HHsearch alignment for GI: 254780700 and conserved domain: TIGR03279

>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase. Members of this protein family are predicted FeS-containing oxidoreductases of unknown function, apparently restricted to and universal across the Cyanobacteria. The high trusted cutoff score for this model, 700 bits, excludes homologs from other lineages. This exclusion seems justified because a significant number of sequence positions are simultaneously unique to and invariant across the Cyanobacteria, suggesting a specialized, conserved function, perhaps related to photosynthesis. A distantly related protein family, TIGR03278, in universal in and restricted to archaeal methanogens, and may be linked to methanogenesis.
Probab=98.31  E-value=1.4e-07  Score=66.92  Aligned_cols=38  Identities=26%  Similarity=0.463  Sum_probs=18.1

Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCEEEE
Q ss_conf             20111112113467116788875243147874310122
Q gi|254780700|r  310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ  347 (489)
Q Consensus       310 V~~V~~~sPA~~AGLk~GDvI~~ing~~I~~~~~l~~~  347 (489)
T Consensus         2 I~~V~pgSiA~e~Gie~GD~llsING~~i~DiiDy~f~   39 (433)
T TIGR03279         2 ISAVLPGSIAEELGFEPGDALVSINGVAPRDLIDYQFL   39 (433)
T ss_pred             EEEECCCCHHHHHCCCCCCEEEEECCCCCCCCEEEEEC
T ss_conf             41577999789838999988998899455551434112