HHsearch alignment for GI: 254780700 and conserved domain: KOG4371

>KOG4371 consensus.
Probab=94.88  E-value=0.032  Score=32.80  Aligned_cols=140  Identities=16%  Similarity=0.203  Sum_probs=67.2

Q ss_pred             CCCHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEECCCCCEEEECCCCCCCCC-CCCCCCCC--CCCCCCCCEEE
Q ss_conf             6711678887524314787431012220356675201012047816651255655876-31000012--46545254698
Q gi|254780700|r  322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT-AKNDMHLE--VGDKELLGMVL  398 (489)
Q Consensus       322 AGLk~GDvI~~ing~~I~~~~~l~~~i~~~~~G~~v~l~v~R~g~~~~~~V~l~~~p~-~~~~~~~~--~~~~~~lGl~v  398 (489)
T Consensus      1185 pd~~~g~~l~~~n~i~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~-d~~~~s~~~~~~~l~~~~~~~~p~~~~~~~~ 1263 (1332)
T KOG4371        1185 PDIRVGDVLLYVNGIAVEGKVHQEVVAMLRGGGDRVVLGVQRPPPAYS-DQHHASSTSASAPLISVMLLKKPMATLGLSL 1263 (1332)
T ss_pred             CCCCHHHHHHHCCCEEEECHHHHHHHHHHHCCCCEEEEEEECCCCCCC-CCHHHHHHCCCCHHHHHEEEECCCCCCCCCC
T ss_conf             873200222113443442024699999875467537887305884224-4222221024430222024504533466653


Q ss_pred             EECCHHHCCEEEEEEEEECCCCHHHHCC-CCCCCEEEEECCEECCCHHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             7289657152007999606889789829-998889998899993899999999998862599569999971
Q gi|254780700|r  399 QDINDGNKKLVRIVALNPNREREVEAKG-IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY  468 (489)
Q Consensus       399 ~~l~~~~~~~~gi~vv~v~~~s~Aa~~G-L~~GDiIl~VNg~~V~s~~dl~~iL~~~k~~~~~~VLL~V~r  468 (489)
T Consensus      1264 ~~~~~s----~~~~~~~~~~~~~a~~~~~~r~g~~~~~~~~~~~~~~~p-~~~l~~~~~v~-~p~~~~~~~ 1328 (1332)
T KOG4371        1264 AKRTMS----DGIFIRNIAQDSAASSEGTLRVGDRLVSLDGEPVDGFTP-ATILEKLKLVQ-GPVQITVTR 1328 (1332)
T ss_pred             CCCCCC----CCEEEECCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCH-HHHHHHHHHCC-CCHHHEEHH
T ss_conf             335767----863540111444445544210365533258866789874-89998742114-756210015