HHsearch alignment for GI: 254780700 and conserved domain: PRK10139

>PRK10139 serine endoprotease; Provisional.
Probab=99.09  E-value=1.2e-09  Score=80.04  Aligned_cols=81  Identities=15%  Similarity=0.172  Sum_probs=64.5

Q ss_pred             CCCCCEEEEECCHHHCCE------EEEEEEEECCCCHHHHCCCCCCCEEEEECCEECCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             452546987289657152------00799960688978982999888999889999389999999999886259956999
Q gi|254780700|r  391 KELLGMVLQDINDGNKKL------VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL  464 (489)
Q Consensus       391 ~~~lGl~v~~l~~~~~~~------~gi~vv~v~~~s~Aa~~GL~~GDiIl~VNg~~V~s~~dl~~iL~~~k~~~~~~VLL  464 (489)
T Consensus       266 rg~LGv~~~~lt~~~a~~~gl~~~~GalV~~V~~~sPA~kAGLk~GDVI~~vnG~~V~~~~dL~~~v~~~~pG--~~v~l  343 (455)
T PRK10139        266 RGLLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPNSGSAKAGVKSGDIITSLNGKPLNSFAELRSRIATTEPG--TKVKL  343 (455)
T ss_pred             CCEEEEEEEECCHHHHHHCCCCCCCCCEEEEECCCCCHHHCCCCCCCEEEEECCEECCCHHHHHHHHHCCCCC--CEEEE
T ss_conf             3156688765265566541677777735665447883687699999999998998968999999999608988--88999


Q ss_pred             EEEECCCCC
Q ss_conf             997177643
Q gi|254780700|r  465 QIKYDPDMQ  473 (489)
Q Consensus       465 ~V~r~~~~~  473 (489)
T Consensus       344 ~v~R~Gk~~  352 (455)
T PRK10139        344 GLLRNGKPL  352 (455)
T ss_pred             EEEECCEEE
T ss_conf             999999799