HHsearch alignment for GI: 254780700 and conserved domain: pfam04495

>pfam04495 GRASP55_65 GRASP55/65 family. GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous. GRASP55 is a component of the Golgi stacking machinery. GRASP65, an N-ethylmaleimide- sensitive membrane protein required for the stacking of Golgi cisternae in a cell-free system.
Probab=97.24  E-value=0.0085  Score=36.43  Aligned_cols=84  Identities=18%  Similarity=0.241  Sum_probs=55.5

Q ss_pred             CCCCCCCCCCHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCHH-HHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEE
Q ss_conf             43320003421667644176444411320111112113467116-78887524314787431012220356675201012
Q gi|254780700|r  283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV-GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL  361 (489)
Q Consensus       283 g~lGv~~~~v~~~la~~lgl~~~~GvlV~~V~~~sPA~~AGLk~-GDvI~~ing~~I~~~~~l~~~i~~~~~G~~v~l~v  361 (489)
T Consensus        26 ~lLG~si~~~~~~------~a~~~~whvl~v~~~SPA~~AgL~~~~DYIiG~~~~~l~~~~~l~~~v~~-~~~~~l~lyV   98 (280)
T pfam04495        26 GLLGLSLRWCSFS------GANENVWHVLDVHPNSPAALAGLQPYSDYIIGTDSGLLRGEDDLFELVES-HEGRPLKLYV   98 (280)
T ss_pred             CCEEEEEEECCCC------CCCCEEEEEEECCCCCHHHHCCCCCCCCEEEECCCCCCCCHHHHHHHHHH-HCCCCEEEEE
T ss_conf             6305799841565------65330689984489997997488877786873684231456789999997-3699769999


Q ss_pred             CCCCCE--EEECCC
Q ss_conf             047816--651255
Q gi|254780700|r  362 CKEGSK--HSVAVV  373 (489)
Q Consensus       362 ~R~g~~--~~~~V~  373 (489)
T Consensus        99 YN~~~d~~R~V~i~  112 (280)
T pfam04495        99 YNSETDVVREVTIT  112 (280)
T ss_pred             ECCCCCCEEEEEEE
T ss_conf             65788836789985