HHsearch alignment for GI: 254780700 and conserved domain: KOG3550

>KOG3550 consensus.
Probab=93.96  E-value=0.22  Score=27.42  Aligned_cols=58  Identities=17%  Similarity=0.240  Sum_probs=40.8

Q ss_pred             CCCEEEECCCCCCCCCCCC-CHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEEC
Q ss_conf             4411320111112113467-116788875243147874310122203566752010120
Q gi|254780700|r  305 TKGSLITAVVKESPADKAG-MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC  362 (489)
Q Consensus       305 ~~GvlV~~V~~~sPA~~AG-Lk~GDvI~~ing~~I~~~~~l~~~i~~~~~G~~v~l~v~  362 (489)
T Consensus       114 nspiyisriipggvadrhgglkrgdqllsvngvsvege~hekavellkaa~gsvklvvr  172 (207)
T KOG3550         114 NSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAVGSVKLVVR  172 (207)
T ss_pred             CCCEEEEEECCCCCCCCCCCCCCCCEEEEECCEEECCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             89647886247752001376445564676546420313169999999973576789876