HHsearch alignment for GI: 254780700 and conserved domain: KOG3532

>KOG3532 consensus.
Probab=96.24  E-value=0.018  Score=34.33  Aligned_cols=48  Identities=27%  Similarity=0.360  Sum_probs=40.4

Q ss_pred             CCCEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCEEEEECCCC
Q ss_conf             441132011111211346711678887524314787431012220356
Q gi|254780700|r  305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRS  352 (489)
Q Consensus       305 ~~GvlV~~V~~~sPA~~AGLk~GDvI~~ing~~I~~~~~l~~~i~~~~  352 (489)
T Consensus       397 ~~~v~v~tv~~ns~a~k~~~~~gdvlvai~~~pi~s~~q~~~~~~s~~  444 (1051)
T KOG3532         397 NRAVKVCTVEDNSLADKAAFKPGDVLVAINNVPIRSERQATRFLQSTT  444 (1051)
T ss_pred             CEEEEEEEECCCCHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHCC
T ss_conf             637899970689754675268655699855852315999999998614