HHsearch alignment for GI: 254780700 and conserved domain: KOG2921

>KOG2921 consensus.
Probab=94.32  E-value=0.0065  Score=37.20  Aligned_cols=51  Identities=12%  Similarity=0.087  Sum_probs=28.0

Q ss_pred             HCCEEEEEEEEECCCCHHHH-CCCCCCCEEEEECCEECCCHHHHHHHHHHHH
Q ss_conf             71520079996068897898-2999888999889999389999999999886
Q gi|254780700|r  405 NKKLVRIVALNPNREREVEA-KGIQKGMTIVSVNTHEVSCIKDVERLIGKAK  455 (489)
Q Consensus       405 ~~~~~gi~vv~v~~~s~Aa~-~GL~~GDiIl~VNg~~V~s~~dl~~iL~~~k  455 (489)
T Consensus       216 ya~g~gV~Vtev~~~Spl~gprGL~vgdvitsldgcpV~~v~dW~ecl~tsl  267 (484)
T KOG2921         216 YAHGEGVTVTEVPSVSPLFGPRGLSVGDVITSLDGCPVHKVSDWLECLATSL  267 (484)
T ss_pred             HHCCCEEEEEECCCCCCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHC
T ss_conf             6638507999445557775765677665577537854588889999998644