HHsearch alignment for GI: 254780700 and conserved domain: KOG3542

>KOG3542 consensus.
Probab=96.91  E-value=0.00026  Score=46.05  Aligned_cols=39  Identities=26%  Similarity=0.386  Sum_probs=29.4

Q ss_pred             CCCCCEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             444411320111112113467116788875243147874
Q gi|254780700|r  303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH  341 (489)
Q Consensus       303 ~~~~GvlV~~V~~~sPA~~AGLk~GDvI~~ing~~I~~~  341 (489)
T Consensus       559 EkGfgifV~~V~pgskAa~~GlKRgDqilEVNgQnfeni  597 (1283)
T KOG3542         559 EKGFGIFVAEVFPGSKAAREGLKRGDQILEVNGQNFENI  597 (1283)
T ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCHHHH
T ss_conf             556406886306884677765420114321045232220