HHsearch alignment for GI: 254780700 and conserved domain: cd00988

>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
Probab=99.03  E-value=2.9e-11  Score=90.45  Aligned_cols=68  Identities=32%  Similarity=0.563  Sum_probs=53.7

Q ss_pred             CCCEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCC--CCEEEEECCCCCCCCEEEEECC-CCCEEEECCC
Q ss_conf             4411320111112113467116788875243147874--3101222035667520101204-7816651255
Q gi|254780700|r  305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH--QDFVWQIASRSPKEQVKISLCK-EGSKHSVAVV  373 (489)
Q Consensus       305 ~~GvlV~~V~~~sPA~~AGLk~GDvI~~ing~~I~~~--~~l~~~i~~~~~G~~v~l~v~R-~g~~~~~~V~  373 (489)
T Consensus        12 ~~~~~V~~v~~gsPA~~aGl~~GD~I~~Vng~~v~~~~~~~~~~~lr-g~~Gt~V~l~v~R~~~~~~~~~l~   82 (85)
T cd00988          12 DGGLVITSVLPGSPAAKAGIKAGDIIVAIDGEPVDGLSLEDVVKLLR-GKAGTKVRLTLKRGDGEPREVTLT   82 (85)
T ss_pred             CCEEEEEEECCCCHHHHHCCCCCCEEEEECCEECCCCCHHHHHHHHC-CCCCCEEEEEEECCCCCEEEEEEE
T ss_conf             99899999689995898089999999999999978999999999865-999988999999099989999999