HHsearch alignment for GI: 254780700 and conserved domain: KOG3580

>KOG3580 consensus.
Probab=98.39  E-value=2.6e-07  Score=65.24  Aligned_cols=60  Identities=22%  Similarity=0.298  Sum_probs=47.2

Q ss_pred             CCCEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC--CEEEEECCCCCCCCEEEEECCC
Q ss_conf             44113201111121134671167888752431478743--1012220356675201012047
Q gi|254780700|r  305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ--DFVWQIASRSPKEQVKISLCKE  364 (489)
Q Consensus       305 ~~GvlV~~V~~~sPA~~AGLk~GDvI~~ing~~I~~~~--~l~~~i~~~~~G~~v~l~v~R~  364 (489)
T Consensus       428 DVGIFVaGvqegspA~~eGlqEGDQIL~VN~vdF~nl~REeAVlfLL~lPkGEevtilaQ~k  489 (1027)
T KOG3580         428 DVGIFVAGVQEGSPAEQEGLQEGDQILKVNTVDFRNLVREEAVLFLLELPKGEEVTILAQSK  489 (1027)
T ss_pred             CEEEEEEECCCCCCHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEEEHHHHH
T ss_conf             23588741126883011130003626775363301042788899986289976776134356