HHsearch alignment for GI: 254780700 and conserved domain: pfam03761

>pfam03761 DUF316 Domain of unknown function (DUF316). This family of proteins with unknown function are from Caenorhabditis elegans. The protein has GO references indicating the protein is a positive regulator of growth rate and is also involved in nematode larval development.
Probab=94.66  E-value=0.31  Score=26.49  Aligned_cols=128  Identities=21%  Similarity=0.308  Sum_probs=65.2

Q ss_pred             CCCEEEEEECCCCEEEECHHCCCCCCE----------------------------EEEEC---CCCE------EEEECCC
Q ss_conf             234027897599629851010478714----------------------------37962---8980------6740111
Q gi|254780700|r  108 LMFGSGFFITDDGYILTSNHIVEDGAS----------------------------FSVIL---SDDT------ELPAKLV  150 (489)
Q Consensus       108 ~~~GsG~ii~~~G~ilTn~hvv~~a~~----------------------------i~V~~---~dg~------~~~a~vv  150 (489)
T Consensus        68 ~~~~~gT~IS~R-HiLTss~~~l~~~~~~~~~~~~~~~C~g~~~~l~vP~~~l~~~~v~~~~~~~~~~~~~~~v~ka~il  146 (280)
T pfam03761        68 NYKPPATFISTR-HILTSSRLFLNGKMLNWKNTGDNDTCSGGLGHLEVPPEVLDKFDIMDLSKKKGKNSFRDNITRAYVL  146 (280)
T ss_pred             CEEECEEEEECC-EEEEEEEEEEECCEECCCCCCCCCCCCCCCCCEECCHHHHHCEEEEECCCCCCCCCCCCCEEEEEEE
T ss_conf             146220783020-0556623687344101245676755679972424888886166786025556776442551699999


Q ss_pred             CCC----CCCCEE----EEEEECCC-CCCCCCCCC-CCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC--CCC--CC
Q ss_conf             233----444328----99960676-676556556-73111241467523665531111258744311223--344--34
Q gi|254780700|r  151 GTD----ALFDLA----VLKVQSDR-KFIPVEFED-ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI--PDR--PG  216 (489)
Q Consensus       151 g~D----~~~DlA----vlki~~~~-~~~~~~lg~-s~~~~~G~~v~aiG~P~g~~~tvt~GiiSa~~R~~--~~~--~~  216 (489)
T Consensus       147 n~C~~~~~~~~~~~~pMIiEL~~~~~n~s~~Clad~~~~~~~~~~~~~yG~~~--~~~l----~---~~~~~i~~~~~~~  217 (280)
T pfam03761       147 NICANTKSKFDLSAKPMLVELEGPEPNISYPCLADESTSLEKGDAVDVYGIDS--SGEL----K---HRKLNIVNCYSND  217 (280)
T ss_pred             ECCCCCCCCCCCCCCCEEEEEECCCCCCCCCEECCCHHHCCCCCCEEEECCCC--CCCE----E---ECCCEEEECCCCH
T ss_conf             41357766553346646999823534687632056412101476147742588--8733----6---5132044035634


Q ss_pred             CEEEEEEEEECCCCCCEEE---ECCCEEEEEE
Q ss_conf             2023323320134770354---0343035551
Q gi|254780700|r  217 TFTQIDAPINQGNSGGPCF---NALGHVIGVN  245 (489)
Q Consensus       217 ~~iqtDa~InpGnSGGpl~---n~~G~viGin  245 (489)
T Consensus       218 ~~v~~~~~~~~gd~GG~li~~~~gk~tviGi~  249 (280)
T pfam03761       218 LSIGTDQYLCKGDDGGPLIKNVSGKNTVIGFG  249 (280)
T ss_pred             HHEECCCCCCCCCCCCCEEEEECCCEEEEEEE
T ss_conf             42005577445775761079888948999996