HHsearch alignment for GI: 254780700 and conserved domain: PRK11186

>PRK11186 carboxy-terminal protease; Provisional.
Probab=98.66  E-value=2.2e-08  Score=72.07  Aligned_cols=60  Identities=28%  Similarity=0.408  Sum_probs=46.2

Q ss_pred             CCEEEECCCCCCCCCCCC-CHHHHHHHHH--CCCCCCCCC-----CEEEEECCCCCCCCEEEEECCCCC
Q ss_conf             411320111112113467-1167888752--431478743-----101222035667520101204781
Q gi|254780700|r  306 KGSLITAVVKESPADKAG-MKVGDVICML--DGRIIKSHQ-----DFVWQIASRSPKEQVKISLCKEGS  366 (489)
Q Consensus       306 ~GvlV~~V~~~sPA~~AG-Lk~GDvI~~i--ng~~I~~~~-----~l~~~i~~~~~G~~v~l~v~R~g~  366 (489)
T Consensus       257 ~~~~Iv~~i~GgPA~k~g~L~~gD~Ii~V~q~~~~~~dviG~~lddvV~lIR-G~kGT~V~L~I~r~~~  324 (673)
T PRK11186        257 DYTVIKSLVAGGPAAKSKKLSVGDKIVGVGQDGKEIVDVIGWRLDDVVALIK-GPKGSKVRLEILPAGK  324 (673)
T ss_pred             CEEEEEEECCCCHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHC-CCCCCEEEEEEEECCC
T ss_conf             9899997068995887389998999998257898742023765999999853-8998879999997888