HHsearch alignment for GI: 254780700 and conserved domain: cd00190

>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.
Probab=98.40  E-value=6.1e-06  Score=56.51  Aligned_cols=136  Identities=23%  Similarity=0.335  Sum_probs=73.6

Q ss_pred             CCEEEEEECCCCEEEECHHCCCC--CCEEEEECCC---------CEEEEEC-CCC------CCCCCCEEEEEEECCC---
Q ss_conf             34027897599629851010478--7143796289---------8067401-112------3344432899960676---
Q gi|254780700|r  109 MFGSGFFITDDGYILTSNHIVED--GASFSVILSD---------DTELPAK-LVG------TDALFDLAVLKVQSDR---  167 (489)
Q Consensus       109 ~~GsG~ii~~~G~ilTn~hvv~~--a~~i~V~~~d---------g~~~~a~-vvg------~D~~~DlAvlki~~~~---  167 (489)
T Consensus        25 ~~CgGtLIs~~-~VLTAAHCv~~~~~~~~~V~~G~~~~~~~~~~~~~~~v~~i~~Hp~y~~~~~~~DIALl~L~~~v~~~  103 (232)
T cd00190          25 HFCGGSLISPR-WVLTAAHCVYSSAPSNYTVRLGSHDLSSNEGGGQVIKVKKVIVHPNYNPSTYDNDIALLKLKRPVTLS  103 (232)
T ss_pred             EEEEEEEECCC-EEEECHHHCCCCCCCCEEEEEEEEECCCCCCCCEEEEEEEEEECCCCCCCCCCCCEEEEECCCCEEEC
T ss_conf             99999995399-99989666789998657999956345888999689999999989988888877758877057732822


Q ss_pred             -CCCCCCCCC-CCCCCCCCEEEEECCCCCCCC----------CCCCCCCCCCC--CCCC---CCCCCEEEE-----EEEE
Q ss_conf             -676556556-731112414675236655311----------11258744311--2233---443420233-----2332
Q gi|254780700|r  168 -KFIPVEFED-ANNIRVGEAVFTIGNPFRLRG----------TVSAGIVSALD--RDIP---DRPGTFTQI-----DAPI  225 (489)
Q Consensus       168 -~~~~~~lg~-s~~~~~G~~v~aiG~P~g~~~----------tvt~GiiSa~~--R~~~---~~~~~~iqt-----Da~I  225 (489)
T Consensus       104 ~~v~picLp~~~~~~~~~~~~~~~Gw--G~~~~~~~~~~~L~~~~~~v~~~~~C~~~~~~~~~~~~~~iCa~~~~~~~~~  181 (232)
T cd00190         104 DNVRPICLPSSGYNLPAGTTCTVSGW--GRTSEGGPLPDVLQEVNVPIVSNAECKRAYSYGGTITDNMLCAGGLEGGKDA  181 (232)
T ss_pred             CCCCEEECCCCCCCCCCCCEEEEECC--CCCCCCCCCCCEEEEEEEEECCHHHHHHHHCCCCCCCCCEEEECCCCCCCCC
T ss_conf             56741677986666679978998532--5436898778855899998768999867635688658873772747999740


Q ss_pred             ECCCCCCEEEEC---CCEEEEEECC
Q ss_conf             013477035403---4303555123
Q gi|254780700|r  226 NQGNSGGPCFNA---LGHVIGVNAM  247 (489)
Q Consensus       226 npGnSGGpl~n~---~G~viGint~  247 (489)
T Consensus       182 C~GDsGgPL~~~~~~~~~l~Gi~S~  206 (232)
T cd00190         182 CQGDSGGPLVCNDNGRGVLVGIVSW  206 (232)
T ss_pred             CCCCCCCEEEEEECCCEEEEEEEEE
T ss_conf             4340389479978991999999998