BLAST/PSIBLAST alignment of GI: 254780700 and GI: 15964774 at iteration 1
>gi|15964774|ref|NP_385127.1| protease precursor protein [Sinorhizobium meliloti 1021] Length = 504
>gi|7531139|sp|Q52894|DEGP_RHIME RecName: Full=Probable serine protease do-like; Flags: Precursor Length = 504
>gi|15073952|emb|CAC45593.1| Probable serine protease [Sinorhizobium meliloti 1021] Length = 504
 Score =  306 bits (783), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 181/475 (38%), Positives = 268/475 (56%), Gaps = 47/475 (9%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQM-----FNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
           V+  VSP++VSV V+ +++VS ++      F   GF +LPEDHPL+ +FR+     F+  
Sbjct: 44  VVDAVSPAVVSVRVQARERVSDDESNFTFDFGGRGFEDLPEDHPLRRFFRE-----FAPR 98

Query: 98  E------------PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           E            P     +     GSGFFIT+DGY++T+NH+V DG++F+VI++D TEL
Sbjct: 99  ENDRADRWRDRRGPRGEGRLRPRAQGSGFFITEDGYLVTNNHVVSDGSAFTVIMNDGTEL 158

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            AKLVG D+  DLAVLKV   RKF  V F D   +RVG+ V  +GNPF L GTV+AGI+S
Sbjct: 159 DAKLVGKDSRTDLAVLKVDDKRKFTYVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIIS 218

Query: 206 ALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPL 264
           A  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +    ++G+   IP 
Sbjct: 219 ARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPA 278

Query: 265 SIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGM 324
           S+ K  + SLI  G V  GW G+  Q +T+++A  LGL    G+L+      SP +KAG+
Sbjct: 279 SVAKDVVDSLIKDGTVSRGWLGVQIQPVTKDIAESLGLSEANGALVVEPQAGSPGEKAGI 338

Query: 325 KVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM 384
           K GDV+  L+G  +K  +D   ++A+  P    +++L + G   +V + +G+ P+   + 
Sbjct: 339 KNGDVVTALNGEPVKDPRDLARRVAALRPGSTAEVTLWRSGKSETVNLEIGTLPSDAKEP 398

Query: 385 HLEVGDKEL------------LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMT 432
               G+ +             LG+ +    DG  K V I +++P  + +   +G+++G  
Sbjct: 399 APATGEAQPDEGQAGEEALADLGLTVTPSEDG--KGVTIASVDP--DSDAGDRGLKEGEK 454

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           IVSVN  EV    DV ++I  AK+  R   L QI    + Q G    SRFV+L I
Sbjct: 455 IVSVNNQEVKSADDVLKVINNAKKDGRSKALFQI----EAQEG----SRFVALPI 501