HHsearch alignment for GI: 254780700 and conserved domain: PRK09681

>PRK09681 putative type II secretion protein GspC; Provisional.
Probab=97.23  E-value=0.0025  Score=39.89  Aligned_cols=59  Identities=19%  Similarity=0.343  Sum_probs=45.8

Q ss_pred             EEEECCCCHH-HHCCCCCCCEEEEECCEECCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCC
Q ss_conf             9960688978-982999888999889999389999999999886259956999997177643
Q gi|254780700|r  413 ALNPNREREV-EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ  473 (489)
Q Consensus       413 vv~v~~~s~A-a~~GL~~GDiIl~VNg~~V~s~~dl~~iL~~~k~~~~~~VLL~V~r~~~~~  473 (489)
T Consensus       253 Rl~PGkd~~lF~~~Glq~gDlavsiNG~dLtDp~~a~~~~~~l~~a--te~~ltVeRdGq~~  312 (319)
T PRK09681        253 AVKPGADRSLFDASGFKEGDIAIALNQQDFTDPRAMIALMRQLPSM--DSIQLTVLRKGARY  312 (319)
T ss_pred             EECCCCCHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHC--CEEEEEEEECCEEE
T ss_conf             7279988899997299988888982696678989999999960007--15589999799689