BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780700|ref|YP_003065113.1| serine protease DO-like
protease [Candidatus Liberibacter asiaticus str. psy62]
         (489 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780700|ref|YP_003065113.1| serine protease DO-like protease [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040377|gb|ACT57173.1| serine protease DO-like protease [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 489

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/489 (100%), Positives = 489/489 (100%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK
Sbjct: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG
Sbjct: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI
Sbjct: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
           RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH
Sbjct: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL
Sbjct: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS
Sbjct: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER 420
           LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER
Sbjct: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER 420

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
           EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS
Sbjct: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480

Query: 481 RFVSLKIDK 489
           RFVSLKIDK
Sbjct: 481 RFVSLKIDK 489


>gi|315121865|ref|YP_004062354.1| serine protease DO-like protease [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495267|gb|ADR51866.1| serine protease DO-like protease [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 490

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 271/493 (54%), Positives = 362/493 (73%), Gaps = 13/493 (2%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MFK  ILS+++I    L  + F+ST  V EA++PPS+ DL P++ RVS S+VS++VEPKK
Sbjct: 1   MFKSHILSIRNISITVLMYIFFASTCFVAEARIPPST-DLVPIVERVSRSVVSILVEPKK 59

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           +V  ++    YGF  LP+ +PLKNY     H FFS E    +   E+L  GSGFF+T++G
Sbjct: 60  EVLEKEFLKLYGFDTLPDSNPLKNYL----HNFFSNEGNESAGITEKLASGSGFFVTENG 115

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y+LTSNH+VE G SFSV+LSD+TE PAK++GTD + DLAVLKVQS++KF+PV+ ED+ N+
Sbjct: 116 YVLTSNHVVERGVSFSVVLSDNTEFPAKVIGTDPMSDLAVLKVQSNQKFVPVKLEDSGNV 175

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
            VGE VFTIG+P   RG+V+AGIVSA DR + D+ G++ QIDAPINQGNSGGPCFN  G+
Sbjct: 176 HVGETVFTIGDPLGFRGSVNAGIVSARDRVLADKSGSYIQIDAPINQGNSGGPCFNTSGN 235

Query: 241 VIGVNAMIVTSGQ--FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           VIGV+ +I+T+ +   ++G+GLI+P+S+IKK +PSLI KG VD GW G++ QNLTQELA 
Sbjct: 236 VIGVSDIIITNNESASNVGIGLIVPVSVIKKVLPSLIEKGFVDRGWMGVVVQNLTQELAR 295

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
           PLGL+G  G L+++ VK+SP+D+AG+K GDVIC +DG+IIK+  DFV +I S S K++V+
Sbjct: 296 PLGLKGGNGLLVSSTVKDSPSDRAGIKPGDVICAIDGQIIKNTHDFVGRILSHSSKDKVE 355

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKN-DMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPN 417
           I LCKEG   SV V L S P  K  D    +  K++LG+ LQD N G KK+VRIV ++  
Sbjct: 356 IRLCKEGGDRSVPVYLESYPLVKEGDAKQLLATKKILGLRLQDFNYGTKKIVRIVDMDLG 415

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
              E   KGIQKGM IVSVNT++VSCIKD+E LI +A+EK RD++LLQ+  D D +  ++
Sbjct: 416 --AEAVRKGIQKGMNIVSVNTNQVSCIKDIESLIEQAREKNRDTILLQLSVDNDAKFNSN 473

Query: 478 ---NMSRFVSLKI 487
              N   FVSLKI
Sbjct: 474 FYKNNVFFVSLKI 486


>gi|163759094|ref|ZP_02166180.1| protease precursor protein [Hoeflea phototrophica DFL-43]
 gi|162283498|gb|EDQ33783.1| protease precursor protein [Hoeflea phototrophica DFL-43]
          Length = 523

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 191/493 (38%), Positives = 280/493 (56%), Gaps = 51/493 (10%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPK-KKVSVEQMF----NAYGFGNLPEDHPLK 83
           +EA   PS  D   V+  VSP++VSV V+ + + VS +  F    N  GF +LP DHP+K
Sbjct: 49  VEAPQAPSFAD---VVEAVSPAVVSVRVQAEVRPVSNDGPFSFDFNGRGFDDLPNDHPMK 105

Query: 84  NYFRKDFHKFFSGEEPILSDTVER-------------LMFGSGFFITDDGYILTSNHIVE 130
            +F  +F + F GE    ++   R             +  GSGFFI+ DGY++T+NH++E
Sbjct: 106 RFF-DEFRRGFGGEPDRRAERDRRGPDGQGRPGRVRPVSQGSGFFISGDGYLVTNNHVIE 164

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
           +GA+F+VI+ D +EL AKL+G D+  DLAVLKV+ DR+FI V+F D + IRVG+ V  +G
Sbjct: 165 NGATFTVIMDDGSELDAKLIGRDSRTDLAVLKVEEDREFIYVDFADDSKIRVGDWVVAVG 224

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           NPF L GTV+AGIVSA  RDI   P   F Q+DA +N+GNSGGP FN  G VIG+N  I 
Sbjct: 225 NPFGLGGTVTAGIVSARGRDIGAGPYDDFIQVDAAVNRGNSGGPTFNLSGEVIGINTAIF 284

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +    ++G+   IP S  +  I  LI  G V+ GW G+  Q +T ++A  LGL   +G+L
Sbjct: 285 SPSGGNVGIAFAIPASTARTVINDLIDSGSVERGWLGVQIQPVTADIAESLGLAEAQGAL 344

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           ITA   ++PA KAG++ GDV+  +DG  ++  +D   +IA+  P + V+I++ + G   +
Sbjct: 345 ITAPQDDAPAAKAGIEAGDVVTAVDGNAVEDPRDLAKKIAAMDPGKTVEITVWRNGKSEA 404

Query: 370 VAVVLGSSPTAKNDMHLEVGDKEL-------------LGMVLQDINDGNKKLVRIVALNP 416
           V V LGS PT    +     D+E               G+ +     G+  L+  VA   
Sbjct: 405 VEVELGSLPTEVAALST---DEETTPSAPQAEATLDSFGLTVVPAETGSGLLITSVA--- 458

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
             +   E +G+Q G  IV+VN  +V+   DV  +I  A    R + L Q++        N
Sbjct: 459 -PDSAAEERGLQAGDVIVAVNNQDVANAADVVGIIDDAASNGRKAALFQVE--------N 509

Query: 477 DNMSRFVSLKIDK 489
           ++ SRFV+L ID+
Sbjct: 510 EDRSRFVALPIDQ 522


>gi|325292355|ref|YP_004278219.1| serine protease DO-like protease [Agrobacterium sp. H13-3]
 gi|325060208|gb|ADY63899.1| serine protease DO-like protease [Agrobacterium sp. H13-3]
          Length = 517

 Score =  310 bits (793), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 183/478 (38%), Positives = 279/478 (58%), Gaps = 49/478 (10%)

Query: 43  VIARVSPSIVSVMVE----PKKKVSVEQMFNAYGFG--NLPEDHPLKNYFRKDF------ 90
           V+  VSP++VSV V+    P    S    FN  G G   LP+DHPLK +F K+F      
Sbjct: 57  VVEAVSPAVVSVRVQSNVQPASDDSSNFSFNFGGRGLDQLPDDHPLKRFF-KEFGGPNQD 115

Query: 91  ------HKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
                 ++   G+ P+       +  GSGFFI++DGY++T+NH+V+DG++++V+++D TE
Sbjct: 116 RPDRGPNRHRDGKGPL-----RPVAQGSGFFISEDGYVVTNNHVVDDGSAYTVVMNDGTE 170

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
           L AKLVG D   DLA+LKV  +RKF  V+F D + IRVG+ V  +GNPF L GTV++GIV
Sbjct: 171 LEAKLVGRDPRTDLALLKVDVNRKFTYVQFADDSKIRVGDWVVAVGNPFGLGGTVTSGIV 230

Query: 205 SALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           SA  RDI   P   + QIDA +N+GNSGGP FN  G V+G+N  I +    ++G+   IP
Sbjct: 231 SARGRDIGSGPYDDYLQIDAAVNRGNSGGPAFNLNGEVVGINTAIFSPSGGNVGIAFAIP 290

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
            S+ K  I  L   G+V+ GW G+  Q +++++A  LGL   KG+L+ +    SP DKAG
Sbjct: 291 SSVAKDVIADLQKDGKVERGWLGVQIQPVSKDIAESLGLAEAKGALVVSPQSGSPGDKAG 350

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-------- 375
           +K GD+I  ++G  +K  +D   +I S +P  +V+ISL + G   SV V LG        
Sbjct: 351 IKQGDIITAVNGDPVKDARDLSRRIGSMTPNSKVEISLWRGGKSQSVTVTLGDLASDDAS 410

Query: 376 -SSPTAKNDMHLEVGDKEL---LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGM 431
            ++P  +ND   +    ++   LG+ +   +DGN   + I  ++P  + +  A+G++ G 
Sbjct: 411 KATPGQENDSGSKPSSAKVLSSLGLTVAPADDGNG--LAITDVDP--DSDAAARGLKTGE 466

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            I SVN  +V+   D+E+++ +AK+  R   L QI+         D+ SRF++L ID+
Sbjct: 467 KITSVNNQQVASAADIEKVLEQAKKDGRSKALFQIQ--------TDSGSRFIALDIDQ 516


>gi|15888320|ref|NP_354001.1| serine protease DO-like protease [Agrobacterium tumefaciens str.
           C58]
 gi|15155988|gb|AAK86786.1| serine protease DO-like protease [Agrobacterium tumefaciens str.
           C58]
          Length = 523

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 181/478 (37%), Positives = 274/478 (57%), Gaps = 48/478 (10%)

Query: 43  VIARVSPSIVSVMVE----PKKKVSVEQMFNAYGFG--NLPEDHPLKNYFRKDFHKFFSG 96
           V+  VSP++VSV V+    P    S    FN  G G   LP+DHPLK +F++     F G
Sbjct: 62  VVDAVSPAVVSVRVQSNVQPASDDSSNFSFNFGGRGLDQLPDDHPLKRFFKE-----FGG 116

Query: 97  EEPILSDT-----------VERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           +    SD            +  +  GSGFFI++DGY++T+NH+V+DG++++V+++D TEL
Sbjct: 117 QNQDRSDRGPNRHRDGKGPLRPVAQGSGFFISEDGYVVTNNHVVDDGSAYTVVMNDGTEL 176

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            AKLVG D   DLA+LKV  +RKF  V+F D   IRVG+ V  +GNPF L GTV++GI+S
Sbjct: 177 EAKLVGRDPRTDLALLKVDVNRKFTYVKFADDTKIRVGDWVVAVGNPFGLGGTVTSGIIS 236

Query: 206 ALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPL 264
           A  RDI   P   + QIDA +N+GNSGGP FN  G V+G+N  I +    ++G+   IP 
Sbjct: 237 ARGRDIGSGPYDDYLQIDAAVNRGNSGGPAFNLNGEVVGINTAIFSPSGGNVGIAFAIPS 296

Query: 265 SIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGM 324
           S+ K  I  L   G+V+ GW G+  Q +++++A  LGL   KG+L+ +    SP DKAG+
Sbjct: 297 SVAKDVIADLQKDGKVERGWLGVQIQPVSKDIAESLGLAEAKGALVVSPQSGSPGDKAGI 356

Query: 325 KVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG--------- 375
           K GD+I  ++G  +K  +D   +I   +P  +V+ISL + G   SV V LG         
Sbjct: 357 KQGDIITAVNGDPVKDARDLSRRIGGMAPNSKVEISLWRGGKSQSVTVTLGDLTSDEASK 416

Query: 376 SSPTAKNDMHLEVGDKE----LLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGM 431
           ++P+  +D        E     LG+ +   +DGN   + I  ++P  + +  A+G++ G 
Sbjct: 417 ATPSQNDDKGGSQSSSEKVLSSLGLTVSPSDDGNG--LAITDVDP--DSDAAARGLKTGE 472

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            I SVN  +V+   D+E+++ +AK+  R   L QI+         D+ SRF++L ID+
Sbjct: 473 KITSVNNQQVASAADIEKILEQAKKDGRSKALFQIQ--------TDDGSRFIALDIDQ 522


>gi|227821359|ref|YP_002825329.1| serine protease do-like precursor [Sinorhizobium fredii NGR234]
 gi|227340358|gb|ACP24576.1| serine protease do-like precursor [Sinorhizobium fredii NGR234]
          Length = 521

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 189/526 (35%), Positives = 280/526 (53%), Gaps = 66/526 (12%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLP---------------PSSVDLPPVIARVSPSIVSVM 55
           S+ TV  T  +     ++L   LP               PS      V+  VSP++VSV 
Sbjct: 10  SLKTVLKTSTVAGLAAVMLTTGLPAQITQSFAEAVKVQAPSVPSFANVVDAVSPAVVSVR 69

Query: 56  VEPKKKVSVEQM-----FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE------------ 98
           V+ +++ S ++      F   GF +LP+DHPLK +FR+     F G +            
Sbjct: 70  VQAREQASNDESNFTFDFGGRGFEDLPDDHPLKRFFRE-----FGGPDSRDGDRADRWRD 124

Query: 99  ---PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
              P     +     GSGFFIT+DGY++T+NH+V DG++F+VI++D TEL AKLVG D+ 
Sbjct: 125 RRGPRGEGRLRPRAQGSGFFITEDGYLVTNNHVVSDGSAFTVIMNDGTELDAKLVGKDSR 184

Query: 156 FDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
            DLAVLKV S +RKF  V F D  N+RVG+ V  +GNPF L GTV+AGIVSA  RDI   
Sbjct: 185 TDLAVLKVDSANRKFTHVSFADDKNVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSG 244

Query: 215 P-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
           P   + Q+DA +N+GNSGGP FN  G V+G+N  I +    ++G+   IP S+ K  + S
Sbjct: 245 PYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVVDS 304

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           LI  G V  GW G+  Q +T+++A  LGL    G+L+      SP +KAG+K GD++  L
Sbjct: 305 LIKDGSVSRGWLGVQIQPVTKDIAESLGLSEASGALVVEPQAGSPGEKAGIKKGDIVTAL 364

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL 393
           +G  +K  +D   ++A+  P     ++L ++G   SV + +G+ P        +  D++ 
Sbjct: 365 NGEPVKDPRDLARRVATMRPGATADVTLWRDGKSQSVKLEIGTLPEEAKATTPDTSDEQT 424

Query: 394 ------------LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEV 441
                       LG+ +    DG    V I +++P  + +   +G+++G  IVSVN  EV
Sbjct: 425 DQGQAGEEALADLGLAVTPSEDGAG--VTIASVDP--DSDAADRGLKEGEKIVSVNNQEV 480

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
               D+ ++I  AK+  R   L QI+         D  SRFV+L I
Sbjct: 481 KSADDILKVINNAKKDGRSKALFQIQA--------DEGSRFVALPI 518


>gi|150395861|ref|YP_001326328.1| protease Do [Sinorhizobium medicae WSM419]
 gi|150027376|gb|ABR59493.1| protease Do [Sinorhizobium medicae WSM419]
          Length = 517

 Score =  306 bits (785), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 184/518 (35%), Positives = 280/518 (54%), Gaps = 48/518 (9%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKLP---------------PSSVDLPPVIARVSPSIV 52
           S  S+ TV  T  +     ++L   LP               P+      V+  VSP++V
Sbjct: 7   SRPSLKTVLKTTTVAGVAAVLLTTGLPAQITQSFAEAVSVPAPAVPSFANVVEAVSPAVV 66

Query: 53  SVMVEPKKKVSVEQM-----FNAYGFGNLPEDHPLKNYFRK-------DFHKFFSGEEPI 100
           SV V+ +++ S ++      F   GF +LPEDHPL+ +FR+          ++     P 
Sbjct: 67  SVRVQAREQASDDESNFTFDFGGRGFDDLPEDHPLRRFFREFDPRDNDRADRWRDRRGPR 126

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
               +     GSGFFIT+DGY++T+NH++ DG++F+VI+ D TEL AKLVG D+  DLAV
Sbjct: 127 GEGRLRPRAQGSGFFITEDGYLVTNNHVISDGSAFTVIMDDGTELEAKLVGKDSRTDLAV 186

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFT 219
           LKV + RKF  V F D   +RVG+ V  +GNPF L GTV+AGI+SA  RDI   P   + 
Sbjct: 187 LKVDAKRKFTHVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIISARGRDIGSGPYDDYL 246

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q+DA +N+GNSGGP FN  G V+G+N  I +    ++G+   IP S+ K  + SLI  G 
Sbjct: 247 QVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVVDSLIKDGT 306

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  GW G+  Q +T+++A  LGL   KG+L+      SP +KAG+K GDV+  L+G  +K
Sbjct: 307 VSRGWLGVQIQPVTKDIAESLGLAEAKGALVVEPQTGSPGEKAGIKNGDVVTALNGEPVK 366

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG---------- 389
             +D   ++A+  P    +++L + G   +V + +G+ P+   +     G          
Sbjct: 367 DPRDLARRVAALRPGSTAEVTLWRSGKSETVKLEIGTLPSDAKETAPTTGEAQPDEGQAS 426

Query: 390 DKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
           D+ L G+ L      + + V I +++P  + +   +G+++G  IVSVN  EV    D+ +
Sbjct: 427 DEALAGLGLTVTPSEDDRGVTITSVDP--DSDASDRGLKQGEKIVSVNNQEVKSADDILK 484

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           +I  A++  R   L QI    + Q G    SRFV+L I
Sbjct: 485 VINNARKDNRTKALFQI----EAQEG----SRFVALPI 514


>gi|15964774|ref|NP_385127.1| protease precursor protein [Sinorhizobium meliloti 1021]
 gi|7531139|sp|Q52894|DEGP_RHIME RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|15073952|emb|CAC45593.1| Probable serine protease [Sinorhizobium meliloti 1021]
          Length = 504

 Score =  306 bits (783), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 181/475 (38%), Positives = 268/475 (56%), Gaps = 47/475 (9%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQM-----FNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
           V+  VSP++VSV V+ +++VS ++      F   GF +LPEDHPL+ +FR+     F+  
Sbjct: 44  VVDAVSPAVVSVRVQARERVSDDESNFTFDFGGRGFEDLPEDHPLRRFFRE-----FAPR 98

Query: 98  E------------PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           E            P     +     GSGFFIT+DGY++T+NH+V DG++F+VI++D TEL
Sbjct: 99  ENDRADRWRDRRGPRGEGRLRPRAQGSGFFITEDGYLVTNNHVVSDGSAFTVIMNDGTEL 158

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            AKLVG D+  DLAVLKV   RKF  V F D   +RVG+ V  +GNPF L GTV+AGI+S
Sbjct: 159 DAKLVGKDSRTDLAVLKVDDKRKFTYVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIIS 218

Query: 206 ALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPL 264
           A  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +    ++G+   IP 
Sbjct: 219 ARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPA 278

Query: 265 SIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGM 324
           S+ K  + SLI  G V  GW G+  Q +T+++A  LGL    G+L+      SP +KAG+
Sbjct: 279 SVAKDVVDSLIKDGTVSRGWLGVQIQPVTKDIAESLGLSEANGALVVEPQAGSPGEKAGI 338

Query: 325 KVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM 384
           K GDV+  L+G  +K  +D   ++A+  P    +++L + G   +V + +G+ P+   + 
Sbjct: 339 KNGDVVTALNGEPVKDPRDLARRVAALRPGSTAEVTLWRSGKSETVNLEIGTLPSDAKEP 398

Query: 385 HLEVGDKEL------------LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMT 432
               G+ +             LG+ +    DG  K V I +++P  + +   +G+++G  
Sbjct: 399 APATGEAQPDEGQAGEEALADLGLTVTPSEDG--KGVTIASVDP--DSDAGDRGLKEGEK 454

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           IVSVN  EV    DV ++I  AK+  R   L QI    + Q G    SRFV+L I
Sbjct: 455 IVSVNNQEVKSADDVLKVINNAKKDGRSKALFQI----EAQEG----SRFVALPI 501


>gi|307309661|ref|ZP_07589313.1| protease Do [Sinorhizobium meliloti BL225C]
 gi|307319458|ref|ZP_07598885.1| protease Do [Sinorhizobium meliloti AK83]
 gi|306894830|gb|EFN25589.1| protease Do [Sinorhizobium meliloti AK83]
 gi|306899873|gb|EFN30496.1| protease Do [Sinorhizobium meliloti BL225C]
          Length = 517

 Score =  305 bits (782), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 181/475 (38%), Positives = 268/475 (56%), Gaps = 47/475 (9%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQM-----FNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
           V+  VSP++VSV V+ +++VS ++      F   GF +LPEDHPL+ +FR+     F+  
Sbjct: 57  VVDAVSPAVVSVRVQARERVSDDESNFTFDFGGRGFEDLPEDHPLRRFFRE-----FAPR 111

Query: 98  E------------PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           E            P     +     GSGFFIT+DGY++T+NH+V DG++F+VI++D TEL
Sbjct: 112 ENDRADRWRDRRGPRGEGRLRPRAQGSGFFITEDGYLVTNNHVVSDGSAFTVIMNDGTEL 171

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            AKLVG D+  DLAVLKV   RKF  V F D   +RVG+ V  +GNPF L GTV+AGI+S
Sbjct: 172 DAKLVGKDSRTDLAVLKVDDKRKFTYVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIIS 231

Query: 206 ALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPL 264
           A  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +    ++G+   IP 
Sbjct: 232 ARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPA 291

Query: 265 SIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGM 324
           S+ K  + SLI  G V  GW G+  Q +T+++A  LGL    G+L+      SP +KAG+
Sbjct: 292 SVAKDVVDSLIKDGTVSRGWLGVQIQPVTKDIAESLGLSEANGALVVEPQAGSPGEKAGI 351

Query: 325 KVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM 384
           K GDV+  L+G  +K  +D   ++A+  P    +++L + G   +V + +G+ P+   + 
Sbjct: 352 KNGDVVTALNGEPVKDPRDLARRVAALRPGSTAEVTLWRSGKSETVNLEIGTLPSDAKEP 411

Query: 385 HLEVGDKEL------------LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMT 432
               G+ +             LG+ +    DG  K V I +++P  + +   +G+++G  
Sbjct: 412 APATGEAQPDEGQAGEEALADLGLTVTPSEDG--KGVTIASVDP--DSDAGDRGLKEGEK 467

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           IVSVN  EV    DV ++I  AK+  R   L QI    + Q G    SRFV+L I
Sbjct: 468 IVSVNNQEVKSADDVLKVINNAKKDGRSKALFQI----EAQEG----SRFVALPI 514


>gi|49475272|ref|YP_033313.1| Serine protease [Bartonella henselae str. Houston-1]
 gi|51704299|sp|P54925|DEGP_BARHE RecName: Full=Probable periplasmic serine protease DO-like;
           AltName: Full=Antigen htrA; Flags: Precursor
 gi|49238078|emb|CAF27285.1| Serine protease [Bartonella henselae str. Houston-1]
          Length = 503

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 185/472 (39%), Positives = 273/472 (57%), Gaps = 49/472 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVS---VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           ++++V P++VSV V+  KK         F+  GF  LP+ HPLK +F+     F++ ++P
Sbjct: 55  IVSQVKPAVVSVQVKSNKKKKEWFFSDFFSTPGFDQLPDQHPLKKFFQD----FYNRDKP 110

Query: 100 I-----LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
                  S  +  + FGSGFFI+ DGYI+T+NH++ DG S++V+L D TEL AKL+GTD 
Sbjct: 111 SNKSLQRSHRLRPIAFGSGFFISSDGYIVTNNHVISDGTSYAVVLDDGTELNAKLIGTDP 170

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             DLAVLKV   RKF  V+F D + +RVG+ V  IGNPF L GTV+AGIVSA  RDI   
Sbjct: 171 RTDLAVLKVNEKRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDI--- 227

Query: 215 PGT-----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKK 269
            GT     F QIDA +N+GNSGGP F+  G V+GVN  I +    ++G+   IP +  K+
Sbjct: 228 -GTGVYDDFIQIDAAVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAATAKQ 286

Query: 270 AIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDV 329
            +  LI KG V  GW G+  Q +T+E++  +GL+  KG+LIT  +K  PA KAG+K GDV
Sbjct: 287 VVQQLIEKGLVQRGWLGVQIQPVTKEISDSIGLKEAKGALITDPLK-GPAAKAGIKAGDV 345

Query: 330 ICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG 389
           I  ++G  I   +D   +IA+ SP E V + + K G + ++ V L S P    D +++ G
Sbjct: 346 IISVNGEKINDVRDLAKRIANMSPGETVTLGVWKSGKEENIKVKLDSMP---EDENMKDG 402

Query: 390 DK------------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVN 437
            K            E  G+++   +DG    V +V  + + + +   KGI+ G  IV+VN
Sbjct: 403 SKYSNEHGNSDETLEDYGLIVAPSDDG----VGLVVTDVDPDSDAADKGIRPGDVIVTVN 458

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              V  + D+   I  A++  R ++LLQ++         ++ +RFV+L I K
Sbjct: 459 NKSVKKVSDITDTIKNAQKLGRKAILLQVR--------TNDQNRFVALPIFK 502


>gi|239831455|ref|ZP_04679784.1| protease Do [Ochrobactrum intermedium LMG 3301]
 gi|239823722|gb|EEQ95290.1| protease Do [Ochrobactrum intermedium LMG 3301]
          Length = 519

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 187/521 (35%), Positives = 286/521 (54%), Gaps = 54/521 (10%)

Query: 10  KSICTVALTCVI---FSSTYLV----------LEAKLPPSSVDLPPVIARVSPSIVSVMV 56
           KS+  +AL+ V+   F +T  +          ++   PP +     ++ +V P++VSV V
Sbjct: 11  KSVAAIALSAVLAGGFVATGPIGALNDARADAVQVTPPPQAAGFADLVEKVRPAVVSVRV 70

Query: 57  EPKKKVSVE----QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE-----EPILSDTVER 107
           +   + + +    Q     GF  LP+DHPLK +FR DF     G+      P      +R
Sbjct: 71  KKDVQQTADRGGGQFSGPQGFYQLPDDHPLKRFFR-DFGMDPRGDARPDARPDRRGPGKR 129

Query: 108 ---------LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
                    +  GSGFFI++DGY++T+NH+V DG ++SV++ D TEL AKL+GTD   DL
Sbjct: 130 GPRPGHERPVAQGSGFFISEDGYVVTNNHVVSDGDAYSVVMDDGTELDAKLIGTDPRTDL 189

Query: 159 AVLKVQSDR-KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-G 216
           AVLKV   + KF  V F D N IRVG+ V  +GNPF L GTV++GIVSA  RDI   P  
Sbjct: 190 AVLKVNDPKQKFTYVAFGDDNKIRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPYD 249

Query: 217 TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F QIDA +N+GNSGGP FN  G VIG+N  I +     +G+   IP S  K+ +  LI 
Sbjct: 250 DFIQIDAAVNKGNSGGPAFNLSGQVIGINTAIFSPSGGSVGIAFAIPASTAKQVVDQLIK 309

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
           KG V+ GW G+  Q +T+++A  LGL   KG+L+ +  K+ PA KAG++ GDVI  ++G 
Sbjct: 310 KGSVERGWIGVQIQPVTKDIAASLGLAEEKGALVASPQKDGPAAKAGIQSGDVITAVNGE 369

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP-----TAKNDMHLEVGDK 391
            ++  +D   ++A  +P E+  +++ ++     ++V + + P     +A        G  
Sbjct: 370 TVQDTRDLARKVAGVAPGEKAALTVWRKNKAEEISVTIEAMPGDLGKSASPSTDNGGGQN 429

Query: 392 ELL---GMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
           E L   G+ +    DGN     +V  + + + +   +GI+ G  IVSVN   V   KD+ 
Sbjct: 430 ETLDSYGLTVTPSEDGNG----VVVTDVDPDSDASDRGIRSGDIIVSVNNQTVKSAKDIN 485

Query: 449 RLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             I +A++  R +VLLQ++        +++ SRFV+L ID+
Sbjct: 486 NAISEAEKSGRKAVLLQLQ--------SNDQSRFVALPIDQ 518


>gi|310329|gb|AAA97430.1| antigen [Bartonella henselae str. Houston-1]
          Length = 503

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 183/472 (38%), Positives = 272/472 (57%), Gaps = 49/472 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVS---VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           ++++V P++VSV V+  KK         F+  GF  LP+ HPLK +F+     F++ ++P
Sbjct: 55  IVSQVKPAVVSVQVKSNKKKKEWFFSDFFSTPGFDQLPDQHPLKKFFQD----FYNRDKP 110

Query: 100 I-----LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
                  S  +  + FGSGFFI+ DGYI+T+NH++ DG S++V+L D TEL AKL+GTD 
Sbjct: 111 SNKSLQRSHRLRPIAFGSGFFISSDGYIVTNNHVISDGTSYAVVLDDGTELNAKLIGTDP 170

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             DLAVLKV   RKF  V+F D + +RVG+ V  IGNPF L GTV+AGIVSA  RDI   
Sbjct: 171 RTDLAVLKVNEKRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDI--- 227

Query: 215 PGT-----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKK 269
            GT     F QIDA +N+GNSGGP F+  G V+GVN  I +    ++G+   IP +   +
Sbjct: 228 -GTGVYDDFIQIDAAVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAATANE 286

Query: 270 AIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDV 329
            +  LI KG V  GW G+  Q +T+E++  +GL+  KG+LIT  +K  PA KAG+K GDV
Sbjct: 287 VVQQLIEKGLVQRGWLGVQIQPVTKEISDSIGLKEAKGALITDPLK-GPAAKAGIKAGDV 345

Query: 330 ICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG 389
           I  ++G  I   +D   +IA+ SP E V + + K G + ++ V L S P    D +++ G
Sbjct: 346 IISVNGEKINDVRDLAKRIANMSPGETVTLGVWKSGKEENIKVKLDSMP---EDENMKDG 402

Query: 390 DK------------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVN 437
            K            E  G+++   +DG    + +V  + + + +   KGI+ G  IV+VN
Sbjct: 403 SKYSNEHGNSDETLEDYGLIVAPSDDG----LGLVVTDVDPDSDAADKGIRPGDVIVTVN 458

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              V  + D+   I  A++  R ++LLQ++         ++ +RFV+L I K
Sbjct: 459 NKSVKKVSDITDTIKNAQKLGRKAILLQVR--------TNDQNRFVALPIFK 502


>gi|209548527|ref|YP_002280444.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534283|gb|ACI54218.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 527

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 182/485 (37%), Positives = 268/485 (55%), Gaps = 56/485 (11%)

Query: 43  VIARVSPSIVSVMVEPK-KKVSVEQMFN--AYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           V+  VSP++VSV VE +   VS    F+    GF +LP+DHPLK +F++     F G++P
Sbjct: 57  VVDAVSPAVVSVRVENRVNPVSDNDGFSIEGRGFDDLPDDHPLKRFFKQ-----FGGQDP 111

Query: 100 ILSDTVER---------------------LMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
                 +R                     +  GSGFFI++DGYI+T+NH+V DG +F  +
Sbjct: 112 SDQQGHQRRFGQNGPGGQNGPGGKGRLRPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAV 171

Query: 139 LSDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRG 197
           ++D TEL AKL+G D   DLAVLKV    +KF  V + D NN+RVG+ V  +GNPF L G
Sbjct: 172 MNDGTELDAKLIGKDPRTDLAVLKVDGKGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGG 231

Query: 198 TVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHM 256
           TV+AGIVSA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +     +
Sbjct: 232 TVTAGIVSARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSV 291

Query: 257 GVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKE 316
           G+   IP S  +  +  L+  G+V  GW G+  Q +T+++A  +GL    G+L+ A    
Sbjct: 292 GIAFAIPASTARDVVADLMKDGQVSRGWLGVQIQPVTKDIAESIGLSEPSGALVVAPQAG 351

Query: 317 SPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           SP DKAGMK GDV+  L+G  IK  +D   +I +  P  +V++S+ + G    + V LG+
Sbjct: 352 SPGDKAGMKAGDVVTALNGETIKDARDLSRRIGAMQPGSKVELSVWRAGKAQPLTVELGT 411

Query: 377 SPTAKNDMHLE-----------VGDKEL--LGMVLQDINDGNKKLVRIVALNPNREREVE 423
            P  + D + +             +K L  LG+ +   +DG  K + I  ++P  + +  
Sbjct: 412 LPADQKDANADDNSQPQQPEAPASEKALADLGLTVGPSDDG--KGLAITGIDP--DSDAA 467

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
            KGI++G  I SVN  EVS   DV +++ +AK+  R   L QI+        +   SRFV
Sbjct: 468 DKGIKEGEKITSVNNQEVSSPADVVKVLNQAKKDGRTRALFQIQ--------SSEGSRFV 519

Query: 484 SLKID 488
           +L I+
Sbjct: 520 ALPIN 524


>gi|86356933|ref|YP_468825.1| serine protease DO-like protein [Rhizobium etli CFN 42]
 gi|86281035|gb|ABC90098.1| serine protease DO-like protein [Rhizobium etli CFN 42]
          Length = 529

 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 181/488 (37%), Positives = 266/488 (54%), Gaps = 60/488 (12%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQM------FNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
           V+  VSP++VSV VE +     +        FN  GF +LP+DHPLK +FR+       G
Sbjct: 57  VVDAVSPAVVSVRVENRVNPVADNNDGFSFDFNGRGFDDLPDDHPLKRFFRQ------FG 110

Query: 97  EEPILSDTVER--------------------LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           ++P      +R                    +  GSGFFI++DGYI+T+NH+V DG +F 
Sbjct: 111 QDPNDQQGHQRRFGQNGPGGPNGPGKGRLRPVAQGSGFFISEDGYIVTNNHVVADGQAFV 170

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            +++D TEL AKL+G D   DLAVLKV    +KF  V + D NN+RVG+ V  +GNPF L
Sbjct: 171 AVMNDGTELDAKLIGKDPRTDLAVLKVDGKGKKFTYVNWADDNNVRVGDWVVAVGNPFGL 230

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV+AGI+SA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +    
Sbjct: 231 GGTVTAGIISARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLNGEVVGINTAIFSPSGG 290

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K  +  L+  G+V  GW G+  Q +T+++A  +GL    G+L+ A  
Sbjct: 291 SVGIAFAIPASTAKDVVADLMKDGQVSRGWLGVQIQPVTKDIAESIGLSEPSGALVVAPQ 350

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
             SP DKAGMK GDV+  L+G  IK  +D   +I +  P  + ++S+ + G   S+ V L
Sbjct: 351 PGSPGDKAGMKAGDVVTALNGETIKDARDLSRRIGAMQPGSKAELSVWRAGKAQSLTVEL 410

Query: 375 GSSPTAKNDMHLE------------VGDKEL--LGMVLQDINDGNKKLVRIVALNPNRER 420
           G+ P  + D + +              +K L  LG+ +   +DG  K + I  ++P  + 
Sbjct: 411 GTLPADQKDANADDNNNQPQQPEAPASEKALADLGLTVGPSDDG--KGLAITGIDP--DS 466

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
           +   KGI++G  I SVN  EVS   DV +++ +AK+  R   L QI+        +   S
Sbjct: 467 DAADKGIKEGEKITSVNNQEVSTPADVVKVLNQAKKDGRTRALFQIQ--------SSEGS 518

Query: 481 RFVSLKID 488
           RFV+L I+
Sbjct: 519 RFVALPIN 526


>gi|241203811|ref|YP_002974907.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857701|gb|ACS55368.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 527

 Score =  296 bits (759), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 184/480 (38%), Positives = 263/480 (54%), Gaps = 46/480 (9%)

Query: 43  VIARVSPSIVSVMVEPK-KKVSVEQM------FNAYGFGNLPEDHPLKNYFRK------- 88
           V+  VSP++VSV VE +   VS          FN  GF +LP+DHPLK +F++       
Sbjct: 57  VVDAVSPAVVSVRVENRVNPVSDNNNDGFSFDFNGRGFDDLPDDHPLKRFFKQFGQDPND 116

Query: 89  --DFHKFFSGEEPILSDTVERL---MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT 143
                + F    P       RL     GSGFFI++DGYI+T+NH+V DG +F  ++ D T
Sbjct: 117 QQGHSRRFGQNGPNGPGGKGRLRPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAVMKDGT 176

Query: 144 ELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
           EL AKL+G D   DLAVLKV    +KF  V + D NN+RVG+ V  +GNPF L GTV+AG
Sbjct: 177 ELDAKLIGKDPRTDLAVLKVDGKGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGTVTAG 236

Query: 203 IVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLI 261
           IVSA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +     +G+   
Sbjct: 237 IVSARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSVGIAFA 296

Query: 262 IPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADK 321
           IP S  K  +  L+  G+V  GW G+  Q +T+++A  +GL    G+L+ A    SP DK
Sbjct: 297 IPASTAKDVVADLMKDGQVSRGWLGVQIQPVTKDIAESIGLSEPSGALVVAPQAGSPGDK 356

Query: 322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK 381
           AGMK GDV+  L+G  IK  +D   +I +  P  +V++S+ + G    + V LG+ P  +
Sbjct: 357 AGMKAGDVVTALNGETIKDARDLSRRIGAMQPGSKVELSVWRAGKAQPLTVELGTLPIDQ 416

Query: 382 NDMHLE-----------VGDKEL--LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQ 428
            D   +             +K L  LG+ +   +DG  K + I  ++PN   +   KGI+
Sbjct: 417 KDASADDNSQPQQPEAPASEKALADLGLTVGPSDDG--KGLAITDIDPN--SDAADKGIK 472

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           +G  I SVN  EVS   D+ +++ +AK+  R   L QI+        +   SRFV+L I+
Sbjct: 473 EGEKITSVNNQEVSSADDIVKVLNQAKKDGRTRALFQIQ--------SSEGSRFVALPIN 524


>gi|190891004|ref|YP_001977546.1| serine protease Do protein [Rhizobium etli CIAT 652]
 gi|190696283|gb|ACE90368.1| serine protease Do protein [Rhizobium etli CIAT 652]
          Length = 532

 Score =  295 bits (756), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 181/491 (36%), Positives = 266/491 (54%), Gaps = 63/491 (12%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQM------FNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
           V+  VSP++VSV VE +     +        FN  GF +LP+DHPLK +FR+       G
Sbjct: 57  VVDAVSPAVVSVRVENRVNPVADNNDGFAFDFNGRGFDDLPDDHPLKRFFRQ------FG 110

Query: 97  EEPILSDTVER------------------------LMFGSGFFITDDGYILTSNHIVEDG 132
           ++P      +R                        +  GSGFFI++DGYI+T+NH+V DG
Sbjct: 111 QDPNDQQGHQRRFGQNGPGGPGGPNAPGGKGRLRPVAQGSGFFISEDGYIVTNNHVVSDG 170

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGN 191
            +F  +++D TEL AKL+G D   DLAVLKV    +KF  V + D NN+RVG+ V  +GN
Sbjct: 171 QAFVAVMNDGTELDAKLIGKDPRTDLAVLKVDGKGKKFTYVNWADDNNVRVGDWVVAVGN 230

Query: 192 PFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF L GTV+AGIVSA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +
Sbjct: 231 PFGLGGTVTAGIVSARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFS 290

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                +G+   IP S  K  +  L+  G+V  GW G+  Q +T+++A  +GL    G+L+
Sbjct: 291 PSGGSVGIAFAIPASTAKDVVADLMKDGQVSRGWLGVQIQPVTKDIAESIGLSEPSGALV 350

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
            A    SP DKAGMK GDV+  L+G  IK  +D   +I +  P  + ++S+ + G   S+
Sbjct: 351 VAPQAGSPGDKAGMKAGDVVTALNGETIKDARDLSRRIGAMQPGSKAELSVWRAGKAQSL 410

Query: 371 AVVLGSSPTAKNDMHLE-----------VGDKEL--LGMVLQDINDGNKKLVRIVALNPN 417
            V LG+ P  + + + +             +K L  LG+ +   +DG  K + I  ++P 
Sbjct: 411 TVELGTLPADQKEANADDNSQPQQPEAPASEKALADLGLTVGPSDDG--KGLAITGIDP- 467

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
            + +   KGI++G  I SVN  EVS   DV +++ +AK+  R   L QI+        + 
Sbjct: 468 -DSDAADKGIKEGEKITSVNNQEVSTPADVVKVLNQAKKDGRTRALFQIQ--------SS 518

Query: 478 NMSRFVSLKID 488
             SRFV+L I+
Sbjct: 519 EGSRFVALPIN 529


>gi|327193946|gb|EGE60821.1| serine protease Do protein [Rhizobium etli CNPAF512]
          Length = 549

 Score =  295 bits (756), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 181/491 (36%), Positives = 266/491 (54%), Gaps = 63/491 (12%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQM------FNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
           V+  VSP++VSV VE +     +        FN  GF +LP+DHPLK +FR+       G
Sbjct: 74  VVDAVSPAVVSVRVENRVNPVADNNDGFAFDFNGRGFDDLPDDHPLKRFFRQ------FG 127

Query: 97  EEPILSDTVER------------------------LMFGSGFFITDDGYILTSNHIVEDG 132
           ++P      +R                        +  GSGFFI++DGYI+T+NH+V DG
Sbjct: 128 QDPNDQQGHQRRFGQNGPGGPGGPNGPGGKGRLRPVAQGSGFFISEDGYIVTNNHVVSDG 187

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGN 191
            +F  +++D TEL AKL+G D   DLAVLKV    +KF  V + D NN+RVG+ V  +GN
Sbjct: 188 QAFVAVMNDGTELDAKLIGKDPRTDLAVLKVDGKGKKFTYVNWADDNNVRVGDWVVAVGN 247

Query: 192 PFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF L GTV+AGIVSA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +
Sbjct: 248 PFGLGGTVTAGIVSARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFS 307

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                +G+   IP S  K  +  L+  G+V  GW G+  Q +T+++A  +GL    G+L+
Sbjct: 308 PSGGSVGIAFAIPASTAKDVVADLMKDGQVSRGWLGVQIQPVTKDIAESIGLSEPSGALV 367

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
            A    SP DKAGMK GDV+  L+G  IK  +D   +I +  P  + ++S+ + G   S+
Sbjct: 368 VAPQAGSPGDKAGMKAGDVVTALNGETIKDARDLSRRIGAMQPGSKAELSVWRAGKAQSL 427

Query: 371 AVVLGSSPTAKNDMHLE-----------VGDKEL--LGMVLQDINDGNKKLVRIVALNPN 417
            V LG+ P  + + + +             +K L  LG+ +   +DG  K + I  ++P 
Sbjct: 428 TVELGTLPADQKEANADDNSQPQQPEAPASEKALADLGLTVGPSDDG--KGLAITGIDP- 484

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
            + +   KGI++G  I SVN  EVS   DV +++ +AK+  R   L QI+        + 
Sbjct: 485 -DSDAADKGIKEGEKITSVNNQEVSTPADVVKVLNQAKKDGRTRALFQIQ--------SS 535

Query: 478 NMSRFVSLKID 488
             SRFV+L I+
Sbjct: 536 EGSRFVALPIN 546


>gi|153009993|ref|YP_001371208.1| protease Do [Ochrobactrum anthropi ATCC 49188]
 gi|151561881|gb|ABS15379.1| protease Do [Ochrobactrum anthropi ATCC 49188]
          Length = 520

 Score =  293 bits (751), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 182/522 (34%), Positives = 280/522 (53%), Gaps = 55/522 (10%)

Query: 10  KSICTVALTCVI---FSST----------YLVLEAKLPPSSVDLPPVIARVSPSIVSVMV 56
           K +  +AL+ V+   F +T             ++   PP +     ++ +V P++VSV V
Sbjct: 11  KGVAAIALSAVLAGGFVATGPLGALNDARAEAVQVTPPPQAAGFADLVEKVRPAVVSVRV 70

Query: 57  EPKKKVSVE-----QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE-----EPILSDTVE 106
           +   + + +     Q     GF  LP+DHPLK +FR DF     G+      P      +
Sbjct: 71  KKDVQQTADRGGSGQFSGPPGFDQLPDDHPLKRFFR-DFGMDPRGDARPDARPDRRGPGK 129

Query: 107 R---------LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
           R         +  GSGFFI++DGY++T+NH+V DG ++SV++ D TEL AKL+GTD   D
Sbjct: 130 RGPRPGHERPVAQGSGFFISEDGYVVTNNHVVSDGDAYSVVMDDGTELDAKLIGTDPRTD 189

Query: 158 LAVLKVQSDR-KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP- 215
           LAVLKV   + KF  V F D N IRVG+ V  +GNPF L GTV++GIVSA  RDI   P 
Sbjct: 190 LAVLKVNDPKQKFTYVAFGDDNKIRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPY 249

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F QIDA +N+GNSGGP FN  G VIG+N  I +     +G+   IP S  K+ +  LI
Sbjct: 250 DDFIQIDAAVNKGNSGGPAFNLSGQVIGINTAIFSPSGGSVGIAFAIPASTAKQVVDQLI 309

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
            KG V+ GW G+  Q +T+++A  LGL   KG+++ +  K+ PA KAG++ GDVI  ++G
Sbjct: 310 KKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQKDGPAAKAGIQSGDVITAVNG 369

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK---- 391
             ++  +D   ++A   P E+  +++ ++     V + + + P         +GD     
Sbjct: 370 ETVQDPRDLARKVAGIVPGEKAALTVWRKNKAEEVDITIEAMPGDLGKAASALGDNGGGQ 429

Query: 392 ----ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
               +  G+ +    DGN     +V  + + + +   +GI+ G  I+SVN   V   KD+
Sbjct: 430 NEALDSYGLTVTPSEDGNG----VVVTDVDPDSDASDRGIRSGDIIMSVNNQTVKSAKDI 485

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              I +A +  R +VLLQ++        +++ SRFV+L ID+
Sbjct: 486 NNAISEAAKSGRKAVLLQLQ--------SNDQSRFVALPIDQ 519


>gi|218460930|ref|ZP_03501021.1| serine protease Do protein [Rhizobium etli Kim 5]
          Length = 510

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 175/464 (37%), Positives = 255/464 (54%), Gaps = 51/464 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQM------FNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
           V+  VSP++VSV VE +     +        FN  GF +LP+DHPLK +FR+       G
Sbjct: 57  VVDAVSPAVVSVRVENRVNPVADNNDGFSFDFNGRGFDDLPDDHPLKRFFRQ------FG 110

Query: 97  EEPILSDTVER--------------------LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           ++P      +R                    +  GSGFFI++DGYI+T+NH+V DG +F 
Sbjct: 111 QDPNDQQGHQRRFGQNGPGGPNGPGKGRLRPVAQGSGFFISEDGYIVTNNHVVSDGQAFV 170

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            +++D TEL AKL+G D   DLAVLKV    +KF  V + D NN+RVG+ V  +GNPF L
Sbjct: 171 AVMNDGTELDAKLIGKDPRTDLAVLKVDGKGKKFTYVNWADDNNVRVGDWVVAVGNPFGL 230

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV+AGIVSA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +    
Sbjct: 231 GGTVTAGIVSARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGG 290

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  +  +  L+  G+V  GW G+  Q +T+++A  +GL    G+L+ A  
Sbjct: 291 SVGIAFAIPASTARDVVADLMKDGQVSRGWLGVQIQPVTKDIAESIGLSEPSGALVVAPQ 350

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
             SP DKAGMK GDV+  L+G  IK  +D   +I +  P  +V++S+ + G   S+ V L
Sbjct: 351 AGSPGDKAGMKAGDVVTALNGETIKDARDLSRRIGAMQPGSKVELSVWRAGKAQSLQVEL 410

Query: 375 GSSPTAKNDMHLE-----------VGDKEL--LGMVLQDINDGNKKLVRIVALNPNRERE 421
           G+ P  + D   +             +K L  LG+ +   +DG  K + I  ++P  + +
Sbjct: 411 GTLPADQKDASADDNNQPQQPEAPASEKALADLGLTVGPSDDG--KGLAITGIDP--DSD 466

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
              KGI++G  I SVN  EVS   DV +++ +AK+  R   L Q
Sbjct: 467 AADKGIKEGEKITSVNNQEVSTPADVVKVLNQAKKDGRTRALFQ 510


>gi|116251206|ref|YP_767044.1| serine protease [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255854|emb|CAK06935.1| putative serine protease [Rhizobium leguminosarum bv. viciae 3841]
          Length = 531

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 182/484 (37%), Positives = 266/484 (54%), Gaps = 50/484 (10%)

Query: 43  VIARVSPSIVSVMVEPK-KKVSVEQM------FNAYGFGNLPEDHPLKNYFR-------- 87
           V+  VSP++VSV VE +   VS          FN  GF +LP+DHPLK +F+        
Sbjct: 57  VVDAVSPAVVSVRVENRVNPVSDNNNDGFSFDFNGRGFDDLPDDHPLKRFFKQFGQDPND 116

Query: 88  -----KDFHKFFSGEEPILSDTVERL---MFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
                + F +      P       RL     GSGFFI++DGYI+T+NH+V DG +F  ++
Sbjct: 117 QQGHSRRFGQNGPNGGPNGPGGKGRLRPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAVM 176

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGT 198
           +D TEL AKL+G D   DLAVLKV    +KF  V + D NN+RVG+ V  +GNPF L GT
Sbjct: 177 NDGTELDAKLIGKDPRTDLAVLKVDGKGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGT 236

Query: 199 VSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           V+AGIVSA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +     +G
Sbjct: 237 VTAGIVSARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSVG 296

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +   IP S  +  +  L+  G+V  GW G+  Q +T+++A  +GL    G+L+ A    S
Sbjct: 297 IAFAIPASTARDVVADLMKDGQVSRGWLGVQIQPVTKDIAESIGLSEPSGALVVAPQAGS 356

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           P DKAGMK GDV+  L+G  IK  +D   +I +  P  +V++S+ + G    + V LG+ 
Sbjct: 357 PGDKAGMKAGDVVTALNGETIKDARDLSRRIGAMQPGSKVELSVWRAGKAQPLTVELGTL 416

Query: 378 PTAKNDMHLE-----------VGDKEL--LGMVLQDINDGNKKLVRIVALNPNREREVEA 424
           P  + D   +             +K L  LG+ +   +DG  K + I  ++P  + +   
Sbjct: 417 PIDQKDASADDNSQPQQPEAPASEKALADLGLTVGPSDDG--KGLAITGIDP--DSDAAD 472

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVS 484
           KGI++G  I SVN  EV+  +DV +++ +AK+  R   L QI+        ++  SRFV+
Sbjct: 473 KGIKEGEKITSVNNQEVASPEDVVKVLNQAKKDGRTRALFQIQ--------SNEGSRFVA 524

Query: 485 LKID 488
           L I+
Sbjct: 525 LPIN 528


>gi|319898566|ref|YP_004158659.1| serine protease [Bartonella clarridgeiae 73]
 gi|319402530|emb|CBI76073.1| serine protease [Bartonella clarridgeiae 73]
          Length = 501

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 282/508 (55%), Gaps = 36/508 (7%)

Query: 4   RQILSVKSICTVALTCVIF--SSTYLVLEAKLPPSSV------DLPPVIARVSPSIVSVM 55
           R +L+  S C+V L   +F   S + V      P  V          V+++V P++VSV 
Sbjct: 7   RTMLTTVS-CSVFLASTMFFSGSNFWVTTTNANPVFVPSVQQQGFADVVSKVKPAVVSVQ 65

Query: 56  VEP---KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI-LSDTVERLMFG 111
           V+    K++      F++ G   LP+ HPLK +F+  ++      +P+  S     + FG
Sbjct: 66  VKSNAKKEERFFSNFFSSPGIDQLPDQHPLKRFFKDFYNHTLPNNKPLNRSRKFRPIAFG 125

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGFFI+ DGYI+T++H++ DG S+S+IL D  EL AKL+G D   DLAVLKV   RKF  
Sbjct: 126 SGFFISSDGYIVTNHHVIADGTSYSIILDDGAELEAKLIGADPRTDLAVLKVNDKRKFPY 185

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNS 230
           V+F D + I VG+ V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNS
Sbjct: 186 VDFADDSTIHVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGVYDDFIQIDAAVNRGNS 245

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP FN  G V+G+N  I +    ++G+   IP +  K+ +  L+ KG V  GW G+  Q
Sbjct: 246 GGPTFNLNGQVVGINTAIFSPSGGNVGIAFAIPSATAKQVVKQLMEKGSVRRGWIGVQIQ 305

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            +T+E++  +GL+  KG+LIT  +K  PA KAG+K GDVI  ++G  I   +D   +IA+
Sbjct: 306 PVTKEISDSIGLKEAKGALITDPLK-GPAAKAGIKAGDVIIAVNGEKINDARDLAKRIAN 364

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSP-------TAKNDMHLEVGDKEL--LGMVLQDI 401
            +P E V + + + G + S+ V L + P       T+K        D+ L   G+++   
Sbjct: 365 TTPGETVTLGIWRSGKEESIKVKLDTMPADEGKRETSKYSSEHGNLDETLEDYGLIVAPS 424

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           +DG    V +V  + + + +   +GI+ G  IV+VN   V    D+   I  AK+  R++
Sbjct: 425 DDG----VGLVVTDVDSDADAADRGIRSGDVIVTVNNRSVKKASDIIDAIKDAKKLGRNA 480

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +LLQ++         ++ +RF++L I K
Sbjct: 481 ILLQVR--------TNDQNRFIALPILK 500


>gi|163867921|ref|YP_001609125.1| serine protease [Bartonella tribocorum CIP 105476]
 gi|161017572|emb|CAK01130.1| serine protease [Bartonella tribocorum CIP 105476]
          Length = 503

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 181/466 (38%), Positives = 269/466 (57%), Gaps = 37/466 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVS---VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE- 98
           ++A+V P++V+V V+  KK         F+  G   LP+ HPLK  F K+F+ F   +  
Sbjct: 55  IVAQVKPAVVAVQVKSNKKKEDWFFSNFFSGPGIDQLPDQHPLKRLF-KEFYDFDKPKNK 113

Query: 99  -PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
            P  S  +  + FGSGFFI+ DGYI+T++H++ DG S++V+L D TEL AKL+G D   D
Sbjct: 114 FPNHSQRLRPVAFGSGFFISSDGYIVTNDHVISDGTSYTVVLDDGTELNAKLIGKDPKTD 173

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           LAVLKV   RKF  V+F D + +RVG+ V  IGNPF L GTV+AGIVSA  RDI    GT
Sbjct: 174 LAVLKVNDTRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDI----GT 229

Query: 218 -----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
                F QIDA +N+GNSGGP F+  G V+GVN  I +    ++G+   IP    K+ + 
Sbjct: 230 GVYDDFIQIDAAVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAGTAKQVVQ 289

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            LI KG V  GW G+M Q +T+E++  +GL+  KG+L+T  +K  PA KAG+K GDVI  
Sbjct: 290 QLIEKGSVQRGWLGVMIQPVTKEISDSIGLKDAKGALVTDPLK-GPAAKAGIKAGDVIIS 348

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP----TAKNDMHL-E 387
           ++   +   +D   +IA+ SP++ V + + + G +  + V L + P      +N  +L E
Sbjct: 349 VNDEKVNDSRDLAKRIANMSPEDTVTLGILRSGKEEKIKVKLAAMPEDEGKKENSKYLNE 408

Query: 388 VGDK----ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
            GD     E  G+++   +DG    + +V  + + + +   KGI+ G  IV+VN   V  
Sbjct: 409 RGDSDETLEDYGLIVSPSDDG----LGLVVTDVDSDSDAADKGIRPGDVIVTVNNKSVKK 464

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             D+   I  A++  R ++LLQI+         ++ +RFV+L I K
Sbjct: 465 TSDITDAIKNAQKLGRKAILLQIR--------TNDQNRFVALPIFK 502


>gi|319408249|emb|CBI81902.1| serine protease [Bartonella schoenbuchensis R1]
          Length = 502

 Score =  289 bits (740), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 179/508 (35%), Positives = 281/508 (55%), Gaps = 35/508 (6%)

Query: 4   RQILSVKSICTV-ALTCVIFSSTYLVLEAKLPPSSV------DLPPVIARVSPSIVSVMV 56
           R I     + TV A T  +  S + + EA   P  V          ++++V P++VSV V
Sbjct: 7   RMISPAIGLSTVLASTMFLSGSNFWMTEAHADPVFVPSVQQQGFANIVSQVKPAVVSVQV 66

Query: 57  EP---KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF-SGEEPILSDTVERLMFGS 112
           +    K++   +  F+A G   LP+ HP K +F++ + + + + +    S     + FGS
Sbjct: 67  KSNAKKEEWFFDGFFSAPGIDQLPDQHPFKKFFKEFYDRGWPNNKHSHRSHKPRPIAFGS 126

Query: 113 GFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
           GFFI+ DGYI+T++H++ DG S+SV+L D TEL AKL+GTD+  DLAVLKV   R F  V
Sbjct: 127 GFFISPDGYIVTNDHVISDGTSYSVVLDDGTELNAKLIGTDSRTDLAVLKVDDKRTFPYV 186

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNSG 231
           +F D + + VG+ V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNSG
Sbjct: 187 DFADDSKLYVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGIYDDFIQIDAAVNRGNSG 246

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP FN  G V+G+N  I +    ++G+   IP +  K+ +  LI KG V  GW G+  Q 
Sbjct: 247 GPTFNLNGQVVGINTAIFSPSGGNVGIAFAIPATTAKQVVKQLIEKGSVQRGWLGVQIQP 306

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +T+E++  +GL+ TKG+L+T  +K  PA+KAG+K GDVI  ++G  +   +D   +IA  
Sbjct: 307 VTKEISDSVGLKETKGALVTDPLK-GPAEKAGIKTGDVIIAVNGEKVTDARDLARRIAHI 365

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----------ELLGMVLQDI 401
            P E   +++ + G +  + V L + P ++N                   E  G+++   
Sbjct: 366 RPGETAVLNVWRSGKEEKIKVKLDAMPESENKKEASRSSSSKQQSSNETLEDYGLIVSPS 425

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           +D    +V  V    + + E   KGI+ G  IV+VN   V  + D+   I  A++  R++
Sbjct: 426 DDSTGMVVNDV----DSDSEAAEKGIRPGDVIVTVNNKPVKKVSDITDAIKNAQKLGRNA 481

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +LLQ++         ++ +RF++L+I K
Sbjct: 482 ILLQVR--------TNDQNRFIALQIVK 501


>gi|254718760|ref|ZP_05180571.1| Serine protease, V8 family protein [Brucella sp. 83/13]
 gi|265983738|ref|ZP_06096473.1| serine protease [Brucella sp. 83/13]
 gi|306838736|ref|ZP_07471571.1| protease Do [Brucella sp. NF 2653]
 gi|264662330|gb|EEZ32591.1| serine protease [Brucella sp. 83/13]
 gi|306406223|gb|EFM62467.1| protease Do [Brucella sp. NF 2653]
          Length = 513

 Score =  289 bits (739), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 269/483 (55%), Gaps = 44/483 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSV-----EQMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V       +Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPPQAGFADLVEKVRPAVVSVRV--KKDVQEASNRGQQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+ V F D N +RVG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +  
Sbjct: 282 SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKSGSQSNDNGGGQGETLDSYGLTVVSSEDG--KGVVVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L 
Sbjct: 458 IRSGDVIVSVNNQTVKTASDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALP 509

Query: 487 IDK 489
           I++
Sbjct: 510 INQ 512


>gi|306845217|ref|ZP_07477793.1| protease Do [Brucella sp. BO1]
 gi|306274376|gb|EFM56183.1| protease Do [Brucella sp. BO1]
          Length = 513

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 269/483 (55%), Gaps = 44/483 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSV-----EQMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V       +Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPQQAGFADLVEKVRPAVVSVRV--KKDVQEASNRDQQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+ V F D N +RVG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +  
Sbjct: 282 SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKTGSQSNDNGGGQGETLDSYGLTVVPSEDG--KGVVVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L 
Sbjct: 458 IRSGDVIVSVNNQMVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALP 509

Query: 487 IDK 489
           I++
Sbjct: 510 INQ 512


>gi|306842119|ref|ZP_07474788.1| protease Do [Brucella sp. BO2]
 gi|306287706|gb|EFM59137.1| protease Do [Brucella sp. BO2]
          Length = 513

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 269/483 (55%), Gaps = 44/483 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSV-----EQMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V       +Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPQQAGFADLVEKVRPAVVSVRV--KKDVQEASNRDQQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+ V F D N +RVG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +  
Sbjct: 282 SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKSGSQSNDNGGGQGETLDSYGLTVVPSEDG--KGVVVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L 
Sbjct: 458 IRSGDVIVSVNNQMVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALP 509

Query: 487 IDK 489
           I++
Sbjct: 510 INQ 512


>gi|240850127|ref|YP_002971520.1| serine protease [Bartonella grahamii as4aup]
 gi|240267250|gb|ACS50838.1| serine protease [Bartonella grahamii as4aup]
          Length = 503

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 178/460 (38%), Positives = 267/460 (58%), Gaps = 29/460 (6%)

Query: 43  VIARVSPSIVSVMVEPKKKVS---VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE- 98
           ++A+V P++V+V V+  KK         F+  GF  LP+ HPLK +F K+F+ F   +  
Sbjct: 55  IVAQVKPAVVAVQVKSNKKKEDRFFSNFFSGPGFDQLPDQHPLKRFF-KEFYDFDKPKNK 113

Query: 99  -PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
            P  S  +  + FGSGFFI+ DGYI+T++H++ DG S++V+L D TEL AKL+G D   D
Sbjct: 114 FPHQSRRLRPIAFGSGFFISSDGYIVTNDHVISDGTSYTVVLDDGTELNAKLIGKDPKTD 173

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           LAVLKV   RKF  V+F D + +RVG+ V  IGNPF L GTV+AGIVSA  RDI    GT
Sbjct: 174 LAVLKVSDKRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDI----GT 229

Query: 218 -----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
                F QIDA +N+GNSGGP F+  G V+GVN  I +    ++G+   IP + +K+ + 
Sbjct: 230 GVYDDFIQIDAAVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAATVKQVVQ 289

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            LI KG V  GW G+  Q +T+E++  +GL+  KG+L+T  +K  PA+KAG+K GDVI  
Sbjct: 290 QLIEKGSVQRGWLGVQIQPVTKEISDSIGLKEAKGALVTDPLK-GPAEKAGIKAGDVIIS 348

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG--SSPTAKNDMHLEVGD 390
           ++   +   +D   +IA+  P E V I + + G + S+ V L   S   +K +      +
Sbjct: 349 VNNEKVADARDLAKRIANIKPGETVTIGIWRSGKEESIKVKLASMSEDESKKEASKHSNE 408

Query: 391 KELLGMVLQD---INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
           +  L   L+D   I   +   V +V  + + + +   KGI+ G  IV+VN   V  + D+
Sbjct: 409 RGDLDETLEDYGLIVIPSDDGVGVVVTDVDTDSDAADKGIRPGDIIVTVNNKPVKKVSDI 468

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
              I  A++  R ++LLQ++         ++ +RFV+L I
Sbjct: 469 VSTIKNAQQLGRKAILLQVR--------TNDQNRFVALPI 500


>gi|17987613|ref|NP_540247.1| protease DO [Brucella melitensis bv. 1 str. 16M]
 gi|225852136|ref|YP_002732369.1| protease Do [Brucella melitensis ATCC 23457]
 gi|256044313|ref|ZP_05447217.1| protease Do [Brucella melitensis bv. 1 str. Rev.1]
 gi|256264352|ref|ZP_05466884.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563667|ref|ZP_05834153.1| serine protease [Brucella melitensis bv. 1 str. 16M]
 gi|265990725|ref|ZP_06103282.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|38257712|sp|Q8YG32|DEGP_BRUME RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|17983322|gb|AAL52511.1| protease do [Brucella melitensis bv. 1 str. 16M]
 gi|225640501|gb|ACO00415.1| protease Do [Brucella melitensis ATCC 23457]
 gi|260153683|gb|EEW88775.1| serine protease [Brucella melitensis bv. 1 str. 16M]
 gi|263001509|gb|EEZ14084.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094645|gb|EEZ18424.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408636|gb|ADZ65701.1| protease Do [Brucella melitensis M28]
 gi|326538358|gb|ADZ86573.1| protease Do [Brucella melitensis M5-90]
          Length = 513

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 268/483 (55%), Gaps = 44/483 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE-----QMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V        Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPQQAGFADLVEKVRPAVVSVRV--KKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+ V F D N +RVG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +  
Sbjct: 282 SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDG--KGVVVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L 
Sbjct: 458 IRSGDVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALP 509

Query: 487 IDK 489
           I++
Sbjct: 510 INQ 512


>gi|256113150|ref|ZP_05454027.1| protease Do [Brucella melitensis bv. 3 str. Ether]
 gi|265994563|ref|ZP_06107120.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765676|gb|EEZ11465.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 513

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 268/483 (55%), Gaps = 44/483 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE-----QMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V        Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPQQAGFADLVEKVRPAVVSVRV--KKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+ V F D N +RVG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +  
Sbjct: 282 SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDG--KGVVVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L 
Sbjct: 458 IRSGDVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALP 509

Query: 487 IDK 489
           I++
Sbjct: 510 INQ 512


>gi|23501498|ref|NP_697625.1| serine protease [Brucella suis 1330]
 gi|62289573|ref|YP_221366.1| serine protease [Brucella abortus bv. 1 str. 9-941]
 gi|82699503|ref|YP_414077.1| serine protease family protein [Brucella melitensis biovar Abortus
           2308]
 gi|148559514|ref|YP_001258604.1| serine protease [Brucella ovis ATCC 25840]
 gi|161618586|ref|YP_001592473.1| protease Do [Brucella canis ATCC 23365]
 gi|163842886|ref|YP_001627290.1| protease Do [Brucella suis ATCC 23445]
 gi|189023832|ref|YP_001934600.1| Serine protease, V8 family [Brucella abortus S19]
 gi|225627118|ref|ZP_03785156.1| protease Do [Brucella ceti str. Cudo]
 gi|237815070|ref|ZP_04594068.1| protease Do [Brucella abortus str. 2308 A]
 gi|254688894|ref|ZP_05152148.1| Serine protease, V8 family protein [Brucella abortus bv. 6 str.
           870]
 gi|254693375|ref|ZP_05155203.1| Serine protease, V8 family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697026|ref|ZP_05158854.1| Serine protease, V8 family protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701405|ref|ZP_05163233.1| Serine protease, V8 family protein [Brucella suis bv. 5 str. 513]
 gi|254703950|ref|ZP_05165778.1| Serine protease, V8 family protein [Brucella suis bv. 3 str. 686]
 gi|254707672|ref|ZP_05169500.1| Serine protease, V8 family protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709745|ref|ZP_05171556.1| Serine protease, V8 family protein [Brucella pinnipedialis B2/94]
 gi|254713748|ref|ZP_05175559.1| Serine protease, V8 family protein [Brucella ceti M644/93/1]
 gi|254717194|ref|ZP_05179005.1| Serine protease, V8 family protein [Brucella ceti M13/05/1]
 gi|254729925|ref|ZP_05188503.1| Serine protease, V8 family protein [Brucella abortus bv. 4 str.
           292]
 gi|256031235|ref|ZP_05444849.1| Serine protease, V8 family protein [Brucella pinnipedialis
           M292/94/1]
 gi|256159338|ref|ZP_05457128.1| Serine protease, V8 family protein [Brucella ceti M490/95/1]
 gi|256254643|ref|ZP_05460179.1| Serine protease, V8 family protein [Brucella ceti B1/94]
 gi|256257142|ref|ZP_05462678.1| Serine protease, V8 family protein [Brucella abortus bv. 9 str.
           C68]
 gi|256369050|ref|YP_003106558.1| serine protease [Brucella microti CCM 4915]
 gi|260168371|ref|ZP_05755182.1| serine protease [Brucella sp. F5/99]
 gi|260545666|ref|ZP_05821407.1| serine protease [Brucella abortus NCTC 8038]
 gi|260566801|ref|ZP_05837271.1| HtrA protein [Brucella suis bv. 4 str. 40]
 gi|260754379|ref|ZP_05866727.1| serine endoprotease [Brucella abortus bv. 6 str. 870]
 gi|260757598|ref|ZP_05869946.1| serine endoprotease [Brucella abortus bv. 4 str. 292]
 gi|260761424|ref|ZP_05873767.1| serine endoprotease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883404|ref|ZP_05895018.1| HtrA [Brucella abortus bv. 9 str. C68]
 gi|261213625|ref|ZP_05927906.1| serine endoprotease [Brucella abortus bv. 3 str. Tulya]
 gi|261219010|ref|ZP_05933291.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221818|ref|ZP_05936099.1| HtrA [Brucella ceti B1/94]
 gi|261315168|ref|ZP_05954365.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317276|ref|ZP_05956473.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321490|ref|ZP_05960687.1| serine protease [Brucella ceti M644/93/1]
 gi|261751944|ref|ZP_05995653.1| serine endoprotease [Brucella suis bv. 5 str. 513]
 gi|261754602|ref|ZP_05998311.1| serine endoprotease [Brucella suis bv. 3 str. 686]
 gi|261757831|ref|ZP_06001540.1| serine protease [Brucella sp. F5/99]
 gi|265988314|ref|ZP_06100871.1| HtrA [Brucella pinnipedialis M292/94/1]
 gi|265997782|ref|ZP_06110339.1| HtrA [Brucella ceti M490/95/1]
 gi|297247988|ref|ZP_06931706.1| serine protease [Brucella abortus bv. 5 str. B3196]
 gi|60392175|sp|P0A3Z5|DEGP_BRUSU RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|88911283|sp|Q2YMX6|DEGP_BRUA2 RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|90109771|sp|P0C114|DEGP_BRUAB RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|497157|gb|AAA70164.1| htrA [Brucella abortus]
 gi|23347404|gb|AAN29540.1| serine protease [Brucella suis 1330]
 gi|62195705|gb|AAX74005.1| serine protease [Brucella abortus bv. 1 str. 9-941]
 gi|82615604|emb|CAJ10591.1| Serine proteases, V8 family:Serine protease, trypsin
           family:PDZ/DHR/GLGF domain:HtrA/DegQ protease [Brucella
           melitensis biovar Abortus 2308]
 gi|122831091|gb|ABM66832.1| HtrA [Brucella melitensis]
 gi|148370771|gb|ABQ60750.1| serine protease [Brucella ovis ATCC 25840]
 gi|161335397|gb|ABX61702.1| protease Do [Brucella canis ATCC 23365]
 gi|163673609|gb|ABY37720.1| protease Do [Brucella suis ATCC 23445]
 gi|189019404|gb|ACD72126.1| Serine protease, V8 family [Brucella abortus S19]
 gi|225617953|gb|EEH14997.1| protease Do [Brucella ceti str. Cudo]
 gi|237789907|gb|EEP64117.1| protease Do [Brucella abortus str. 2308 A]
 gi|255999210|gb|ACU47609.1| serine protease [Brucella microti CCM 4915]
 gi|260097073|gb|EEW80948.1| serine protease [Brucella abortus NCTC 8038]
 gi|260156319|gb|EEW91399.1| HtrA protein [Brucella suis bv. 4 str. 40]
 gi|260667916|gb|EEX54856.1| serine endoprotease [Brucella abortus bv. 4 str. 292]
 gi|260671856|gb|EEX58677.1| serine endoprotease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674487|gb|EEX61308.1| serine endoprotease [Brucella abortus bv. 6 str. 870]
 gi|260872932|gb|EEX80001.1| HtrA [Brucella abortus bv. 9 str. C68]
 gi|260915232|gb|EEX82093.1| serine endoprotease [Brucella abortus bv. 3 str. Tulya]
 gi|260920402|gb|EEX87055.1| HtrA [Brucella ceti B1/94]
 gi|260924099|gb|EEX90667.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294180|gb|EEX97676.1| serine protease [Brucella ceti M644/93/1]
 gi|261296499|gb|EEX99995.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261304194|gb|EEY07691.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261737815|gb|EEY25811.1| serine protease [Brucella sp. F5/99]
 gi|261741697|gb|EEY29623.1| serine endoprotease [Brucella suis bv. 5 str. 513]
 gi|261744355|gb|EEY32281.1| serine endoprotease [Brucella suis bv. 3 str. 686]
 gi|262552250|gb|EEZ08240.1| HtrA [Brucella ceti M490/95/1]
 gi|264660511|gb|EEZ30772.1| HtrA [Brucella pinnipedialis M292/94/1]
 gi|297175157|gb|EFH34504.1| serine protease [Brucella abortus bv. 5 str. B3196]
          Length = 513

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 268/483 (55%), Gaps = 44/483 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE-----QMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V        Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPPQAGFADLVEKVRPAVVSVRV--KKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+ V F D N +RVG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +  
Sbjct: 282 SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDG--KGVVVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L 
Sbjct: 458 IRSGDVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALP 509

Query: 487 IDK 489
           I++
Sbjct: 510 INQ 512


>gi|256060743|ref|ZP_05450907.1| Serine protease, V8 family protein [Brucella neotomae 5K33]
 gi|261324733|ref|ZP_05963930.1| HtrA [Brucella neotomae 5K33]
 gi|261300713|gb|EEY04210.1| HtrA [Brucella neotomae 5K33]
          Length = 513

 Score =  286 bits (732), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 268/483 (55%), Gaps = 44/483 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE-----QMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V        Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPPQAGFADLVEKVRPAVVSVRV--KKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+ V F D N +RVG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +  
Sbjct: 282 SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDG--KGVIVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L 
Sbjct: 458 IRSGDVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALP 509

Query: 487 IDK 489
           I++
Sbjct: 510 INQ 512


>gi|13476388|ref|NP_107958.1| serine protease [Mesorhizobium loti MAFF303099]
 gi|14027149|dbj|BAB54103.1| serine protease [Mesorhizobium loti MAFF303099]
          Length = 516

 Score =  286 bits (731), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 172/469 (36%), Positives = 262/469 (55%), Gaps = 33/469 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAY-GFGNLPEDHPLKNYFRK------------D 89
           V+ RVSP++VSV V+ K + + +   +   GF NLP +  L+ +F++            +
Sbjct: 58  VVERVSPAVVSVKVKAKIQPTADDGSDDQDGFDNLPNNPQLRRFFKEFRGFGDQGGQNDE 117

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
            H+ F G     +D    +  GSGFFI++DGY++T+NH+VE+G +F+V+ +D  EL AKL
Sbjct: 118 GHRRF-GHRDRSNDQPRPVAQGSGFFISEDGYLVTNNHVVEEGTAFTVVTNDGKELDAKL 176

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           VGTD   DLAVLKV+   KF  V+F D + +RVG+ V  +GNPF L GTV+AGIVSA  R
Sbjct: 177 VGTDPRTDLAVLKVEGGGKFTYVDFADDSKVRVGDWVVAVGNPFGLGGTVTAGIVSARGR 236

Query: 210 DIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIK 268
           DI   P   F QIDA +N+GNSGGP FN  G V+G+N  I +     +G+   IP S  K
Sbjct: 237 DIGAGPYDDFLQIDASVNRGNSGGPTFNLNGQVVGINTAIFSPSGGSVGIAFDIPASTAK 296

Query: 269 KAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGD 328
           + +  L+  G V  GW G+  Q +T ++A  LGL+   G+L+++   + P  KAG+  GD
Sbjct: 297 QVVEDLMKSGAVQRGWLGVEIQPVTSDIAESLGLKSNNGALVSSAQDDGPGKKAGITAGD 356

Query: 329 VICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT----AKNDM 384
           VI  ++G+ + S ++    I + SP + V +++ ++G   ++ V LG  P     A ND 
Sbjct: 357 VITQVEGKDVASPKELARLIGAYSPGKSVDVTVWRDGKSQTIKVDLGKLPASDKQASNDQ 416

Query: 385 HLE----VGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
             +         L  + L      N K + +  ++P  E     +GIQ G  I +VN++E
Sbjct: 417 QQQPAAPAKPDTLADLGLTVTKSENGKGLVVTDVDP--ESAAADRGIQPGDIITAVNSNE 474

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V+   DV + +  A +  R +VL+QI          DN +RFV+L + K
Sbjct: 475 VNGTDDVTKAMTDAVKSGRKAVLMQITR--------DNNNRFVALPVAK 515


>gi|294851979|ref|ZP_06792652.1| serine protease do-like protein [Brucella sp. NVSL 07-0026]
 gi|294820568|gb|EFG37567.1| serine protease do-like protein [Brucella sp. NVSL 07-0026]
          Length = 513

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 176/483 (36%), Positives = 267/483 (55%), Gaps = 44/483 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE-----QMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V        Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPPQAGFADLVEKVRPAVVSVRV--KKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+ V F D N +RVG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++    
Sbjct: 282 SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVALPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDG--KGVVVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  IVSVN   V    ++ + I  A++  R +VLLQ++        +++ SRFV+L 
Sbjct: 458 IRSGDVIVSVNNQTVKTAGNINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALP 509

Query: 487 IDK 489
           I++
Sbjct: 510 INQ 512


>gi|114706872|ref|ZP_01439772.1| serine protease DO-like protease [Fulvimarina pelagi HTCC2506]
 gi|114537820|gb|EAU40944.1| serine protease DO-like protease [Fulvimarina pelagi HTCC2506]
          Length = 507

 Score =  283 bits (724), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 176/505 (34%), Positives = 275/505 (54%), Gaps = 29/505 (5%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLV----LEAKLPPSSVDLPPVIARVSPSIVSVMVE 57
           F   IL+   +   AL+  + S+   V    ++ + P  S     V+++VSP++VSV V 
Sbjct: 14  FLAAILAA-GVAGGALSAGVLSNAPAVYAEPVQVEAPQQSFGFADVVSKVSPAVVSVRVS 72

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYF-RKDFHKFFSGEEPILSDTVERLMFGSGFFI 116
              + + +    A  F NLPEDHPL+ +F   D ++   G  P        +  GSGFFI
Sbjct: 73  QSAEPAADFGGMASPFENLPEDHPLRRFFGTPDGNQMPRGLNPRSPRDRPSIGQGSGFFI 132

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFE 175
           ++DGY++T+NH+V++GA ++V++ D +E  AKL+GTD   DLA+LKV + + KF  VEF 
Sbjct: 133 SEDGYVVTNNHVVDNGAKYTVVMDDGSEYEAKLIGTDERTDLALLKVDAKNTKFTYVEFG 192

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPC 234
           D + +RVG+ V  +GNPF L G+V+AGI+SA  RDI   P   F QIDA +N+GNSGGP 
Sbjct: 193 DDDAVRVGDWVVAVGNPFGLGGSVTAGIISARGRDIGAGPYDDFLQIDAAVNRGNSGGPA 252

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
           F   G VIGVN  I +    ++G+   IP S+ +  + SL   G V+ GW G+    ++ 
Sbjct: 253 FGLDGKVIGVNTAIFSPSGGNVGIAFAIPASVAQDVVRSLRENGSVERGWLGVQIGEVSD 312

Query: 295 ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK 354
           ++A  LGL   +G+++T    E+PA +AG++ GDVI  ++G  ++S ++    IA  SP 
Sbjct: 313 DIAEALGLSNAQGAIVTLPDNETPASRAGIETGDVITGVNGEAVESPRELARMIADYSPG 372

Query: 355 EQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-------DKELL---GMVLQDINDG 404
             V+I++ ++G   ++ V LG+  +      L+         D   L   GM +    DG
Sbjct: 373 TDVEITVFRDGDSETIDVTLGNLNSLDEAASLDEPRGQGSPVDPSTLSGYGMTVTPSEDG 432

Query: 405 NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
                 +V  + + +     KG + G TIV+VN   V+   DV   I  A +  R + L 
Sbjct: 433 EG----VVVTDVDPDSSAAEKGFEAGDTIVAVNGSNVASQSDVRAAIDAASKNGRRAALF 488

Query: 465 QIKYDPDMQSGNDNMSRFVSLKIDK 489
           Q++         D  +RFV+L I+K
Sbjct: 489 QLRN-------ADGQNRFVALPIEK 506


>gi|222148025|ref|YP_002548982.1| serine protease DO-like protease [Agrobacterium vitis S4]
 gi|221735013|gb|ACM35976.1| serine protease DO-like protease [Agrobacterium vitis S4]
          Length = 491

 Score =  282 bits (722), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 181/503 (35%), Positives = 276/503 (54%), Gaps = 46/503 (9%)

Query: 16  ALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ----MFNAY 71
           A+T     +  + ++A   PS  DL   ++ VSP++VS+ V+   + + E      FN  
Sbjct: 5   AVTVTPALAAPVEVQAPQVPSFADL---VSAVSPAVVSIRVKSDVQQASEDGSNFSFNGR 61

Query: 72  GFGNLPEDHPLKNYFRK----DFHKFFSGEEPILSDTVER------LMFGSGFFITDDGY 121
            F  LP+  PLK +F++              P      ER      +  GSGFFI++DGY
Sbjct: 62  DFDQLPD--PLKRFFKEWGMPGPGGPGGPGGPKGGPHAERHGKLRPIAQGSGFFISEDGY 119

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV-QSDRKFIPVEFEDANNI 180
           ++T+NH+V DG +++V+++D TE  AKLVG D   DLAVLKV Q  +KF  VE+     I
Sbjct: 120 VVTNNHVVSDGQAYTVVMNDGTEYDAKLVGKDPRTDLAVLKVDQPTKKFTYVEWAQDEKI 179

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALG 239
           RVG+ V  +GNPF L GTV++GIVSA  RDI   P   + QIDAP+N+GNSGGP FN  G
Sbjct: 180 RVGDWVVAVGNPFGLGGTVTSGIVSAFGRDIGSGPYDDYIQIDAPVNRGNSGGPDFNLSG 239

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+G+N  I +     +G+   IP +  K  +  LI  G V  GW G+  Q +T+++A  
Sbjct: 240 KVVGINTAIFSPSGGSVGIAFAIPAATAKDVVAELIKHGSVQRGWLGVQIQPVTKDIAES 299

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           LGL   KG+L+      SP +KAG+K GDVI  ++G  +K  +D   +IA+  P  +V I
Sbjct: 300 LGLADAKGALVAEPQTGSPGEKAGIKQGDVITAVNGDPVKDPRDLAKRIAAFPPNTKVDI 359

Query: 360 SLCKEGSKHSVAVVLGSSPTAKN-----------DMHLEVGDKEL--LGMVLQDINDGNK 406
           S+ + G   +V V LG+ P  K+           + +    ++ L  LG+ +Q  +DG  
Sbjct: 360 SIWRNGKPTAVKVDLGTLPAEKDTASSDEDQGAPEQNAPATEQALANLGVTVQRADDG-- 417

Query: 407 KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           K + I  ++P  + +   KG++ G  I SVN  +VS   +V++++ +AK+  R   L Q+
Sbjct: 418 KGLTITNVDP--DSDAADKGLKTGQKITSVNNQQVSSAAEVKKILDQAKKDGRTKALFQV 475

Query: 467 KYDPDMQSGNDNMSRFVSLKIDK 489
           +         DN SRF++L I++
Sbjct: 476 E--------TDNGSRFIALPINQ 490


>gi|260462375|ref|ZP_05810583.1| protease Do [Mesorhizobium opportunistum WSM2075]
 gi|259031869|gb|EEW33137.1| protease Do [Mesorhizobium opportunistum WSM2075]
          Length = 516

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 179/485 (36%), Positives = 270/485 (55%), Gaps = 40/485 (8%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY-GFGNLPEDHPLKNYFR 87
           +EA   PS  D   V+ RVSP++VSV V+ K + + +   +   G  NLP +  L+ +F 
Sbjct: 47  VEAPQVPSFAD---VVERVSPAVVSVKVKAKIQPTADDGSDDQDGLDNLPNNPQLRRFF- 102

Query: 88  KDFHKFFSGEEPILSDTVER--------------LMFGSGFFITDDGYILTSNHIVEDGA 133
           K+F  F  G++   +D   R              +  GSGFFI++DGY++T+NH+VE+G 
Sbjct: 103 KEFRGF--GDQGGQNDEGHRRFGHRDRNNGQPRPVAQGSGFFISEDGYLVTNNHVVEEGT 160

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
           +F+V+ +D  EL AKLVGTD   DLAVLKV    KF  V+F D + +RVG+ V  +GNPF
Sbjct: 161 AFTVVTNDGKELDAKLVGTDPRTDLAVLKVDGGGKFTYVDFADDSKVRVGDWVVAVGNPF 220

Query: 194 RLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
            L GTV+AGIVSA  RDI   P   F QIDA +N+GNSGGP FN  G V+G+N  I +  
Sbjct: 221 GLGGTVTAGIVSARGRDIGAGPYDDFLQIDASVNRGNSGGPTFNLNGQVVGINTAIFSPS 280

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              +G+   IP S  ++ +  L+  G V  GW G+  Q +T ++A  LGL+   G+L+++
Sbjct: 281 GGSVGIAFDIPASTARQVVGDLMKNGAVQRGWLGVEIQPVTSDIAESLGLKSNNGALVSS 340

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
              + P  KAG+  GDVI  +DG+ + S ++    I + SP + V +++ ++G   +V V
Sbjct: 341 AQDDGPGKKAGITAGDVITQVDGKDVASPKELARLIGAYSPGKPVDVTVWRDGKSQTVKV 400

Query: 373 VLGSSPT----AKNDMHLE----VGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEA 424
            LG  P     A ND   +         L  + L      N K + +  ++P  + +   
Sbjct: 401 DLGKLPASDKQASNDQQQQPAAPAKPDTLADLGLTVTKSENGKGLVVTDVDP--DSDAAD 458

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVS 484
           +GIQ G  I +VN+ EV+  +DV + + +A +  R +VL+QI  D       DN +RFV+
Sbjct: 459 RGIQPGDVITAVNSTEVNGTEDVTKAMTEAVKSGRKAVLMQITRD-------DN-NRFVA 510

Query: 485 LKIDK 489
           L + K
Sbjct: 511 LPVAK 515


>gi|222085318|ref|YP_002543848.1| serine protease DO-like protein [Agrobacterium radiobacter K84]
 gi|221722766|gb|ACM25922.1| serine protease DO-like protein [Agrobacterium radiobacter K84]
          Length = 518

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 184/472 (38%), Positives = 264/472 (55%), Gaps = 38/472 (8%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFN---AYGFGNLPEDHPLKNYFRKDFHKFFSGEE- 98
           V+  VSP++VSV VE +     ++  +     GF  LP+DHPLK +F++   +     + 
Sbjct: 57  VVDAVSPAVVSVRVESRINPVADEDDSFGLGRGFDELPDDHPLKKFFKQFEQQQQGRNQQ 116

Query: 99  -------PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVG 151
                  P     +  +  GSGFF+++DGYI+T+NH+V DGA+F VIL+D TE  AKLVG
Sbjct: 117 QGQQKGQPDSKGHLRPVAQGSGFFVSEDGYIVTNNHVVSDGAAFVVILNDGTEFDAKLVG 176

Query: 152 TDALFDLAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD 210
            D+  DLAVLKV    +KF  V + D   +RVG+ V  +GNPF L GTV+AGIVSA  RD
Sbjct: 177 KDSRTDLAVLKVDGKGKKFTYVSWADDEKVRVGDWVVAVGNPFGLGGTVTAGIVSARGRD 236

Query: 211 IPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKK 269
           I   P   + QIDAP+N+GNSGGP FN  G V+G+N  I +     +G+   IP +  K 
Sbjct: 237 IHSGPYDDYIQIDAPVNKGNSGGPTFNLNGQVVGINTAIFSQSGGSVGIAFAIPATTAKD 296

Query: 270 AIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDV 329
            +  LI  G V  GW G+  Q +T+++A  LGL    G+L+ +    SP  KAG+K GDV
Sbjct: 297 VVADLIKSGTVSRGWLGVQIQPVTKDIAESLGLSEPSGALVVSPQDGSPGQKAGIKNGDV 356

Query: 330 ICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT----AKNDMH 385
           +  ++G  +K  +D   +I +  P  +V +SL + G   SV V LG+ P     A ND +
Sbjct: 357 VTAVNGEPVKDPRDLARRIGAMQPGAKVDVSLWRGGKSQSVTVELGTLPAEQSQASNDDN 416

Query: 386 -------LEVGDKEL--LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                      +K L  LG+ +   +DG  K V I  ++P  + +   KG+++G  I SV
Sbjct: 417 SQPSQPQQPSSEKALADLGLTVGPSDDG--KGVAITGVDP--DSDAADKGVKEGEKITSV 472

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           N  EVS   D+ ++I +AK+  R   L QI      QSG  + SRFV+L I+
Sbjct: 473 NNQEVSNAGDIAKVIEQAKKDGRTRALFQI------QSG--DGSRFVALPIN 516


>gi|304393599|ref|ZP_07375527.1| serine protease [Ahrensia sp. R2A130]
 gi|303294606|gb|EFL88978.1| serine protease [Ahrensia sp. R2A130]
          Length = 493

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 184/500 (36%), Positives = 266/500 (53%), Gaps = 57/500 (11%)

Query: 14  TVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMFN 69
            V+L   +F+    V EA   PS  D   V+  VSP++VSV V+    P      ++ F 
Sbjct: 26  NVSLIQPVFAEAVKV-EAPQAPSFAD---VVEAVSPAVVSVRVKASVKPASNDGNQRGFR 81

Query: 70  AYGFGNLPEDHPLKNYF-----------RKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
             GFGNLPE HPL+ +F           R+    F + +             GSGFF++D
Sbjct: 82  -EGFGNLPEGHPLRRFFEDQQRANPRRDRRSPRNFGTSQ-------------GSGFFVSD 127

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DGY++T+NH+V +G  F+++++D  EL AK++GTD   DLAVLKV+   KF  V+F    
Sbjct: 128 DGYVVTNNHVVANGDEFTIVMNDGVELDAKMIGTDPKTDLAVLKVERAEKFTYVDFAQGK 187

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNA 237
           + RVGE V  +GNPF L GTV+AGIVSA  RDI   P   F QIDA +N+GNSGGP FN 
Sbjct: 188 S-RVGEWVVAVGNPFGLGGTVTAGIVSAAGRDIGSGPYDDFLQIDAAVNKGNSGGPAFNL 246

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G VIGVN  I +    ++G+   I     K+ +  LI +G V  GW G+  Q +++++A
Sbjct: 247 RGEVIGVNTAIFSPSGGNVGIAFAISAKTSKEVVGDLIREGSVTRGWLGVAIQPVSEDIA 306

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
             LGL    G++++     SPADKAGM   DVI  +DG+ +K  +     IA+  P E V
Sbjct: 307 DSLGLDSATGAIVSEASPGSPADKAGMLSRDVIVAVDGKNVKDAKALSRMIAAYEPDEIV 366

Query: 358 KISLCKEGSKHSVAVVLGS------SPTAKNDMHLEVGDKEL--LGMVLQDINDGNKKLV 409
           KI + + G K  + V LG+      +    N    E    EL   GM +    DG    V
Sbjct: 367 KIEVVRNGEKRVIDVTLGTLDQPKEAAAGSNSQPDEKSAIELSDFGMSIIPDEDG----V 422

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           R+ ++  N       KG++ G  IVSVN  E   + DV + + +A E  R +VL Q++  
Sbjct: 423 RVSSVEQN--GAAAEKGLRVGDLIVSVNGKETRSVTDVGQAVAQAMEDDRKAVLFQLR-- 478

Query: 470 PDMQSGNDNMSRFVSLKIDK 489
                 N+  +RF++L +++
Sbjct: 479 ------NNERNRFIALPVNQ 492


>gi|49474035|ref|YP_032077.1| Serine protease [Bartonella quintana str. Toulouse]
 gi|49239539|emb|CAF25896.1| Serine protease [Bartonella quintana str. Toulouse]
          Length = 503

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 180/473 (38%), Positives = 273/473 (57%), Gaps = 51/473 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVS---VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           ++++V P++VSV V+  KK         F++ G   LP+ HPLK +F     +F+   +P
Sbjct: 55  IVSQVKPAVVSVQVKSNKKKKEWFFSDFFSSPGLDQLPDQHPLKKFF----QEFYDRGKP 110

Query: 100 ILSDTVER------LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
             + +++R      + FGSGFFI+ DGY++T+NH++ DG S++V+L D TEL AKL+GTD
Sbjct: 111 -SNKSLKRPHRLRPIAFGSGFFISSDGYLVTNNHVISDGTSYTVVLDDGTELNAKLIGTD 169

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
           A  DLAVLKV   R F  V+F D + +R+G+ V  IGNPF L GTV+AGIVSA  RDI  
Sbjct: 170 ARTDLAVLKVDEKRTFSYVDFGDDSKLRIGDWVVAIGNPFGLGGTVTAGIVSARGRDI-- 227

Query: 214 RPGT-----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIK 268
             GT     F QIDA +N+GNSGGP F+  G VIGVN  I +    ++G+   IP +I K
Sbjct: 228 --GTGVYDDFIQIDAAVNRGNSGGPTFDLNGKVIGVNTAIFSLSGGNVGIAFAIPAAIAK 285

Query: 269 KAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGD 328
           + +  LI KG V  GW G+  Q +T+E++  +GL+  KG+LIT  +K  PA KAG+K GD
Sbjct: 286 QVVQQLIEKGSVQRGWLGVQIQPVTKEISDSIGLKEAKGALITDPLK-GPAAKAGIKAGD 344

Query: 329 VICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP---------- 378
           VI  ++G  I   +D   +IA+  P E V + + K G + ++ V L + P          
Sbjct: 345 VIISVNGEKINDVRDLAKRIANIKPGETVTLGVWKSGKEENIKVKLDTMPDDKVMKEDSK 404

Query: 379 --TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
               +ND +  + D    G+++   +DG    + +V  + + + +   KGI+ G  IV+V
Sbjct: 405 YSNGRNDSNETLED---YGLIVAPSDDG----IGLVVTDVDSDSDAADKGIRPGDVIVTV 457

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           N   V  + D+   I  A++  R ++LLQ++         ++ +RFV+L I K
Sbjct: 458 NNKSVKKVSDITDTIKNAQKLGRKAILLQVR--------TNDQNRFVALPIFK 502


>gi|319405329|emb|CBI78947.1| serine protease [Bartonella sp. AR 15-3]
          Length = 501

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 248/440 (56%), Gaps = 24/440 (5%)

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI-LSDTVERLMFGSGFFIT 117
           K++      F+  G   LP+ HPLK +F+  ++      +P+  S     + FGSGFFI+
Sbjct: 72  KEERFFSNFFSNPGIDQLPDQHPLKRFFKDFYNHTLPNNKPLNRSRKFRPVAFGSGFFIS 131

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGYI+T++H++ DG S+SVIL D TE  AKL+G D   DLAVLKV   RKF  V F D 
Sbjct: 132 PDGYIVTNHHVIVDGTSYSVILDDGTEFEAKLIGADPRTDLAVLKVNDKRKFPYVGFADD 191

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNSGGPCFN 236
           + I VG+ V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNSGGP FN
Sbjct: 192 STIHVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGVYDDFIQIDAAVNRGNSGGPTFN 251

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N  I +    ++G+   IP +  K+ +  L+ KG V  GW G+  Q +T+E+
Sbjct: 252 LNGQVVGINTAIFSPSGGNVGIAFAIPSATAKQVVKQLMEKGSVQRGWIGVQIQPVTKEI 311

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           +  +GL+  KG+LIT  +K  PA KAG+K GDVI  ++G  I   +D   +IA+ +P E 
Sbjct: 312 SDSIGLKEAKGALITDPLK-GPAAKAGVKTGDVIIAVNGEKINDARDLAKRIANTTPGET 370

Query: 357 VKISLCKEGSKHSVAVVLGSSPT-------AKNDMHLEVGDKEL--LGMVLQDINDGNKK 407
           V + + + G + SV V L S P        AK        D+ L   G+++   +DG   
Sbjct: 371 VTLGIWRSGKEESVKVKLDSMPADEGQRERAKYSSEHGNSDETLEDYGLIVAPSDDG--- 427

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            + +V  + + + +   +GI+ G  IV+VN        D+   I  AK+  R++VLLQ++
Sbjct: 428 -MGLVVTDVDSDTDAADRGIRPGDVIVTVNNRPAKKASDITDAIKDAKKLGRNAVLLQVR 486

Query: 468 YDPDMQSGNDNMSRFVSLKI 487
                    ++ +RF++L I
Sbjct: 487 --------TNDQNRFIALPI 498


>gi|319403892|emb|CBI77478.1| serine protease [Bartonella rochalimae ATCC BAA-1498]
          Length = 501

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 166/442 (37%), Positives = 252/442 (57%), Gaps = 24/442 (5%)

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI-LSDTVERLMFGSGFFIT 117
           K++      F++ G   LP+ HPLK +F+  ++      +P+  S     + FGSGFF +
Sbjct: 72  KEERFFSNFFSSPGIDQLPDQHPLKRFFKDFYNHALPNNKPLNRSRKFRPIAFGSGFFTS 131

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGYI+T++H++ +G S++VIL D TEL AKL+G D   DLAVLKV   RKF  V+F D 
Sbjct: 132 SDGYIVTNHHVIAEGTSYAVILDDGTELEAKLIGADPRTDLAVLKVNDKRKFPYVDFADD 191

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNSGGPCFN 236
           + I VG+ V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNSGGP FN
Sbjct: 192 STIHVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGVYDDFIQIDAAVNRGNSGGPTFN 251

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N  I +    ++G+   IP +  K+ +  L+ KG V  GW G+  Q +T+E+
Sbjct: 252 LNGQVVGINTAIYSPSGGNVGIAFAIPSATAKQVVKQLMEKGSVQRGWIGVQIQAVTKEI 311

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           +  +GL+ +KG+LIT  +K  PA KAG+K GDVI  ++G  I   +D   +IA+  P E 
Sbjct: 312 SDSIGLKESKGALITDPLK-GPAAKAGVKAGDVIIAVNGEKINDARDLAKRIANTKPGET 370

Query: 357 VKISLCKEGSKHSVAVVLGSSPT-----AKNDMHLEVGDK----ELLGMVLQDINDGNKK 407
           V + + + G + S+ V L S P       K     E G+     E  G+++   +DG   
Sbjct: 371 VTLGIWRSGKEESIKVKLDSMPADEGQREKGKYSSEHGNSDETLEDYGLIVAPSDDG--- 427

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            V +V  + + + +   +G++ G  IV+VN   V    D+   I  AK+  R+++LLQ++
Sbjct: 428 -VGLVVTDVDSDADAADRGVRPGDVIVTVNNRPVKKASDITDAIKDAKKLGRNAILLQVR 486

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
                    ++ +RF++L I K
Sbjct: 487 --------TNDQNRFIALPILK 500


>gi|319784553|ref|YP_004144029.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170441|gb|ADV13979.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 517

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 168/477 (35%), Positives = 263/477 (55%), Gaps = 48/477 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAY----GFGNLPEDHPLKNYF------------ 86
           V+ RVSP++VSV V+ K   + +   +      G  NLP +  L+ +F            
Sbjct: 58  VVERVSPAVVSVKVKAKISPAADDGSDPSDDQDGMNNLPNNPQLRRFFKEFRGFGDQDGQ 117

Query: 87  ----RKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
               R+  H+  + ++P        +  GSGFFI+DDGY++T+NH+V +G++F+V+++D 
Sbjct: 118 GGGNRRFSHRDRNNDQP------RPVAQGSGFFISDDGYLVTNNHVVSEGSAFTVVMNDG 171

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
            EL AKL+GTD   DLAVLKV    KF  V+F D + +RVG+ V  +GNPF L GTV+AG
Sbjct: 172 KELDAKLIGTDPRTDLAVLKVDGVGKFTYVDFADDSKVRVGDWVVAVGNPFGLGGTVTAG 231

Query: 203 IVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLI 261
           IVSA  RDI   P   F QIDA +N+GNSGGP FN  G V+G+N  I +     +G+   
Sbjct: 232 IVSARGRDIGAGPYDDFIQIDASVNRGNSGGPTFNLNGQVVGINTAIFSPSGGSVGIAFD 291

Query: 262 IPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADK 321
           IP S  K+ +  L+  G V  GW G+  Q +T ++A  LGL+   G+L+++   + P  K
Sbjct: 292 IPASTAKQVVQDLMKSGSVQRGWLGVEIQPVTSDIAESLGLKSNNGALVSSAQDDGPGKK 351

Query: 322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK 381
           AG+  GDVI  ++G+ + S ++    I + SP + V +++ ++G   +V V LG  P++ 
Sbjct: 352 AGITAGDVITQVNGKDVASPKELARLIGAYSPGKSVDVTVWRDGKSQTVKVDLGKLPSSD 411

Query: 382 NDMHLEVGDKEL---------LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMT 432
               ++               LG+ +    +G K LV +  ++P  + +   +GIQ G  
Sbjct: 412 KQASVDQSQPAAPAKPDTLADLGLTVTKSENG-KGLV-VTDVDP--DSDAADRGIQPGDV 467

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           I SVN+ EV+   DV + + +A +  R +VL+QI          D+ +RFV+L + K
Sbjct: 468 ITSVNSTEVNGTDDVTKAMTEAVKSGRKAVLMQITR--------DDTNRFVALPVAK 516


>gi|90419148|ref|ZP_01227059.1| serine protease [Aurantimonas manganoxydans SI85-9A1]
 gi|90337228|gb|EAS50933.1| serine protease [Aurantimonas manganoxydans SI85-9A1]
          Length = 503

 Score =  276 bits (707), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 174/494 (35%), Positives = 268/494 (54%), Gaps = 29/494 (5%)

Query: 12  ICTVALTCVIFSSTYLVLE---AKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + +VALT V+ ++  +  E    + P  +     V+ +VSP++VSV V  +   ++ Q  
Sbjct: 22  VASVALTGVVGNTVPVFAEPVKVEAPVQNFGFADVVEKVSPAVVSVRVTQEVTPTMSQGR 81

Query: 69  N---AYGFGNLPEDHPLKNYFR-KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
                  F +LPEDHPL+ +F         +G  P   +   R+  GSGFFI+DDG+++T
Sbjct: 82  GPDMGSPFDSLPEDHPLRRFFDVPGRDNAPNGMRPD-REPRTRMGQGSGFFISDDGFVVT 140

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV-QSDRKFIPVEFEDANNIRVG 183
           +NH+VE G+ ++V++ D TE  A+L+GTD   DLA+LKV +S+ KF  VEF D + +R+G
Sbjct: 141 NNHVVEGGSQYTVVMDDGTEYDAELIGTDPRTDLALLKVDESNTKFTYVEFGDDDAVRIG 200

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVI 242
           E V  +GNPF L G+V+AGIVSA  RDI   P   F QIDA +N+GNSGGP F   G VI
Sbjct: 201 EWVVAVGNPFGLGGSVTAGIVSARGRDIGAGPYDDFLQIDAAVNRGNSGGPAFGLDGKVI 260

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           GVN  I +    ++G+   IP S+ K  I SL   G V+ GW G+    +T ++A  +GL
Sbjct: 261 GVNTAIFSPSGGNVGIAFAIPASVAKDVIQSLREDGSVERGWLGVQIAPVTDDIAEAVGL 320

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
              KG+++T    E+PA KAG+K GDVI  ++G  +   ++    I +  P  +V +++ 
Sbjct: 321 DQEKGAIVTLPDNETPATKAGIKTGDVITAVNGETVDGPRELARMIGNYRPDTKVDVTIW 380

Query: 363 KEGSKHSVAVVLG-------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALN 415
           ++G    V+V LG       ++    + + ++       G+ L    DG      +V  +
Sbjct: 381 RDGKAQDVSVELGNLSSLDEAASARGSGVPVDPSSLSGYGLTLTPSEDGEG----VVVTD 436

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
              +     KGI+ G  I++VN   V   KDV+  I  A E  R + L Q++        
Sbjct: 437 VKPDSSASEKGIKAGDIIIAVNGETVETQKDVQSAIDAAAETGRKAALFQLQ-------- 488

Query: 476 NDNMSRFVSLKIDK 489
            +  +RFV+L I K
Sbjct: 489 TNGQNRFVALPIAK 502


>gi|319406903|emb|CBI80538.1| serine protease [Bartonella sp. 1-1C]
          Length = 501

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 164/435 (37%), Positives = 248/435 (57%), Gaps = 24/435 (5%)

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVER-LMFGSGFFITDDGYILT 124
             F+  G   LP+ HPLK +F+  ++      +P+      R + FGSGFF + DGYI+T
Sbjct: 79  NFFSNPGIDQLPDQHPLKRFFKDFYNHALPNNKPLNRPRKFRPIAFGSGFFTSSDGYIVT 138

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           ++H++ +G S+++IL D TEL AKL+G D   DLAVLKV   RKF  V+F D + I VG+
Sbjct: 139 NHHVIAEGTSYAIILDDGTELEAKLIGADPRTDLAVLKVNDKRKFPYVDFADDSTIHVGD 198

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNSGGP FN  G V+G
Sbjct: 199 WVVAVGNPFGLGGTVTAGIVSARGRDIGAGVYDDFIQIDAAVNRGNSGGPTFNLNGQVVG 258

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I +    ++G+   IP +  K+ +  L+ KG V  GW G+  Q +T+E++  +GL+
Sbjct: 259 INTAIYSPSGGNVGIAFAIPSATAKQVVKQLMEKGSVQRGWIGVQIQAVTKEISDSIGLK 318

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
            +KG+LIT  +K  PA KAG+K GDVI  ++G  I   +D   +IA+  P E V + + +
Sbjct: 319 ESKGALITDPLK-GPAAKAGVKAGDVIIAVNGEKINDARDLAKRIANTKPGETVTLGIWR 377

Query: 364 EGSKHSVAVVLGSSPT-----AKNDMHLEVGDK----ELLGMVLQDINDGNKKLVRIVAL 414
            G + S+ V L S P       K     E G+     E  G+++   +DG    V +V  
Sbjct: 378 SGKEESIKVKLDSMPADEGQREKGKYSGEHGNSDETLEDYGLIVAPSDDG----VGLVVT 433

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           + + + +   +G++ G  IV+VN   V    D+   I  AK+  R+++LLQ++       
Sbjct: 434 DVDSDADAADRGVRPGDVIVTVNNRPVKKASDITDAIKDAKKLGRNAILLQVR------- 486

Query: 475 GNDNMSRFVSLKIDK 489
             ++ +RF++L I K
Sbjct: 487 -TNDQNRFIALPILK 500


>gi|121601816|ref|YP_988752.1| protease Do family protein [Bartonella bacilliformis KC583]
 gi|120613993|gb|ABM44594.1| protease Do family protein [Bartonella bacilliformis KC583]
          Length = 505

 Score =  272 bits (696), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 172/466 (36%), Positives = 258/466 (55%), Gaps = 33/466 (7%)

Query: 43  VIARVSPSIVSVMV-----EPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
           ++++V P++V+V V     E KK       F + G   LP+ HPLK +F ++FH++    
Sbjct: 53  IVSQVKPAVVAVQVKSDKKETKKDRFFGGFFGSPGMDQLPDQHPLKKFF-EEFHEYAWPN 111

Query: 98  EPI--LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
           +     S     + FGSGFFI+ DGYI+T+NH++  G S+S++L D TEL A+L+GTD  
Sbjct: 112 DKYSNRSRKPRSVAFGSGFFISSDGYIVTNNHVISGGTSYSIVLDDSTELEARLIGTDPR 171

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDR 214
            DLAVLKV   R F  V+F D   +R+G+ V  +GNPF L GTV+AGIVSA  RDI    
Sbjct: 172 TDLAVLKVDDKRTFTYVDFADDTKVRIGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGV 231

Query: 215 PGTFTQIDAPINQGNSGGPCFNALGHVIGVN-AMIVTSGQF--HMGVGLIIPLSIIKKAI 271
              F QIDA +N+GNSGGP FN  G V+GVN A    SG    ++G+   IP    ++ +
Sbjct: 232 YDDFIQIDAAVNRGNSGGPTFNLNGQVVGVNTAFFSPSGGNGGNVGIAFAIPAITAQQVV 291

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             +I KG V  GW G+  Q +T+E++  +GL+  KG+L+T  +K  PA KAG+K GDVI 
Sbjct: 292 KQIIEKGSVQRGWIGVQIQAVTKEISDSVGLKEVKGALVTDPLK-GPAQKAGIKAGDVII 350

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK 391
            ++ + +   +D   +IA+  P E   + + + G + SV V + S P ++N         
Sbjct: 351 SVNDKKVTDARDLARRIANIRPGETATLGVWRSGKEDSVKVKIDSMPESENKGEGSKSSS 410

Query: 392 --------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
                   E  G+++   +D +  +V  V L    + +   +GI+ G  IV+VN   V  
Sbjct: 411 KKGGSETLEDYGLIVTTSDDDSGLIVTDVDL----DSDAAERGIRPGDVIVTVNNKPVKK 466

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             DV   I  A+E  R ++LLQ++          + +RFV+L I K
Sbjct: 467 ASDVADAIKYAQELGRSAILLQVR--------TKDQNRFVALPIIK 504


>gi|110633255|ref|YP_673463.1| protease Do [Mesorhizobium sp. BNC1]
 gi|110284239|gb|ABG62298.1| protease Do [Chelativorans sp. BNC1]
          Length = 509

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 155/441 (35%), Positives = 238/441 (53%), Gaps = 25/441 (5%)

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT 117
           P+        F+  GF NLP +HPL+ +F +   +      P        +  GSGFFI+
Sbjct: 82  PETGTVATPFFDMPGFDNLPPNHPLRRFFDEFQRRDEQPRGPQQRRRTRPVAQGSGFFIS 141

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGYI+T+NH+VE G  ++V+L D TEL A L+G D   DLAVLKV++DR+F  V + + 
Sbjct: 142 GDGYIVTNNHVVEGGNQYTVVLEDGTELQADLIGKDPRTDLAVLKVKADREFTYVTWAND 201

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNSGGPCFN 236
           +  RVG+ V  +GNPF L GTV+AGIVSA  R+I       F QIDA +NQGNSGGP FN
Sbjct: 202 DAARVGDWVVAVGNPFGLGGTVTAGIVSARGREIGAGNYDDFLQIDAAVNQGNSGGPTFN 261

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+GVN  I +    ++G+   IP S+ K  +  LI  G V+ G+ G+  Q +T ++
Sbjct: 262 LAGEVVGVNTAIFSPSGGNVGIAFAIPASLAKTVVEQLIEDGSVERGYMGVSIQEVTPQI 321

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  LGL+  +G+LI +     PA +AG++ GDV+  ++G+ I + ++    +A+  P  +
Sbjct: 322 AESLGLQDARGALINSANSGDPAARAGIQAGDVVIAVNGKTIATPRELARTVAAIQPGTE 381

Query: 357 VKISLCKEGSKHSVAVVL----------GSSPTAKNDMHLEVGDKELLGMVLQDINDGNK 406
           + +++ + G     +V L           ++P+A +    E G     G+ +   +DGN 
Sbjct: 382 IDVTVWRNGKSQDFSVTLTEMPDTDQVASAAPSAPS--QDEGGQPASFGLTVAPADDGNG 439

Query: 407 KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
            +V  V          E  GIQ G  I ++N+  V+   D+++    A    R +VLLQ+
Sbjct: 440 LVVTDVEPG----SVAEENGIQPGDVIRAINSQPVTTAGDLKKAADAASSAGRGAVLLQV 495

Query: 467 KYDPDMQSGNDNMSRFVSLKI 487
                     D+ +RFV+L I
Sbjct: 496 V--------RDDANRFVALPI 508


>gi|328544520|ref|YP_004304629.1| serine protease DO-like protease [polymorphum gilvum SL003B-26A1]
 gi|326414262|gb|ADZ71325.1| Serine protease DO-like protease [Polymorphum gilvum SL003B-26A1]
          Length = 513

 Score =  259 bits (662), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 170/480 (35%), Positives = 249/480 (51%), Gaps = 42/480 (8%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG----------NLPE 78
           +EA  P   +D   V+  V P++VSV V  K++ + E M    G            +LP+
Sbjct: 52  VEAAAP---LDFSHVVDAVQPAVVSVRV--KQEAAAEAMTFGSGGFGDFFRGPGFDDLPD 106

Query: 79  DHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
            HPLK +F +      S   P  +     L  GSGFFI+DDGY++T++H+++ G  F+V+
Sbjct: 107 GHPLKRFFDRRSEDNRS--TPRQAPRRYGLSQGSGFFISDDGYVVTNHHVIDKGTEFTVV 164

Query: 139 LSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGT 198
             D  E  A+L+G DA  DLA+LKV ++R F  V F +    RVGE V  IGNPF L G+
Sbjct: 165 DQDGEEYTARLIGADARTDLALLKVDAERTFTYVGFAE-EAPRVGEWVVAIGNPFGLGGS 223

Query: 199 VSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           V+AGIVSA  RDI   P   F QIDAP+N+GNSGGP FN  G VIGVNA I +    ++G
Sbjct: 224 VTAGIVSARGRDIGAGPYDDFIQIDAPVNRGNSGGPAFNMKGEVIGVNAAIFSPSGGNVG 283

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +   IP S     +  L   G V  GW G+  Q +T ++A  LGL   +G+++      S
Sbjct: 284 IAFAIPASTASNVVADLQQSGAVTRGWLGVQIQAVTNDIAESLGLAKAEGAIVAEAQDGS 343

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS- 376
           PADKAG++ GD I  +DG+ IK  +D    IA  +P   V +++ ++G +  + V LG+ 
Sbjct: 344 PADKAGLRSGDTILKVDGKPIKGPRDLSRLIAGYAPDTTVDVTVWRDGRERDIQVTLGTL 403

Query: 377 ---------SPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGI 427
                     P  +    LE      LG+ L    +       +V ++         KG+
Sbjct: 404 DEPSRVAAADPATQGPTTLED-----LGLGLTSTAEAGIDGDGVVVVDVTPGGPAAEKGL 458

Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           ++G  I  V   +V+   DV   I KA+   R +VL+++         +D  SRFV+L +
Sbjct: 459 KRGDIIAEVAGEKVARPADVVEAIAKAQASGRKAVLMRVY--------SDRASRFVALPL 510


>gi|323137185|ref|ZP_08072264.1| protease Do [Methylocystis sp. ATCC 49242]
 gi|322397543|gb|EFY00066.1| protease Do [Methylocystis sp. ATCC 49242]
          Length = 502

 Score =  259 bits (661), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 153/441 (34%), Positives = 245/441 (55%), Gaps = 24/441 (5%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           V+ RV P++V++ V+     + E+  + +    L  D P+  +F++       G++ +  
Sbjct: 67  VVDRVKPAVVAIKVK-----ATEEDHDHFDVPGLSPDDPMYRFFKRFGEDGGRGQKHVT- 120

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
                +  GSGF ++ DGY++T+NH+VE  +   V L     LPAK++GTD   DLA+LK
Sbjct: 121 -----MSQGSGFIVSPDGYVVTNNHVVEHASEVEVALDSGKTLPAKVIGTDKRTDLALLK 175

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQI 221
           +    K   VE+  AN  RVG+ V  +GNPF L G+V+AGIVSA  RDI   P   F QI
Sbjct: 176 ISDGDKLPYVEWSSANP-RVGDWVIAVGNPFGLGGSVTAGIVSARGRDIGAGPYDDFLQI 234

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DAP+N+GNSGGP F+  G VIGVN  I +     +G+G  IP  + K  + +L  KG V 
Sbjct: 235 DAPVNRGNSGGPAFDTRGAVIGVNTAIYSPSGGSVGIGFAIPAEVAKDVVAALKEKGAVS 294

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            GW G+  QN+TQE+A  +GL+ TKG+LI    K +PA++AG+K GDVI  ++G  I++ 
Sbjct: 295 RGWIGVKIQNVTQEIADSMGLKSTKGALIAQPQKGAPAEEAGLKAGDVITAVNGEKIETP 354

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN----DMHLEVGDKELLGMV 397
           ++   +IA+  PK+ V I+  + G++ +V + LG  P  K     +        E+ G+ 
Sbjct: 355 RELARKIAAMGPKKSVDITFLRNGAEKTVKLTLGVLPEEKEARADNDFGGGDGGEITGLG 414

Query: 398 LQ-----DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
           ++     ++    ++ V +  ++P+       KG+++G  IV      V+   D+     
Sbjct: 415 IEVAPASEVRGAGREGVIVTDIDPS--GAAAQKGVRRGDVIVEAGGQTVNSRADLASAFD 472

Query: 453 KAKEKKRDSVLLQIKYDPDMQ 473
            A+++ R SVLL++K    M+
Sbjct: 473 AARKEGRRSVLLRVKSADGMK 493


>gi|144118|gb|AAA53693.1| immunoreactive stress response protein [Brucella abortus]
          Length = 500

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 162/460 (35%), Positives = 244/460 (53%), Gaps = 36/460 (7%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE-----QMFNAYGFGNLPEDHPLKNYFRK 88
           PP       ++ +V P++VSV V  KK V        Q F   GF  LP+ HPLK +FR 
Sbjct: 47  PPPQAGFADLVEKVRPAVVSVRV--KKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFR- 103

Query: 89  DFHKFFSGEEPILSDTV-----------ER-LMFGSGFFITDDGYILTSNHIVEDGASFS 136
           DF     G+    SD             ER +  GSGF I++DGY++T+NH+V DG +++
Sbjct: 104 DFGMEPRGDS--RSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYT 161

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           V+L D TEL AKL+G D   DLAVLK+ +  RKF+           VG+ V  +GNPF L
Sbjct: 162 VVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYSPLATIIRCDVGDWVVAVGNPFGL 221

Query: 196 RGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
            GTV++GIVSA   DI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +    
Sbjct: 222 GGTVTSGIVSARGADIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG 281

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +  
Sbjct: 282 TVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQ 341

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V +
Sbjct: 342 DDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTI 401

Query: 375 GSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG 426
            + P  K     +  D         +  G+ +    DG  K V +  ++P  + +   +G
Sbjct: 402 AAMPNDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDG--KGVVVTDVDP--DSDAADRG 457

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           I+ G  IVSVN   V    D+ + I  A++  R+     I
Sbjct: 458 IRSGDVIVSVNNQTVKTAGDINKAITAAEKSGRNGAAAAI 497


>gi|27377702|ref|NP_769231.1| DO-like serine protease [Bradyrhizobium japonicum USDA 110]
 gi|27350847|dbj|BAC47856.1| serine protease DO-like protease [Bradyrhizobium japonicum USDA
           110]
          Length = 528

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 163/466 (34%), Positives = 249/466 (53%), Gaps = 27/466 (5%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKF 93
           PP   DL   +ARV P+++SV V   +      M       +  ED P   + R+   + 
Sbjct: 77  PPGFGDL---VARVKPAVISVRVRIDQDNDKSAMLQQNRM-DSDEDAPFDQFSRQFGFRL 132

Query: 94  FSGEEPILSDTVERLMF-GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
             G   +     + +   GSGFFI+ DGY +T+NH+V+   S  V + D T   AK+VGT
Sbjct: 133 PGGMNGMPRQRHQMVTGEGSGFFISADGYAVTNNHVVDHAESVQVTMDDGTSYTAKVVGT 192

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   DLA++KV   + F  V+F D    R+G+ V  +GNPF L GTV+AGIVSA  RDI 
Sbjct: 193 DPKTDLALIKVDGKKDFPFVKFSD-QKPRIGDWVVAVGNPFGLGGTVTAGIVSASGRDIG 251

Query: 213 DRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
           + P   F QIDAPIN+GNSGGP F+  G+VIGVN  I +     +G+G  IP +  K  +
Sbjct: 252 NGPYDDFIQIDAPINKGNSGGPAFDMSGNVIGVNTAIFSPSGGSVGIGFDIPATTAKLVV 311

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             L  KG V  GW G+  Q +T E+A  LGL+  +G+++      SPA KAG++ GDVI 
Sbjct: 312 AQLKDKGAVTRGWLGVQVQPVTSEIADSLGLKEARGAIVDNPQDNSPAAKAGIEAGDVIT 371

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK------NDMH 385
            ++G  IK  +D    +A+ +P   VK+ +  +G+  +V + LG  P  +      ++  
Sbjct: 372 AVNGTAIKDSRDLARTVATLAPGTSVKLDVFHKGASKTVTLALGELPNERQAQGKADEGK 431

Query: 386 LEVGD-KELLGMVLQ---DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEV 441
            + G+    LG+ L    D+    +K V +  ++P  +     +GIQ G  I++V    V
Sbjct: 432 AQPGNGTPRLGLSLAPAGDVQGAGQKGVVVTEVDP--QGPAAQRGIQTGDVILNVGGKPV 489

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           + + DV   + +AK   ++SVLLQI+        + + +RFV++ +
Sbjct: 490 ANVGDVRAELAQAKSSGKNSVLLQIR--------SADATRFVAVPL 527


>gi|170743953|ref|YP_001772608.1| protease Do [Methylobacterium sp. 4-46]
 gi|168198227|gb|ACA20174.1| protease Do [Methylobacterium sp. 4-46]
          Length = 504

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 170/498 (34%), Positives = 259/498 (52%), Gaps = 32/498 (6%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLP--------PVIARVSPSIVSVMVE 57
           + +V  + T AL       +  VL   LP + +  P        P++ RV P +VSV V+
Sbjct: 18  VAAVTLVATGALGSAFLPPSTPVLAQALPQTPITAPEHPPGSFAPIVNRVKPGVVSVKVK 77

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT 117
            K   + ++     G  N+P    L+ +FR+ F +      P  +    R   GSGFFI+
Sbjct: 78  LKDDAADDEE-GGPGGQNVPPQ--LREFFRR-FGENGMPNRPHRNGG--RAAQGSGFFIS 131

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGY++T+NH+VE+  S  V L D   L AK+VGTD   DLA+LKV       P      
Sbjct: 132 ADGYVVTNNHVVENAKSVEVTLDDGRTLDAKVVGTDPKTDLALLKVTEGNGSFPYVRLAH 191

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFN 236
              +VG+ V  IGNPF L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP FN
Sbjct: 192 GAPQVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFN 251

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+GVN  I +    ++G+   IP   ++  +  L + G+V  G+ G+  Q +T+++
Sbjct: 252 VSGEVVGVNTAIASPSGGNVGLAFAIPSETVQAVVDQLRTDGKVARGYLGLQIQPVTKDI 311

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  LGL   KG+L+T+    +PA KAG+K GDV+  ++G  +   ++   +IAS  P  +
Sbjct: 312 AEGLGLDKAKGALVTSAQDGTPAAKAGLKSGDVVQAVNGDPVGDARELSRRIASMKPGTK 371

Query: 357 VKISLCKEGSKHSVAVVLGSSP-----TAKNDMHLEVGDKELLGMVL--QDINDGNKKLV 409
           V++S  + G   +  V L + P      A+ +       +  LG+ L   D     ++ V
Sbjct: 372 VQLSYLRGGKTDTATVELATLPNDTRVAAREERGRGSDAQPRLGLSLAPADAVGAGQEGV 431

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +V ++P  +    AKGI+ G  I+ V    VS + DV+  I  A+   R +VL+++K  
Sbjct: 432 AVVNVDP--DGPAAAKGIEPGDVILDVGGQPVSSVSDVQGRIRAAERDGRKAVLMRVK-- 487

Query: 470 PDMQSGNDNMSRFVSLKI 487
                 +D  +RFV++ +
Sbjct: 488 ------SDKGTRFVAIAL 499


>gi|220926274|ref|YP_002501576.1| protease Do [Methylobacterium nodulans ORS 2060]
 gi|219950881|gb|ACL61273.1| protease Do [Methylobacterium nodulans ORS 2060]
          Length = 502

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 170/489 (34%), Positives = 253/489 (51%), Gaps = 32/489 (6%)

Query: 2   FKRQILS----VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLP--------PVIARVSP 49
           F R+ L+    V  + T AL       +  VL   LP + + +P        P++ RV P
Sbjct: 10  FHRKALASVAAVTLVATGALGTAFLPPSTPVLAQALPQTPITVPEHPPGSFAPIVNRVKP 69

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM 109
            +VSV V  K     +    +    NLP    L+ +FR+ F +      P  +    R  
Sbjct: 70  GVVSVKVSLKDGADDDDGPGS--VQNLPPQ--LREFFRR-FGENGMPNRPHRNGG--RAA 122

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGFFI+ DGY++T+NH+VE+  S  V L D   L AK++GTD   DLA+LKV     F
Sbjct: 123 QGSGFFISPDGYVVTNNHVVENAQSVEVTLDDGRTLAAKVIGTDPKTDLALLKVTEGGPF 182

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
             V+       +VG+ V  IGNPF L GTV+AGIVSA  RDI   P   F QIDAPIN+G
Sbjct: 183 PYVKLAHGAP-QVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDAPINKG 241

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G V+GVN  I +    ++G+   IP   ++  +  L + G+V  G+ G+ 
Sbjct: 242 NSGGPTFNVSGEVVGVNTAIASPSGGNVGLAFAIPSETVQAVVDQLRTDGKVARGYLGLQ 301

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +T+++A  LGL   KG+L+T+    +PA KAG+K GDV+  ++G  +   ++   +I
Sbjct: 302 IQPVTKDIAEGLGLDKAKGALVTSTQDGTPAAKAGLKSGDVVQAVNGEPVSDARELSRRI 361

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE--------LLGMVLQD 400
           A+  P  +V++S  + G   +  V LG+ P   ND+ +   D+          LG+ L  
Sbjct: 362 AAMKPGTKVELSYLRGGKTDTATVELGTLP---NDIKVASRDERGRGSDAQPRLGLSLAP 418

Query: 401 INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
            +        +  +N + +    AKGI+ G  I+ V    VS + DV+  I  A+   R 
Sbjct: 419 ADAVGAGTEGVAVVNVDPDGPAAAKGIEPGDIILDVGGQPVSSVSDVQSRIRSAERDGRK 478

Query: 461 SVLLQIKYD 469
           +VL++IK D
Sbjct: 479 AVLMRIKSD 487


>gi|254472015|ref|ZP_05085416.1| serine protease [Pseudovibrio sp. JE062]
 gi|211959217|gb|EEA94416.1| serine protease [Pseudovibrio sp. JE062]
          Length = 516

 Score =  247 bits (631), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 151/409 (36%), Positives = 217/409 (53%), Gaps = 24/409 (5%)

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMF----GSGFFITDDGYILTSNHI 128
           F ++P+DHPL+ +FR+    F             R  F    GSGFFI+DDGY++T+ H+
Sbjct: 99  FRDMPDDHPLQKFFRE----FGGKGGEQKKKAPPRKRFDQSQGSGFFISDDGYVVTNEHV 154

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           VE G  F+++ S+  EL A LVG D   DLA+LKV+S+ KF  V F D   + VG  V  
Sbjct: 155 VEGGTEFTIVTSEGDELEATLVGADKRSDLALLKVESEEKFEYVAFADDAPL-VGSWVVA 213

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGT-----FTQIDAPINQGNSGGPCFNALGHVIG 243
           +GNPF L GTV+AGIVSA  RDI    G      F QIDA +N+GNSGGP FN  G V+G
Sbjct: 214 VGNPFGLGGTVTAGIVSARGRDI----GAGIYDDFLQIDASVNRGNSGGPAFNVKGEVVG 269

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           VN+ IV+    ++G+   IP    KK I  L   G V  GW G+  Q +T+++A  LGL 
Sbjct: 270 VNSAIVSPSGGNVGIAFAIPAQTAKKIISDLKEDGAVTRGWLGVQIQPVTKDIAESLGLD 329

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+  V  ++PA  AG + GD+I  +DG  +   ++    IA  SP  +V+I   +
Sbjct: 330 NENGTLVAEVQGDTPAKAAGFQAGDIILKVDGEEVNGPRELAKVIAGYSPNTEVEIEYWR 389

Query: 364 EGSKHSVAVVLGSSP------TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPN 417
           +G  ++  V LG+ P      +AK          + LG+ L    +       +V    +
Sbjct: 390 DGEINTATVKLGTIPEEKQQASAKQSEDANTALVDSLGLELATAEEAGVDEEGVVVTKVD 449

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
            +     KG+  G  I  V   +V    DV   + KA+E+ R +VLL++
Sbjct: 450 PDGPAADKGLAPGAIITEVANVKVQSPADVAEQVEKAREQGRKAVLLRV 498


>gi|312115806|ref|YP_004013402.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
 gi|311220935|gb|ADP72303.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
          Length = 532

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 160/473 (33%), Positives = 250/473 (52%), Gaps = 42/473 (8%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKF 93
           PP+  DL     +V P++VSV V+ +         +     +LP+DHPL+ +F +     
Sbjct: 63  PPTFADL---ADKVRPAVVSVNVKSRGAAGETAQKD---LPDLPQDHPLREFFDQ----- 111

Query: 94  FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
           F   +P    +  +   GSGF I+ DGY++T++H+ +      +   ++ +  AK+VG+D
Sbjct: 112 FKHNQPERRPSRAQ---GSGFLISPDGYVVTNHHVADKVDEIEITFENEEKYKAKVVGSD 168

Query: 154 ALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           A  D+A+LK+ S +KF   +EFEDA   RVG+ V  +GNPF L GTV+AGIVSA  RDI 
Sbjct: 169 ARTDIALLKIDSKKKFDNWLEFEDAA-PRVGDWVLAVGNPFGLGGTVTAGIVSANGRDIG 227

Query: 213 DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
             P  F QIDA +N+GNSGGP  +  G V+GVN  I +     +G+   IP S  K+ + 
Sbjct: 228 SGPYDFLQIDAAVNRGNSGGPAVDLKGKVVGVNTAIYSPSGGSVGIAFAIPTSTAKEVVD 287

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L  KG+V  GW G+  QNL + +A   GL+  KG+L+  ++ + PA K+ +K  DVI  
Sbjct: 288 KLRDKGKVSSGWLGVQIQNLDENIAESQGLKTAKGALVAKIIADGPAAKSELKARDVIQQ 347

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG--- 389
           ++GR + + ++    IA+  P    K+ + + G +  V V LG  P       L+ G   
Sbjct: 348 VNGRTVGNSRELARTIAALPPGADAKLRVFRNGEEREVTVKLGEFPANDKLASLQGGGND 407

Query: 390 --DKELLGMVLQDI-----------NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
             D    G  L+D+               K+ V IV ++PN   +   +G+++G  IV V
Sbjct: 408 DSDSSASGKELEDLGLTLIPAPEFPGAKTKEGVAIVNVDPN--SKAADQGLRRGDVIVEV 465

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           N   V+   +V   I  A++K + +VLLQ++        + +  RF+ L IDK
Sbjct: 466 NGKTVTSPDEVVEGIRDARQKNKKNVLLQVR--------SRDQQRFIGLPIDK 510


>gi|118587756|ref|ZP_01545166.1| serine protease [Stappia aggregata IAM 12614]
 gi|118439378|gb|EAV46009.1| serine protease [Stappia aggregata IAM 12614]
          Length = 494

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 158/426 (37%), Positives = 231/426 (54%), Gaps = 21/426 (4%)

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVER---LMFGSGFFITDDGYILTSNHIV 129
           F  LP+ HP + +FR DF     GE+        R   +  GSGFFI+DDGY++T++H++
Sbjct: 78  FKGLPDGHPFQRFFR-DFGGK-GGEQQQNQRRAPRQYGISQGSGFFISDDGYLVTNHHVI 135

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           E+G  F+VI  D  E  AKL+G D   DLA+LKV S  KF  VEF      +VGE    I
Sbjct: 136 ENGTEFTVIDRDGKEYDAKLIGADKRTDLALLKVDSGDKFTYVEFA-KEAPQVGEWTVAI 194

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF L G+V+AGIVSA  RDI   P   F QIDAP+N+GNSGGP FN  G VIGVNA I
Sbjct: 195 GNPFGLGGSVTAGIVSARGRDIGAGPYDDFIQIDAPVNRGNSGGPAFNMHGEVIGVNAAI 254

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +    ++G+   IP S  +  I  L   G V  GW G+  QN+T ++A  LGL   +G+
Sbjct: 255 FSPSGGNVGIAFAIPASTAQDVIMELKDDGTVVRGWLGVQIQNVTDDIAESLGLDEARGA 314

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           ++    + SPA KAG++ GD I  +DG  +K  ++    IA+  P   V I++ ++G K 
Sbjct: 315 IVAEAQENSPAQKAGLRSGDTILAVDGTEVKGPRELSKIIAAYEPDSNVDITVWRDGQKE 374

Query: 369 SVAVVLG--SSPTAKNDMHLEVGDKEL----LGMVLQDINDGNKKLVRIVALNPNREREV 422
            V V LG    P     +  E  + +     LG+VL    +   +   +V    + +   
Sbjct: 375 DVIVTLGRLQEPDRVAAVQPEAAESKTSLDDLGLVLTTKAEAGMEGDGVVIAEIDPDSPA 434

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
             K +  G  I+ V   +V+   DV + + KA++  R +VL +++        ++N +RF
Sbjct: 435 AEKRLNTGDVILEVAGMKVNSPSDVLKALEKAEKDGRKAVLFRVE--------SNNNTRF 486

Query: 483 VSLKID 488
           V+L ++
Sbjct: 487 VALPMN 492


>gi|222081971|ref|YP_002541336.1| serine protease DO-like protein [Agrobacterium radiobacter K84]
 gi|221726650|gb|ACM29739.1| serine protease DO-like protein [Agrobacterium radiobacter K84]
          Length = 500

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 147/445 (33%), Positives = 237/445 (53%), Gaps = 22/445 (4%)

Query: 42  PVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL 101
           P++    P++V+V    K   +     N+      P D   + +F      F   + P  
Sbjct: 52  PIVDADKPAVVTVTTTMKATDTSADTSNS------PMDEQFRQFFENQGIPFPQQQAPQR 105

Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
             +   +  GSGF I+ DG I+T+NH++E+  +  V L D TELPAKL+G DA  DLAVL
Sbjct: 106 HQSQSAMALGSGFIISPDGIIVTNNHVIENATNIKVTLDDGTELPAKLLGADAKSDLAVL 165

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQ 220
           K+Q+ +    V + D++ +++G+ +  IGNPF +  TV+AGIVSA  RD+   P   F Q
Sbjct: 166 KIQAPKPLATVAWGDSDKLKLGDQILAIGNPFGIGTTVTAGIVSARGRDLHSGPYDDFIQ 225

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
           IDAPIN GNSGGP  +  G+V+G+N  I +     +GVG  IP    K  +  L   G +
Sbjct: 226 IDAPINHGNSGGPLVDREGNVVGINTAIYSPNGGSVGVGFAIPSDEAKAIVAKLEKNGSI 285

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
           DHG+ G+  Q +T ++A  +GL   +G+L+ +V   +PA +AG+K GD++  ++   +K+
Sbjct: 286 DHGYLGVAIQPVTSDIANAVGLSQPQGALVASVNDGTPAARAGIKSGDIVTAVNDETVKT 345

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL------ 394
            +D    +A  SP ++  +++ ++G    V V +G +   K   + + GD ++L      
Sbjct: 346 PKDLSRLVADLSPGDKRSLTVWRDGKSMDVNVTIGGNDDGKQAAN-DGGDGKVLPSNQPS 404

Query: 395 -GMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
            G+ L D+    ++ + +       V  + N ++   A GIQ G  IVSVN   V    D
Sbjct: 405 IGVGLADLTPDLREQLNLPHSVQGAVVASVNPDKSAAAAGIQAGDVIVSVNDQPVHSAHD 464

Query: 447 VERLIGKAKEKKRDSVLLQIKYDPD 471
           V+  + +A +  R SVLL I+   D
Sbjct: 465 VQSAVAEAGKAGRKSVLLLIERGGD 489


>gi|254502930|ref|ZP_05115081.1| protease Do subfamily [Labrenzia alexandrii DFL-11]
 gi|222439001|gb|EEE45680.1| protease Do subfamily [Labrenzia alexandrii DFL-11]
          Length = 500

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 172/505 (34%), Positives = 263/505 (52%), Gaps = 48/505 (9%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE 65
           +++V++I    L      +T + ++   P    D   V+  VSP++VSV V   K+ +  
Sbjct: 20  LMTVQTIVPAQLA----QATPVRIDNAAP---ADFSDVVGAVSPAVVSVQV---KQAAEP 69

Query: 66  QMFNAYG-------FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVER---LMFGSGFF 115
           +M N  G       F +LP  HP + +FR DF +   GEE        R   +  GSGFF
Sbjct: 70  RMMNFNGGNNFRDFFEDLPNGHPFERFFR-DFGER-GGEEGRPQRPTPRQYGMSQGSGFF 127

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
           I+ DG+++T+ H+++ G  F+VI  +  E  A L+G D   DLA+LK+   + F  V+F 
Sbjct: 128 ISADGFVVTNQHVIDKGTEFTVIDHEGEEYDAVLIGADKRTDLALLKIDGGKDFTYVDFA 187

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPC 234
           D     VGE    IGNPF L G+V+AGIVSA  RDI   P   F QIDAP+N+GNSGGP 
Sbjct: 188 D-EAPEVGEWTVAIGNPFGLGGSVTAGIVSARGRDIGAGPYDDFIQIDAPVNRGNSGGPA 246

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
           FN  G VIGVNA I +    ++G+   IP S  +  I  L   G V  GW G+  QN+T 
Sbjct: 247 FNMNGEVIGVNAAIFSPSGGNVGIAFAIPASTAQDVIMELKDDGTVVRGWLGVQIQNVTD 306

Query: 295 ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK 354
           ++A  LGL    G++++   + SPA KAG++ GD I  ++G  +   +D    IA+  P 
Sbjct: 307 DIAESLGLDEAHGAIVSEAQEGSPAAKAGLRSGDTILEVEGAKVDGPRDLSKIIAAYDPD 366

Query: 355 EQVKISLCKEGSKHSVAVVLG---------SSPTAKNDMHLEVGDKELLGMVLQDINDG- 404
             V+I++ ++G +  + V LG         + P A       + D   +G+VL    D  
Sbjct: 367 TSVEITVWRDGKEQDIDVTLGRLQDQQQAAAEPEAVEQQKTSLDD---MGLVLTSKADAG 423

Query: 405 -NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
            +   V I  ++P  +     K + +G  I+ V    V+  +DV + + KA+E  R +VL
Sbjct: 424 LDGNGVLIADIDP--DSPASEKRLSRGDVILEVAGMPVNSPEDVIKAVKKAEEDGRKAVL 481

Query: 464 LQIKYDPDMQSGNDNMSRFVSLKID 488
            +++        NDN +RFV+L ++
Sbjct: 482 FRVES-------NDN-TRFVALPMN 498


>gi|296448435|ref|ZP_06890319.1| protease Do [Methylosinus trichosporium OB3b]
 gi|296254059|gb|EFH01202.1| protease Do [Methylosinus trichosporium OB3b]
          Length = 507

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 163/466 (34%), Positives = 242/466 (51%), Gaps = 32/466 (6%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKF 93
           P S  DL   + RV P++V++  +  +     +         L  D PL  +FR      
Sbjct: 58  PKSFADL---VERVKPAVVAIKTKAIEVGGGPEEGVPGMPPELSPDDPLYRFFR-----H 109

Query: 94  FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
           F   +      V +   GSGF IT DGY++T+NH+VE      V   D   LPAK+VGTD
Sbjct: 110 FGPPQGRRQKHVTQAQ-GSGFVITSDGYVVTNNHVVEHATQVEVSFDDGRTLPAKIVGTD 168

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              DLA+LK+    K   V++  + + R+G+ V  +GNPF L GTV+AGIVSA  RDI  
Sbjct: 169 KRTDLALLKISDGNKLAHVDWA-STSPRIGDWVIAVGNPFGLGGTVTAGIVSARGRDIGA 227

Query: 214 RP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
            P   F QIDAP+N+GNSGGP F+  G VIGVN  I +     +G+G  IP  + K  I 
Sbjct: 228 GPYDDFLQIDAPVNRGNSGGPSFDERGQVIGVNTAIYSPSGGSIGIGFAIPAEVAKDVIA 287

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
           +L  KG+V  GW G+  Q +TQE+A  LGL+ TKG+L+    +  PAD AG+K GDVI  
Sbjct: 288 ALKDKGQVARGWIGVQIQPVTQEIAESLGLKSTKGALVAQPQRGGPADAAGLKSGDVITA 347

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK------NDMHL 386
           +DG+ I + ++   +IA+  P +   I+  + GS+ +  + LG  P+ K       D  +
Sbjct: 348 VDGQKIDNPRELARRIATLGPGKTADITYLRGGSEKTARLKLGKLPSEKEAATETEDDGV 407

Query: 387 EVGDK-ELLGMVLQDINDGNKKLVR----IVALNPNREREVEAKGIQKGMTIVSVNTHEV 441
           E G      G+ +   ++   +       +V ++PN       KG+Q+G  I+  N   +
Sbjct: 408 EQGSALAAYGIEVAPASELRGRGGGEGLIVVGIDPN--GSAAQKGLQQGDVILEANGRSM 465

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
               D+   I   K++ R SVLL++K        +   +RFV+L +
Sbjct: 466 KRPGDLSDAIDAVKKEGRKSVLLRVK--------SQGGTRFVALSV 503


>gi|154251399|ref|YP_001412223.1| protease Do [Parvibaculum lavamentivorans DS-1]
 gi|154155349|gb|ABS62566.1| protease Do [Parvibaculum lavamentivorans DS-1]
          Length = 491

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 158/466 (33%), Positives = 252/466 (54%), Gaps = 38/466 (8%)

Query: 35  PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLP--EDHPLKNYFRK-DFH 91
           PS  DL   + +V+P++VS+      +V  E    + G  +LP     P + +FR     
Sbjct: 52  PSFADL---VEKVNPAVVSI------RVDEEVAARSSGVPDLPFPPGSPFEKFFRDMQPQ 102

Query: 92  KFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVG 151
           +   G  P    T      GSGF I+ DG+++T+NH+V DG   +V+ SD +E+ AKL+G
Sbjct: 103 QGPDGAPPRRHATA----LGSGFLISADGFVVTNNHVVGDGKDITVVRSDGSEMKAKLIG 158

Query: 152 TDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI 211
            D   DLA++KV+S      V F +++N+RVG+ V  +GNPF L GTV+ GIVSA  R+I
Sbjct: 159 RDPKTDLALVKVESKEPLPYVVFGNSDNVRVGDWVLAVGNPFGLGGTVTTGIVSARGREI 218

Query: 212 PDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKA 270
              P   F QIDA IN+GNSGGP F+  G+V+GVN  I +     +G+G  IP SI +  
Sbjct: 219 GAGPYDDFIQIDASINKGNSGGPTFDVRGNVVGVNTAIFSPTGGSVGIGFAIPSSIAQNV 278

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
           I  L   G+V  GW G+  Q + +++A  L L   +G+L+  V ++SPA KAG++ GDVI
Sbjct: 279 IAQLKEDGKVTRGWLGVTIQQVDEDVASTLALDKPRGALVAQVAEDSPAKKAGIQTGDVI 338

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP-------TAKND 383
             +DG+ ++  +     +A   P  + +I L ++G + +++  +G+ P        +   
Sbjct: 339 LNVDGKEMEDVRAVSRTVADLQPDTRSQIVLWRDGKRKNISAQIGTFPEEIAAAAASPTG 398

Query: 384 MHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
                G  E LG+ L    +G    V + +++P    +   KG++ G  IV V+  +V+ 
Sbjct: 399 EAPAAGTTESLGLALTRSPEG----VMVQSVDP--ASDAAEKGVRPGDIIVKVSGKDVTE 452

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             DV   + +A +  ++SVLL ++         DN  RFV+L ++K
Sbjct: 453 PADVVARVAEAGKADKNSVLLLLR--------TDNQQRFVALTLEK 490


>gi|262277522|ref|ZP_06055315.1| protease Do [alpha proteobacterium HIMB114]
 gi|262224625|gb|EEY75084.1| protease Do [alpha proteobacterium HIMB114]
          Length = 472

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 156/466 (33%), Positives = 252/466 (54%), Gaps = 32/466 (6%)

Query: 37  SVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
           S+D+    ++++  ++  +V       VE     + F   P   P + +F KDF +    
Sbjct: 23  SIDVSKGFSKLAEKLMPSVVNISATTIVETRSQEFPF-QFPPGSPFEEFF-KDFQQ---N 77

Query: 97  EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
           + P      +    GSGF I ++G ++T+NH++++     V  +D  E  AKL+GTD + 
Sbjct: 78  QGP---QKRKSTALGSGFVIKENGTVITNNHVIQNAEGIFVKFTDGKEYEAKLIGTDPVS 134

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRP 215
           D+AVLK+QSD+KF  V F +++  +VG+ V  IGNPF L GTV+ GIVSA++RDI   R 
Sbjct: 135 DIAVLKIQSDKKFPAVNFANSDEAKVGDWVIAIGNPFGLGGTVTQGIVSAINRDINMGRY 194

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q DA INQGNSGGP FN  G V+G+N  I ++    +G+G  IP +  K  I  LI
Sbjct: 195 DNFIQTDASINQGNSGGPLFNMDGEVLGINTAIFSNSGGSVGIGFAIPSNFAKNVIDQLI 254

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
             G    GW G+  Q +T+E+A  LGL+   G+LIT + K SPADKAG+  GD+I   +G
Sbjct: 255 KFGETKRGWLGVRIQTVTKEIADSLGLKEAIGALITDINKGSPADKAGLNSGDIIIKFNG 314

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG---SSPTAKNDMHLEVGDKE 392
           + +K+ +D    +      +   + + ++  + S  VVLG    +   KN +  +  ++ 
Sbjct: 315 KKVKTTRDLQRLVGESPVGKAANLKIWRDKKEISKTVVLGRLEDTAEFKNKIPTKSKEQT 374

Query: 393 L--LGMVLQDINDGNKKL---------VRIVALNPNREREVEAKGIQKGMTIVSVNTHEV 441
           L  LG+ ++DI + +KK          V I  +NPN    +    ++ G  I+S+  + +
Sbjct: 375 LSSLGIDVRDIKEEDKKNRNKLEKKSGVIIQKINPNGAMALLP--VRPGDAIISLQNNSI 432

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             +KD E+ + K  +  + ++LL I    D+Q    N +R++ +KI
Sbjct: 433 KNVKDFEKQLKKQIKSGKKTLLLTI---IDLQ----NTTRYIGVKI 471


>gi|154252903|ref|YP_001413727.1| protease Do [Parvibaculum lavamentivorans DS-1]
 gi|154156853|gb|ABS64070.1| protease Do [Parvibaculum lavamentivorans DS-1]
          Length = 487

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 168/506 (33%), Positives = 263/506 (51%), Gaps = 49/506 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSS-VDLPPVIARVSPSIVSVMVEPKK 60
             R+ LS   I  V L+ V+ S   L   A+  P+S  DL     R+SP++V++      
Sbjct: 9   LTRRFLS--GIAGVFLSAVLISLPPLPAFAQGAPNSFADL---AERLSPAVVNI------ 57

Query: 61  KVSVEQMFNA--YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
             S  Q+ +       ++P + PL ++F     +F   +E +    V+ L  GSGF I  
Sbjct: 58  --STSQVLSPGDMAIPSIPPESPLNDFF----EEFLEQQESMRPQRVQSL--GSGFVIDP 109

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DG ++T+NH++E      V  +D T LPA + GTD   D+AVL+V+S +K   VE  D+N
Sbjct: 110 DGIVITNNHVIEGADRIEVTFTDGTTLPATVAGTDPKTDIAVLRVESSKKLPFVELGDSN 169

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNSGGPCFNA 237
             RVG+ V  IGNPF L G+V+AGIVSAL+RDI       F Q DA IN+GNSGGP F+ 
Sbjct: 170 KARVGDWVIAIGNPFGLGGSVTAGIVSALNRDIHAGNYDDFIQTDAAINRGNSGGPLFDM 229

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+GVN+ I++     +G+G  +P S +K  +  ++  G    GW G+  Q++T E+A
Sbjct: 230 EGRVVGVNSAIISPSGASVGIGFAVPTSTVKPVVAQILKFGETRRGWIGVRIQSVTPEIA 289

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
             LGL  ++G+LI  V    PA++AG++ GDV+   D +II + +D    +A       V
Sbjct: 290 ESLGLGPSRGALIAGVSPGGPAEEAGIETGDVVLAFDDKIITAMRDLPRVVAEAEIGSTV 349

Query: 358 KISLCKEGSKHSVAVVLG------SSPTAKNDMHLEVGDKE-LLGMVLQDINDGNKKL-- 408
            + L + G   +  +V+G      + P           DK  +LG+VL ++ND  ++   
Sbjct: 350 NVQLFRGGDTLTRKIVVGRLEDEEAQPVEVPGAAGSTPDKTVVLGLVLGELNDDLRERFG 409

Query: 409 -------VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
                  V I  ++P        KGI+ G  IV V    VS   +VE ++   ++  R++
Sbjct: 410 VPEGVPGVLITDVDP--LSAAAEKGIRPGEVIVEVAQRSVSSPAEVEEIVLSEEKAGRNT 467

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKI 487
           VLL++    ++        RFV+L++
Sbjct: 468 VLLRLSLGGEI--------RFVALRL 485


>gi|327194300|gb|EGE61161.1| serine protease Do protein [Rhizobium etli CNPAF512]
          Length = 501

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 141/410 (34%), Positives = 221/410 (53%), Gaps = 18/410 (4%)

Query: 78  EDHPLKNYFRKDFHKF---FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           +D P+   FR+ F         + P    +   +  GSGF I+ DG I+T+NH++++   
Sbjct: 79  QDSPMDEQFRQFFEDQGIPLPRQAPQQKPSQHAMALGSGFIISPDGVIVTNNHVIDNALD 138

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D TELPAKL+GTD   D+AVLK+ + +    + + D++ +++G+ +  IGNPF 
Sbjct: 139 IKVTLDDGTELPAKLIGTDPKSDVAVLKIAAGKPLQTIAWGDSDRLKLGDQILAIGNPFG 198

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G V+G+N  I +   
Sbjct: 199 IGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDREGKVVGINTAIYSPNG 258

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +GVG  IP    K+ +  L   G +DHG+ G+  Q +T+++A  +GL  T G+L+ AV
Sbjct: 259 GSVGVGFAIPSDEAKEIVAKLEKNGSIDHGYLGVQIQPVTKDVADAVGLDKTGGALVAAV 318

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             ++PA  AG+K GD++  + G  +K+ +D    +A  SP  +  + L ++G    + V 
Sbjct: 319 SADTPAAAAGLKPGDIVTSVGGEAVKTPKDLSRLVADLSPGTRESLGLWRDGKTIELNVT 378

Query: 374 LGSSPTAKNDMHLEVGDKE-------LLGMVLQDIN-------DGNKKLVRIVALNPNRE 419
           +G++   +     E  D++        LG+ L D+        D  + +   V  +   +
Sbjct: 379 VGANAGGQKQAAAENPDRQGQASGQPSLGIGLADLTPDVRQQLDLPRSVSGAVVASVKPD 438

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           +   A GIQ G  IVSVN   V   +DV+  I +A +  R SVLL I+ D
Sbjct: 439 KSAAAAGIQSGDVIVSVNDRPVHNARDVKAAIAEAGKAGRKSVLLLIERD 488


>gi|39937630|ref|NP_949906.1| serine protease [Rhodopseudomonas palustris CGA009]
 gi|39651489|emb|CAE30012.1| putative serine protease htrA/degQ/degS family [Rhodopseudomonas
           palustris CGA009]
          Length = 520

 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 162/499 (32%), Positives = 246/499 (49%), Gaps = 63/499 (12%)

Query: 21  IFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----------------------P 58
           + SS Y     K  P+      ++ +V P+++SV V+                      P
Sbjct: 54  LTSSAYAAENGK--PAPAGFGDLVDKVKPAVISVRVKIDDDRQTTPLVRDDGDGDQMQMP 111

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
           +     +Q    +GF   PE  P +       H+  +GE             GSGFFIT 
Sbjct: 112 RGLAPFQQFERQFGF-RGPEGMPKR-------HQMITGE-------------GSGFFITA 150

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DGY +T+NH+V+   S  V   D T   AK+VGTD   DLA++KV     F  V F D +
Sbjct: 151 DGYAVTNNHVVDHAKSVQVTTDDGTIYTAKVVGTDDKTDLALIKVDGKTDFPHVNFAD-S 209

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNA 237
             RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + QIDAPIN+GNSGGP F+ 
Sbjct: 210 PARVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYVQIDAPINKGNSGGPAFDT 269

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G+VIGVN  I +     +G+G  IP +  K  +  L  KG V  GW G+  Q +T E+A
Sbjct: 270 NGNVIGVNTAIYSPSGGSVGIGFDIPAATAKLVVSQLKDKGYVTRGWLGVQVQPVTAEIA 329

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
             LG++  +G+L+      SPA KAG+K GDVI  +DG+ +K  +     I++ +P   V
Sbjct: 330 DSLGMKQARGALVDGPQDGSPAAKAGIKAGDVITAVDGKEVKDSRALARTISTLAPGSSV 389

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE----LLGMVL---QDINDGNKKLVR 410
           K+ +   G   ++ + L   P     +    GD++     LG+ +    +++   K  V 
Sbjct: 390 KLDVLHNGQSKTMDLTLAEMPGDHQKVADSSGDRDATRPYLGLRVAPASEVDGAGKNGVV 449

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
           +  ++P  +     KG++ G  I+ V    V+   DV   + +A +  + +VL+++K   
Sbjct: 450 VTGVDP--DGPAADKGLRTGDVILDVGGKSVTNTGDVRNALTEASKDGKKTVLMRVKT-- 505

Query: 471 DMQSGNDNMSRFVSLKIDK 489
                 D+ +RFV++ I K
Sbjct: 506 -----ADSAARFVAVPIAK 519


>gi|192293411|ref|YP_001994016.1| protease Do [Rhodopseudomonas palustris TIE-1]
 gi|192287160|gb|ACF03541.1| protease Do [Rhodopseudomonas palustris TIE-1]
          Length = 520

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 154/443 (34%), Positives = 229/443 (51%), Gaps = 39/443 (8%)

Query: 55  MVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGF 114
           M  P+     +Q    +GF   PE  P +       H+  +GE             GSGF
Sbjct: 108 MQTPRGLAPFQQFERQFGF-RGPEGMPKR-------HQMITGE-------------GSGF 146

Query: 115 FITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEF 174
           FIT DGY +T+NH+V+   S  V   D T   AK+VGTD   DLA++KV     F  V F
Sbjct: 147 FITADGYAVTNNHVVDHAKSVQVTTDDGTIYTAKVVGTDDKTDLALIKVDGKTDFPHVNF 206

Query: 175 EDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGP 233
            DA   RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + QIDAPIN+GNSGGP
Sbjct: 207 ADAP-ARVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYVQIDAPINKGNSGGP 265

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
            F+  G+VIGVN  I +     +G+G  IP +  K  +  L  KG V  GW G+  Q +T
Sbjct: 266 AFDTNGNVIGVNTAIYSPSGGSVGIGFDIPAATAKLVVSQLKDKGYVTRGWLGVQVQPVT 325

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
            E+A  LG++  +G+L+ +    SPA KAG+K GDVI  +DG+ +K  +     I++ +P
Sbjct: 326 AEIADSLGMKQARGALVDSPQDGSPAAKAGIKAGDVITAVDGKEVKDSRALARTISTLAP 385

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE----LLGMVL---QDINDGNK 406
              VK+ +   G   ++ + L   P     +    GD++     LG+ +    +++   K
Sbjct: 386 GSSVKLDVLHNGQSKTMDLTLAEMPGDHQKVADSSGDRDATRPYLGLRVAPASEVDGAGK 445

Query: 407 KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
             V +  ++P  +     KG++ G  I+ V    V+   DV   + +A +  + +VL+++
Sbjct: 446 NGVVVTGVDP--DGPAADKGLRTGDVILDVGGKAVTNTGDVRNALTQAGKDGKKTVLMRV 503

Query: 467 KYDPDMQSGNDNMSRFVSLKIDK 489
           K         D+ +RFV++ I K
Sbjct: 504 KT-------ADSAARFVAVPIAK 519


>gi|316934892|ref|YP_004109874.1| protease Do [Rhodopseudomonas palustris DX-1]
 gi|315602606|gb|ADU45141.1| protease Do [Rhodopseudomonas palustris DX-1]
          Length = 522

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 152/464 (32%), Positives = 235/464 (50%), Gaps = 36/464 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ +V PS++SV V    K++     + + F   P   P++ +FR+     F GE P   
Sbjct: 77  IVEKVKPSVISVKVNIADKMAKGDDRDDFSF---PPGSPMERFFRR-----FGGEMPPGM 128

Query: 103 DTVERLMF----GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
                       GSGF I+ DGY +T+NH+VE      V   D     AK++G+D   DL
Sbjct: 129 RGHRGGGMMTGQGSGFLISADGYAVTNNHVVEGADRVEVTTDDGKTHKAKVIGSDPRTDL 188

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GT 217
           A++KV+    F   +  D    R+G+ V  +GNPF L GTV++GIVSA+ RDI + P   
Sbjct: 189 ALIKVEGASNFPYAKLSDGKP-RIGDWVLAVGNPFGLGGTVTSGIVSAIGRDIGNGPYDD 247

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F QIDAP+N+GNSGGP FN  G V+GVN  I +     +G+   IP S +K  +  L  K
Sbjct: 248 FIQIDAPVNKGNSGGPAFNTAGEVVGVNTAIYSPSGGSIGIAFSIPASTVKAVVEQLKDK 307

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           G V  GW G+  Q +T E+A  LGL+  +G+L+       PA KAG++ GDVI  +DG  
Sbjct: 308 GSVSRGWIGVQVQPVTPEIADSLGLKKAEGALVAEPQSNGPAAKAGIESGDVIIAVDGTS 367

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK------ 391
           +K  ++    I   +P   VK+++  +G +  + + LG  P        + GD+      
Sbjct: 368 VKDARELARTIGGFAPGHSVKLTVVHKGKERELTLTLGELPNKIEASATDRGDRGRSSQG 427

Query: 392 ---ELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
                LG+ L     +    K  V +  ++P  +     +G ++G  I+ V    VS   
Sbjct: 428 LDLPKLGLTLAPASSVAGAGKDGVVVTDVDP--KGAAADRGFKEGDVILEVAGKNVSSPA 485

Query: 446 DVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           DV  ++  AK + ++SVL++++        +   SRFV+L I K
Sbjct: 486 DVRDVLATAKTENKNSVLVRVR--------SGGASRFVALPIAK 521


>gi|190890813|ref|YP_001977355.1| serine protease Do protein [Rhizobium etli CIAT 652]
 gi|190696092|gb|ACE90177.1| serine protease Do protein [Rhizobium etli CIAT 652]
          Length = 501

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 140/410 (34%), Positives = 220/410 (53%), Gaps = 18/410 (4%)

Query: 78  EDHPLKNYFRKDFHKF---FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           +D P+   FR+ F         + P    +   +  GSGF I+ DG I+T+NH++++   
Sbjct: 79  QDSPMDEQFRQFFEDQGIPLPRQAPQQKPSQHAMALGSGFIISPDGVIVTNNHVIDNALD 138

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D TELPAKL+GTD   D+AVLK+ + +    + + D++ +++G+ +  IGNPF 
Sbjct: 139 IKVTLDDGTELPAKLIGTDPKSDVAVLKIAAGKPLQTIAWGDSDRLKLGDQILAIGNPFG 198

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G V+G+N  I +   
Sbjct: 199 IGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDREGKVVGINTAIYSPNG 258

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +GVG  IP    K  +  L   G +DHG+ G+  Q +T+++A  +GL  T G+L+ AV
Sbjct: 259 GSVGVGFAIPSDEAKAIVAKLEKNGSIDHGYLGVQIQPVTKDVADAVGLDKTGGALVAAV 318

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             ++PA  AG+K GD++  + G  +K+ +D    +A  SP  +  + + ++G    + V 
Sbjct: 319 SADTPAAAAGLKPGDIVTSVGGEAVKTPKDLSRLVADLSPGTRESLGVWRDGKTIELNVT 378

Query: 374 LGSSPTAKNDMHLEVGDKE-------LLGMVLQDIN-------DGNKKLVRIVALNPNRE 419
           +G++   +     E  D++        LG+ L D+        D  + +   V  +   +
Sbjct: 379 VGANAGGQKQAAAENPDRQGQASGQPSLGISLADLTPDVRQQLDLPRSVSGAVVASVKPD 438

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           +   A GIQ G  IVSVN   V   +DV+  I +A +  R SVLL I+ D
Sbjct: 439 KSAAAAGIQSGDVIVSVNDRPVHNARDVKAAIAEAGKAGRKSVLLLIERD 488


>gi|116251018|ref|YP_766856.1| serine protease [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255666|emb|CAK06747.1| putative serine protease [Rhizobium leguminosarum bv. viciae 3841]
          Length = 501

 Score =  237 bits (604), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 138/410 (33%), Positives = 223/410 (54%), Gaps = 18/410 (4%)

Query: 78  EDHPLKNYFRKDFHKF---FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           ++ P+   FR+ F         + P    + + +  GSGF I+ DG I+T+NH++++   
Sbjct: 79  QESPMDEQFRQFFEDQGIPLPRQAPKSRPSQQAMALGSGFIISPDGVIVTNNHVIDNAVD 138

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D TELPAKL+GTD   D+AVLK+++ +    + + D++ +++G+ +  IGNPF 
Sbjct: 139 IKVTLDDGTELPAKLIGTDPKSDVAVLKIEAGKPLQTIAWGDSDRLKLGDQILAIGNPFG 198

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G+V+G+N  I +   
Sbjct: 199 IGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDRSGNVVGINTAIYSPNG 258

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +GVG  IP    K  +  L   G +DHG+ G+  Q +T+++A  +GL  T G+L+ AV
Sbjct: 259 GSVGVGFAIPSDEAKAIVAKLQKDGSIDHGYLGVQIQPVTKDVADAVGLDKTGGALVAAV 318

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             ++PA  AG+K GD++  + G  +K+ +D    +A  SP  +  +S+ ++G    + V 
Sbjct: 319 TADTPAAHAGLKPGDIVTSVGGEAVKTPKDLSRLVADLSPGAKKSLSVWRDGKTIDLNVT 378

Query: 374 LGSSPTAKNDMHLEVGDKE-------LLGMVLQDINDGNKKLVRI-------VALNPNRE 419
           +G++  ++     E  D +        LG+ L D+    ++ + +       V      +
Sbjct: 379 VGTNEESQKQAAAENPDAQGQSTGQPSLGIGLADLTPDVRQELNLPRSISGAVVAKVAPD 438

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           +   A GIQ G  IVSVN   V   +DV+  I  A +  R SVLL ++ D
Sbjct: 439 KSAAAAGIQSGDVIVSVNDRPVHNARDVKTAIADAGKAGRKSVLLLVERD 488


>gi|241203611|ref|YP_002974707.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857501|gb|ACS55168.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 500

 Score =  236 bits (603), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 138/410 (33%), Positives = 222/410 (54%), Gaps = 18/410 (4%)

Query: 78  EDHPLKNYFRKDFHKF---FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           ++ P+   FR+ F         + P    + + +  GSGF I+ DG I+T+NH++++   
Sbjct: 78  QESPMDEQFRQFFEDQGIPLPRQAPQKRPSQQAMALGSGFIISRDGVIVTNNHVIDNAVD 137

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D TELPAKL+GTD   D+AVLK+++ +    + + D++ +++G+ +  IGNPF 
Sbjct: 138 IKVTLDDGTELPAKLIGTDPKSDVAVLKIEAGKPLQTIAWGDSDRLKLGDQILAIGNPFG 197

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G+V+G+N  I +   
Sbjct: 198 IGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDRSGNVVGINTAIYSPNG 257

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +GVG  IP    K  +  L   G +DHG+ G+  Q +T+++A  +GL  T G+L+ AV
Sbjct: 258 GSVGVGFAIPSDEAKAIVAKLQKDGSIDHGYLGVQIQPVTKDVADAVGLDKTGGALVAAV 317

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             ++PA  AG+K GD++  + G  +K+ +D    +A  SP  +  +S+ ++G    + V 
Sbjct: 318 TADTPAAHAGLKPGDIVTSVGGESVKTPKDLSRLVADLSPGAKKSLSVWRDGKTIDLNVT 377

Query: 374 LGSSPTAKNDMHLEVGDKE-------LLGMVLQDINDGNKKLVRI-------VALNPNRE 419
           +G++   +     E  D +        LG+ L D+    ++ + +       V      +
Sbjct: 378 VGTNEEGQKQAAAESPDAQDQSSGQPSLGIGLADLTPDVRQQLNLPRSINGAVVAKVAPD 437

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           +   A GIQ G  IVSVN   V   +DV+  I  A +  R SVLL ++ D
Sbjct: 438 KSAAAAGIQSGDVIVSVNDRPVHNARDVKTAIADAGKAGRKSVLLLVERD 487


>gi|312113146|ref|YP_004010742.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
 gi|311218275|gb|ADP69643.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
          Length = 530

 Score =  236 bits (603), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 158/474 (33%), Positives = 243/474 (51%), Gaps = 34/474 (7%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN---AYGFGNLPEDHPLKNY 85
           +  KLP       P++ +V P++VS+ V  K   + +  F        GN  E  PL+ Y
Sbjct: 70  MRQKLP----SFAPLVKQVKPAVVSIRV--KSDAAAKAAFGDDEGGPRGNPFEGSPLERY 123

Query: 86  FRKDFHKFFSG----EEPILSDTVERLMF--GSGFFITDDGYILTSNHIVEDGASFSVIL 139
           F                P       +L+   GSGFFI+ DGY++T+NH+ +D  S  V++
Sbjct: 124 FGGPGGPRGGFGPWGRAPGGKGGPRQLVTAQGSGFFISPDGYLVTNNHVAQDAVSLEVVM 183

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
            D     AK++GTD   DLA+LKV     F   +F   +   +G+ V  +GNPF L GTV
Sbjct: 184 DDGKIYTAKVIGTDPRTDLALLKVDGRTDFPYTKFSH-SGAEIGDWVVAMGNPFGLGGTV 242

Query: 200 SAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGIVSA  RDI + P   F QIDA +N+GNSGGP FN  G VIGVN  I +     +G+
Sbjct: 243 TAGIVSARGRDIGEGPYDDFIQIDASVNKGNSGGPTFNESGEVIGVNTAIYSPSGGSVGI 302

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP   +++ + +L  KG V  GW G+  Q LT ELA  LGL+ T G+L+ A    SP
Sbjct: 303 AFAIPAPTVERVVAALKDKGHVTRGWLGVQIQGLTPELADSLGLKTTAGALVAAPQSGSP 362

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A+KAG+K GDVI  +DG  +K  +D   +IA  +P    K+++ ++G   +V + +G  P
Sbjct: 363 AEKAGIKTGDVITEVDGTEVKDGRDLAKKIADLAPGANAKLTVLRDGETKTVDLKIGQLP 422

Query: 379 -------TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGM 431
                  +  +D    + D  +      D++  +++ + +V + P   +  EA G+ +G 
Sbjct: 423 EKPTQRASLSDDGRTGLNDLGIAVAPAADVSPNDRQGLAVVGVEPG-GKAAEA-GLAEGD 480

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
            I+ V    V+   D++R +  A +  + + L  +K + D         RFV+L
Sbjct: 481 IILRVGDQTVNRPGDLKRALSDASKSGKKNALALVKRNGDQ--------RFVAL 526


>gi|317051937|ref|YP_004113053.1| protease Do [Desulfurispirillum indicum S5]
 gi|316947021|gb|ADU66497.1| protease Do [Desulfurispirillum indicum S5]
          Length = 463

 Score =  236 bits (603), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 153/475 (32%), Positives = 243/475 (51%), Gaps = 66/475 (13%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           DL  ++ +V PS+V+V    + +V   ++        LPE+     +F  +F +FF   +
Sbjct: 31  DLTQLVKKVEPSVVNVSTSKQVEVGQREL-------PLPEEF-FNRFFGDEFRRFFG--D 80

Query: 99  PILSDTVERLM--FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
           P   +  +R     GSGF ++ DGYI+T+NH+VE     ++ILSD+ E  A++VGTDA +
Sbjct: 81  PGHPNGQQRRSSSLGSGFIVSSDGYIVTNNHVVEGADEITIILSDEREFKAEVVGTDATY 140

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP- 215
           DLA+LK+ +      +   +++ I VG+ VF +GNPF L GTV+ G++SA DR I     
Sbjct: 141 DLALLKINAS-NLPALPLGNSDTIEVGQWVFAVGNPFGLSGTVTVGVISAKDRYIGQSVF 199

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
            +F Q DA IN GNSGGP  N  G VIG+N  IV+SGQ   G+G  IP++ +K +   L 
Sbjct: 200 DSFLQTDASINPGNSGGPLLNLKGEVIGINTAIVSSGQ---GLGFAIPINTLKSSYEQLK 256

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRG-TKGSLITAVVKESPADKAGMKVGDVICMLD 334
            KGRV  GW G+  Q LT ELA  +G    T G L+T+V  + PA + G++ GD+I   D
Sbjct: 257 EKGRVSRGWLGVSLQRLTPELARSMGAGAETTGVLVTSVEPDQPAQRGGLREGDIITSFD 316

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK------------- 381
            + I  +QD    +A  +P   V + + +EG + ++ V LG  P  +             
Sbjct: 317 NQRIDRYQDIFRFVARATPGSTVPMEILREGRRQTLRVTLGERPDERRAQVRPRQAEPAP 376

Query: 382 -------NDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIV 434
                    +H E+ D  +   V+Q +  G+K                   G+++ M I+
Sbjct: 377 SAASWQFQGIHFEMRDNRV---VVQQVEAGSKAY---------------EAGVRRDMVIL 418

Query: 435 SVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             N   VS +  +E+ I   KE+ R+  +       ++   +   +RF+  +I +
Sbjct: 419 RANNVVVSDLATLEKAI---KERSRNGFV-------NLLVQHQGANRFIPFQIQQ 463


>gi|197103233|ref|YP_002128611.1| serine protease HtrA [Phenylobacterium zucineum HLK1]
 gi|196480509|gb|ACG80036.1| serine protease HtrA [Phenylobacterium zucineum HLK1]
          Length = 482

 Score =  236 bits (602), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 200/365 (54%), Gaps = 12/365 (3%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGFFIT  GYI+T+NH+VE+    SV  ++  EL A+++G D L DLAVLKV+    F 
Sbjct: 106 GSGFFITPTGYIVTNNHVVENATKVSVRTNEGRELEARVIGRDPLTDLAVLKVEGS-NFP 164

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNS 230
            V FE     RVG+ V  +GNPF L GT ++GIVSA  RDI +    + QIDAPIN+GNS
Sbjct: 165 YVTFETNARPRVGDWVIAMGNPFGLGGTATSGIVSAYGRDIGEAYVDYLQIDAPINRGNS 224

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP F+  G VIGVN  I +     +G+G  IP  I  +    LIS G +  G+ G M Q
Sbjct: 225 GGPTFDVYGRVIGVNTAIFSPSGGSVGIGFAIPAEIADRITKQLISGGSIVRGYIGAMVQ 284

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
           NLT E+A  LG+ G KG+L+  V    P D AG++ GD I  L+G+ + S  D   ++ +
Sbjct: 285 NLTPEIAESLGIPGRKGALVAEVTPGGPGDLAGLRAGDAILSLNGQELTSSSDLTRRVGA 344

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVR 410
               +++++ + +EG + ++ +  G  P       +   D   LG+ L+ ++   +   R
Sbjct: 345 AREGDRLRLEIWREGRRQTLELRAGRRPADDAPGVVNPADAASLGLTLRPLDQAARTQYR 404

Query: 411 ---------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
                    I A++P    +   KG++ G  I  V    V+   DV   I  A+ + R S
Sbjct: 405 LPATARGVVIDAVSPG--SDAAEKGLRAGDVIDRVGERSVAAPADVREAIDAARRQGRPS 462

Query: 462 VLLQI 466
           VL+++
Sbjct: 463 VLVRV 467


>gi|86356762|ref|YP_468654.1| serine protease DO-like protein [Rhizobium etli CFN 42]
 gi|86280864|gb|ABC89927.1| serine protease DO-like protein [Rhizobium etli CFN 42]
          Length = 500

 Score =  236 bits (601), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 219/411 (53%), Gaps = 20/411 (4%)

Query: 78  EDHPLKNYFRKDFHKF---FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           +  P+   FR+ F           P    +   +  GSGF I+ DG I+T+NH++++   
Sbjct: 78  QQSPMDEQFRQFFEDQGIPLPRPAPQQRGSQHAMALGSGFIISPDGVIVTNNHVIDNALD 137

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D TELPAKL+GTD   D+AVLK+Q+ +    + + D++ +++G+ +  IGNPF 
Sbjct: 138 IKVTLDDGTELPAKLIGTDPKSDVAVLKIQAGKPLQTIAWGDSDKLKLGDQILAIGNPFG 197

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G V+G+N  I +   
Sbjct: 198 IGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDREGKVVGINTAIYSPNG 257

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +GVG  IP    K  +  L   G ++HG+ G+  Q +T+++A  +GL  T G+L+ AV
Sbjct: 258 GSVGVGFAIPSDEAKAIVAKLEKDGSINHGYLGVQIQPVTKDVADAVGLDKTGGALVAAV 317

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             ++PA  AG+K GD++  + G  +K+ +D    +A  SP  Q  + + ++G    + V 
Sbjct: 318 SADTPAAHAGLKPGDIVTSVGGETVKTPKDLSRLVADLSPGTQKSLGVWRDGKTIDLNVT 377

Query: 374 LG-----------SSPT----AKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNR 418
           +G           +SP     A     L +G  EL   V Q IN   + +   V  + N 
Sbjct: 378 VGANADGQKQAAATSPEAPGRASGQPSLGIGLAELTPDVRQQINL-PRSVSGAVVASVNP 436

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           ++   A GIQ G  IVSVN   V   +DV+  I +A +  R SVLL ++ D
Sbjct: 437 DKSAAAAGIQSGDVIVSVNDRPVHNARDVKAAIAEAGKAGRKSVLLLVERD 487


>gi|197106150|ref|YP_002131527.1| serine protease HtrA [Phenylobacterium zucineum HLK1]
 gi|196479570|gb|ACG79098.1| serine protease HtrA [Phenylobacterium zucineum HLK1]
          Length = 519

 Score =  236 bits (601), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 150/476 (31%), Positives = 246/476 (51%), Gaps = 42/476 (8%)

Query: 20  VIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLP-- 77
           +I +ST  +  A  P + +    +  RVSP++VS+ V  +   S  +    + F  +P  
Sbjct: 42  LIKASTTPIF-APPPGAPMSFADIFDRVSPAVVSINVTSRVNPSDLRQIPGFPFNLIPRQ 100

Query: 78  ----EDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
               ED       R          +P L     +   GSGFFI+ DGYI+T+NH+VE+  
Sbjct: 101 PDGGEDEEGGQTERG---------QPRLP---TQQSAGSGFFISADGYIVTNNHVVENAE 148

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNP 192
             +V+L D+TEL A +VG D   D+AV+KV++ +   P V FE++   RVG+ V T+GNP
Sbjct: 149 KITVVLKDETELEATVVGRDEATDIAVIKVKNGKGPFPFVNFENSARPRVGDWVITVGNP 208

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
           F L GT +AGI+SA  RDI +    + QIDAPIN+GNSGGP F+  G VIGVN  I +  
Sbjct: 209 FGLGGTATAGIISAYGRDIGETFVDYIQIDAPINRGNSGGPTFDVYGRVIGVNTAIFSPS 268

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              +G+G  IP  +       LI  G+++ G+ G   QN T E+A   GL   KG+++  
Sbjct: 269 GGSVGIGFAIPADLADSVTKQLIRGGKIERGYIGATIQNFTTEMAEAAGLGEQKGAIVAD 328

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           +    P+ +AG++VGDV+  ++G  ++S  +   Q+A   P + +++ + +EG + +V V
Sbjct: 329 LTPGGPSQRAGLQVGDVVTAINGTAVRSSSELTRQVARAKPGDSLRLDVIREGRRRTVEV 388

Query: 373 VLGSSPT-----AKND----------MHLEVGDKELLGMVLQDINDGNKKLVRI------ 411
             G+ P+     A ND                    LG+ L  + D  +  + +      
Sbjct: 389 RAGTRPSERELAAANDNLGGQGAPGGEGQPQASPSALGLTLGVVTDAMRSRLNLPADVRG 448

Query: 412 -VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
            V  + ++  +  +KG+++G  I   N   ++   ++  ++ +AK+  R SVL+ +
Sbjct: 449 AVVESVDQNSDAASKGLRRGDVITRANNRAINSPAELVAVVEEAKKAGRTSVLVGV 504


>gi|209548367|ref|YP_002280284.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534123|gb|ACI54058.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 501

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 137/410 (33%), Positives = 222/410 (54%), Gaps = 18/410 (4%)

Query: 78  EDHPLKNYFRKDFHKF---FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           +  P+   FR+ F         + P    + + +  GSGF I+ DG I+T+NH++++   
Sbjct: 79  QQSPMDEQFRQFFEDQGIPLPRQAPKNRSSQQTMALGSGFIISPDGVIVTNNHVIDNAVD 138

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D TELPAKL+GTD   D+AV+K+++ +    + + D++ +++G+ +  IGNPF 
Sbjct: 139 IKVTLDDGTELPAKLIGTDPKSDVAVVKIEAGKPLQTIAWGDSDRLKLGDQILAIGNPFG 198

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G+V+G+N  I +   
Sbjct: 199 IGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDRSGNVVGINTAIYSPNG 258

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +GVG  IP    K  +  L   G +DHG+ G+  Q +T+++A  +GL  T G+L+ AV
Sbjct: 259 GSVGVGFAIPSDEAKAIVAKLQKDGSIDHGYLGVQIQPVTKDVADAVGLDKTGGALVAAV 318

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             ++PA  AG+K GD+I  + G  +K+ +D    +A  SP  +  + + ++G    + V 
Sbjct: 319 TADTPAAHAGVKPGDIITSVGGESVKTPKDLSRLVADLSPGAKKSLGIWRDGKTIDLNVT 378

Query: 374 LGSSPTAKNDMHLEVGDKE-------LLGMVLQDINDGNKKLVRI-------VALNPNRE 419
           +G +   +     E  D +        LG+ L D+    ++ + +       V  + + +
Sbjct: 379 VGGNEDGQKQAAAESSDSKGESSGQPSLGIGLADLTPDVREQLTLPRAVSGAVVASVDPD 438

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           +   A GIQ G  IVSVN   V   +DV+  I +A +  R SVLL ++ D
Sbjct: 439 KSAAAAGIQSGDVIVSVNDRPVHSTRDVKTAIAEAGKAGRKSVLLLVERD 488


>gi|39934998|ref|NP_947274.1| htrA-like serine protease [Rhodopseudomonas palustris CGA009]
 gi|39648849|emb|CAE27370.1| htrA-like serine protease [Rhodopseudomonas palustris CGA009]
          Length = 523

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 154/465 (33%), Positives = 239/465 (51%), Gaps = 37/465 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE-EPIL 101
           ++ +V PS++SV V    K++  +    + F   P   P++ +FR+     F GE  P L
Sbjct: 77  IVDKVKPSVISVKVNIADKMAKNEDREDFSF---PPGSPMERFFRR-----FGGEMPPGL 128

Query: 102 SDTVERLMF---GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
                  M    GSGFFI+ DGY +T+NH+VE      V   D     AK++G D   DL
Sbjct: 129 RGHRGGGMITGQGSGFFISADGYAVTNNHVVEGADKVEVTTDDGKTYKAKVIGNDPRTDL 188

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GT 217
           A++KV+    F P         R+G+ V  +GNPF L GTV+AGIVSA+ RDI + P   
Sbjct: 189 ALIKVEGGSSF-PYAKLSEGKPRIGDWVLAVGNPFGLGGTVTAGIVSAMGRDIGNGPYDD 247

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F QIDAP+N+GNSGGP FN  G V+GVN  I +     +G+   IP + +K  +  L  +
Sbjct: 248 FIQIDAPVNKGNSGGPAFNTAGEVVGVNTAIYSPSGGSIGIAFSIPANTVKAVVEQLKDR 307

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           G V  GW G+  Q +T E+A  LGL+  +G+L+       PA KAG++ GDVI  +DG  
Sbjct: 308 GSVSRGWIGVQVQPVTPEIADSLGLKKAEGALVAEPQSNGPAAKAGIESGDVIVAVDGTS 367

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-KNDMHLEVGDK----- 391
           +K  ++    I + +P   VK+++  +G +  + + LG  P   +   + + GD+     
Sbjct: 368 VKDARELARTIGAFAPGHAVKLTVFHKGKERELTLTLGELPNKIEASNNTDRGDRGGANQ 427

Query: 392 ----ELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
                 LG+ L     +    K  V +  ++P  +     +G ++G  I+ V    VS  
Sbjct: 428 GLDLPKLGLTLAPASSVAGAGKDGVVVTDVDP--KGAAADRGFKEGDVILEVAGKNVSSP 485

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            DV  ++  AK + ++SVL++++        +   SRFV+L I K
Sbjct: 486 ADVRDVLATAKTENKNSVLVRVR--------SGGASRFVALPIAK 522


>gi|158422760|ref|YP_001524052.1| peptidase S1C protein [Azorhizobium caulinodans ORS 571]
 gi|158329649|dbj|BAF87134.1| peptidase S1C protein [Azorhizobium caulinodans ORS 571]
          Length = 525

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 166/509 (32%), Positives = 261/509 (51%), Gaps = 50/509 (9%)

Query: 11  SICTVALTCVIFSSTYLVLEAK----LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           ++  VA+    + ST  + +A     +   S     V+ +V+P++VSV +  KK VS +Q
Sbjct: 34  AVAGVAVGQFGYGSTPALAQATTAAPVTAQSFSFADVVQKVTPAVVSVKI--KKDVSAQQ 91

Query: 67  MF----NAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--------PILSDTVERLMFG--S 112
           M     + +G  ++P   P    F K F  F +G+         P      ER + G  S
Sbjct: 92  MAMGGDDEFGGADVP---PQIERFLKRFG-FENGQGGPGGMQRMPRGGGAGERRVVGQGS 147

Query: 113 GFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
           GF I+ DGY++T+NH+V+  +   V ++D  E  AK++GTD   D+A++K+        V
Sbjct: 148 GFIISPDGYVVTNNHVVDGASEVDVTMTDGKEYTAKVIGTDPRTDVALIKIDGKNDLPFV 207

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSG 231
           +  D    RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSG
Sbjct: 208 KLADGAP-RVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDFVQIDAPINRGNSG 266

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP F+  G+VIG+N  IV+    ++G+   IP   +K  +  L   G+V  G+ G+  Q 
Sbjct: 267 GPTFDLNGNVIGMNTAIVSPSGGNVGIAFAIPSETVKTVVDQLRQDGKVARGYIGVQIQP 326

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +T +LA  LGL   +G+L+  V  ++PA KAG+K GDV+  ++G  +K  +D   +I   
Sbjct: 327 VTDDLASGLGLNAAEGALVAQVQPDTPAAKAGLKSGDVVTKVNGDAVKDARDLSRKIGMM 386

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE--------LLGMVL---QD 400
            P   V +++ ++G   +  V L   PT   D  +   D           LG+ L   + 
Sbjct: 387 KPGASVALTVVRDGKTQAFNVKLEQLPT---DQQMASADGNGPATHDVPRLGLQLAPAKS 443

Query: 401 INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
           +     + V +  ++PN      A+GI+ G  I+ V    VS   DV   +  AK + R 
Sbjct: 444 VQGAGAQGVVVTEVDPN--GPAAARGIRSGDVILDVGGKTVSNPSDVREGLAAAKAENRK 501

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +VL+++K +  +        RFV++ +DK
Sbjct: 502 AVLMRVKGEQGV--------RFVAITLDK 522


>gi|299133553|ref|ZP_07026747.1| protease Do [Afipia sp. 1NLS2]
 gi|298591389|gb|EFI51590.1| protease Do [Afipia sp. 1NLS2]
          Length = 525

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 151/465 (32%), Positives = 241/465 (51%), Gaps = 33/465 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV V  ++K + +   +       P   P++ +FR+          P   
Sbjct: 75  IVERVKPSVISVRVRIEEKQTADNNDDLP----FPPGSPMERFFRRFGGPDGFPGGPGGR 130

Query: 103 DTVERLMFG--SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                L+ G  SGFFI+ DGY +T+NH+V+      V   D     AK++GTD   DLA+
Sbjct: 131 RGRGNLVTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDKRTDLAL 190

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFT 219
           +KV+    F   +  D    R+G+ V  +GNPF L GTV+AGIVSA  RDI + P   F 
Sbjct: 191 IKVEGGSNFPFAKLSDGE-PRIGDWVLAVGNPFGLGGTVTAGIVSARGRDIGNGPYDDFI 249

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           QIDAP+N+GNSGGP FN  G VIGVN  I +     +G+   IP + +K  +  L  KG 
Sbjct: 250 QIDAPVNKGNSGGPAFNTEGEVIGVNTAIYSPSGGSVGIAFSIPSATVKNVVAQLKDKGS 309

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  GW G+  Q +T E+A  LGL+  +G+L+       PA KAG++ GDVI  ++ + +K
Sbjct: 310 VSRGWIGVQIQPVTPEIADSLGLKKAEGALVAEPQTNGPAAKAGIESGDVINKVNDQPVK 369

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK------NDMHLEVG---- 389
             ++    I   +P   +K+ +  +GS+ ++ + LG  P AK      ND    +G    
Sbjct: 370 DARELARTIGGMAPGASIKLGVLHKGSEKTLTLTLGELPNAKSIKTGFNDNDNGLGRNGN 429

Query: 390 --DKELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
             D   LG+ +   + +    K+ V +  +NP+       +G+++G  I+ V    V+  
Sbjct: 430 GSDVPNLGLTVAPARSVAGAGKEGVVVTNVNPDGAS--AERGLKEGDVILEVAGKSVATA 487

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            D+   +  A+  K++SVL++++        + + SRFV+L + K
Sbjct: 488 DDIRNELNTARADKKNSVLIRVR--------SGDSSRFVALPVGK 524


>gi|192290531|ref|YP_001991136.1| protease Do [Rhodopseudomonas palustris TIE-1]
 gi|192284280|gb|ACF00661.1| protease Do [Rhodopseudomonas palustris TIE-1]
          Length = 523

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 154/465 (33%), Positives = 239/465 (51%), Gaps = 37/465 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE-EPIL 101
           ++ +V PS++SV V    K++  +    + F   P   P++ +FR+     F GE  P L
Sbjct: 77  IVDKVKPSVISVKVNIADKMAKNEDREDFSF---PPGSPMERFFRR-----FGGEMPPGL 128

Query: 102 SDTVERLMF---GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
                  M    GSGFFI+ DGY +T+NH+VE      V   D     AK++G D   DL
Sbjct: 129 RGHRGGGMITGQGSGFFISADGYAVTNNHVVEGADKVEVTTDDGKTYKAKVIGNDPRTDL 188

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GT 217
           A++KV+    F P         R+G+ V  +GNPF L GTV+AGIVSA+ RDI + P   
Sbjct: 189 ALIKVEGGSNF-PYAKLSEGKPRIGDWVLAVGNPFGLGGTVTAGIVSAMGRDIGNGPYDD 247

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F QIDAP+N+GNSGGP FN  G V+GVN  I +     +G+   IP + +K  +  L  +
Sbjct: 248 FIQIDAPVNKGNSGGPAFNTAGEVVGVNTAIYSPSGGSIGIAFSIPANTVKAVVEQLKDR 307

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           G V  GW G+  Q +T E+A  LGL+  +G+L+       PA KAG++ GDVI  +DG  
Sbjct: 308 GSVSRGWIGVQVQPVTPEIADSLGLKKAEGALVAEPQSNGPAAKAGIESGDVIVAVDGTS 367

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-KNDMHLEVGDK----- 391
           +K  ++    I + +P   VK+++  +G +  + + LG  P   +   + + GD+     
Sbjct: 368 VKDARELARTIGAFAPGHAVKLTVFHKGKERELTLTLGELPNKIEASNNTDRGDRGGANQ 427

Query: 392 ----ELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
                 LG+ L     +    K  V +  ++P  +     +G ++G  I+ V    VS  
Sbjct: 428 GLDLPKLGLTLAPASSVAGAGKDGVVVTDVDP--KGAAADRGFKEGDVILEVAGKNVSSP 485

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            DV  ++  AK + ++SVL++++        +   SRFV+L I K
Sbjct: 486 ADVRDVLATAKTENKNSVLVRVR--------SGGASRFVALPIAK 522


>gi|13474189|ref|NP_105757.1| serine protease [Mesorhizobium loti MAFF303099]
 gi|14024941|dbj|BAB51543.1| serine protease, HtrA/DegQ/DegS family [Mesorhizobium loti
           MAFF303099]
          Length = 513

 Score =  235 bits (599), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 159/476 (33%), Positives = 246/476 (51%), Gaps = 45/476 (9%)

Query: 25  TYLVLEAKLPPSSVDLP-----PVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
           + +V   + P + +  P     P++A   P++V+V    K + + +   +    GN P D
Sbjct: 39  SKIVATTQTPVAGITAPNGSFAPIVAADKPAVVTVTSIMKGQPASDD--DGMPLGNSPFD 96

Query: 80  HPLKNYFRKDFHKFFSGE-------EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
                YFR+    FF  +        P  +   E L  GSGF +T DG ++T+NH+V+  
Sbjct: 97  Q----YFRQ----FFGDQGMPAPQTPPQQAQRAEAL--GSGFIVTADGTVVTNNHVVDGA 146

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
           +S  V L D TELPAKLVG DA  DLAVLK++SD+    V++ D++ +  G+ V  IGNP
Sbjct: 147 SSIKVTLDDGTELPAKLVGRDAKNDLAVLKIKSDKPLPTVKWGDSDRLMTGDQVLAIGNP 206

Query: 193 FRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G+V+G+N  I + 
Sbjct: 207 FGIGTTVTAGIVSARGRDLHSGPFDDFIQIDAPINHGNSGGPLVDVNGNVVGINTAIYSP 266

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +GVG  IP    +K +  L+  G + +G+ G+  Q +T ++A  +GL    G+L++
Sbjct: 267 NGGSVGVGFAIPSDQAQKVVAKLMKDGSIQYGYLGVEIQEVTPDVASAIGLDHAGGALVS 326

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V   SPA  AG++ GDVI    G+ +K  +D    +A  +P  +  + + ++G    ++
Sbjct: 327 KVNDSSPAASAGVEAGDVITGFAGQDVKDPKDLSRAVADVAPGAKETLDVWRKGKAMQIS 386

Query: 372 VVLG--------SSPTAKNDMHLEVGDKE-LLGMVLQDIND---------GNKKLVRIVA 413
           V +G        +S         E G +   +G+ L DI           GN+    +  
Sbjct: 387 VEVGQNSDDVKTASAGESGAPSAEQGSRAPAIGLGLMDITPDIRQEMNLAGNEHGAVVAR 446

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           +NP  ++   A GIQ G  IV+VN   V   + V + I +A +  R SVLL ++ D
Sbjct: 447 VNP--DKAAAAAGIQPGDIIVAVNQAPVKSARQVTQAIAQASKSGRKSVLLLVERD 500


>gi|149912789|ref|ZP_01901323.1| possible serine protease [Roseobacter sp. AzwK-3b]
 gi|149813195|gb|EDM73021.1| possible serine protease [Roseobacter sp. AzwK-3b]
          Length = 490

 Score =  234 bits (596), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 156/501 (31%), Positives = 259/501 (51%), Gaps = 46/501 (9%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM 67
           +++++   ALT  +  +  LV  A+ P S  DL     RVSP++V++             
Sbjct: 15  ALRALWLTALTMALIVAQALVALAR-PESFADLAD---RVSPAVVNITT---------ST 61

Query: 68  FNAYGFGN---LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
             A G G    +PE  P +++FR+   +   G+ P  S        GSGF I++DG+++T
Sbjct: 62  VVAEGAGPSPIVPEGSPFEDFFREFRDRNGDGDRPRRSSA-----LGSGFVISEDGFVVT 116

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH++E      +      EL A+++GTD   D+A+LKV++D+    V F D++  RVG+
Sbjct: 117 NNHVIEAADEIIIEFFSGEELVAEVIGTDPKTDIALLKVKADQPLAFVTFGDSDTARVGD 176

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGV 244
            V  +GNP     + SAGIVSA +R +      + Q DA IN+GNSGGP FN    VIGV
Sbjct: 177 WVMAMGNPLGQGFSASAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDAQVIGV 236

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I++     +G+G  +  +++ + I  L   G    GW G+  Q++T+++A  +GL  
Sbjct: 237 NTAILSPTGGSIGIGFSMASNVVTRVIDQLKEYGETRRGWLGVRIQDVTEDVAEAMGLEE 296

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
            +G+L+T  V E PA +AGM+ GDVI   DG  +   +  V Q+ +    + V++++ +E
Sbjct: 297 VRGALVTD-VPEGPASEAGMQAGDVILSFDGTQVNDTRGLVRQVGNTEVGKAVRVTVFRE 355

Query: 365 GSKHSVAVVL-------GSSPTAK--NDMHLEVGDKELLGMVLQDINDG-------NKKL 408
           G   ++ V L       G+ PTA+   D   E  ++E++G+ +  ++D           +
Sbjct: 356 GKTQTLKVTLGRREVAEGAVPTAQPGPDTPAEPSEQEMMGLTISPLDDELRGQLDLGSDV 415

Query: 409 VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
             +V  + +   E   KG++ G  I       V+ I D+E  I +A++  R S+LL I+ 
Sbjct: 416 TGLVVTDVDDLSEAYEKGVRAGDLITEAGQQNVASISDLEDRISEARDAGRKSILLLIR- 474

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
               +SG     RFV+L ID 
Sbjct: 475 ----RSGE---PRFVALPIDS 488


>gi|148254516|ref|YP_001239101.1| putative serine protease do-like [Bradyrhizobium sp. BTAi1]
 gi|146406689|gb|ABQ35195.1| Putative serine protease do-like precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 527

 Score =  234 bits (596), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 150/468 (32%), Positives = 237/468 (50%), Gaps = 40/468 (8%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI-- 100
           ++ RV PS++SV V   +KV+     +   F       P++ +FR+     F GE  I  
Sbjct: 78  IVERVKPSVISVKVNIAEKVAKNDSDDDTPF---QPGSPMERFFRR-----FGGENGIPG 129

Query: 101 ------LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
                           GSGFFI+ DGY +T+NH+V+      V   D     AK++GTD 
Sbjct: 130 MPGRGGRGGGRAVTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYSAKVIGTDQ 189

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             DLA++KV+    F   +  D    R+G+ V  +GNPF L GTV+AGIVSA+ RDI + 
Sbjct: 190 RTDLALIKVEGGSNFPFAKLADGKP-RIGDWVLAVGNPFGLGGTVTAGIVSAVGRDIGNG 248

Query: 215 P-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
           P   F QIDAP+N+GNSGGP F+  G+V+GVN  I +     +G+   IP S +K  I  
Sbjct: 249 PYDDFIQIDAPVNKGNSGGPAFDVDGNVVGVNTAIYSPSGGSVGIAFSIPASTVKSVIAQ 308

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           L   G V  GW G+  Q +TQ++A  LG++  +G+L+     + PA KAG++ GDVI  +
Sbjct: 309 LKDNGSVSRGWIGVQIQPVTQDIADSLGMKKAEGALVAEPQADGPAAKAGIRSGDVITSV 368

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT---------AKNDM 384
           +G  +K  ++    I   +P   VK+++ ++G + ++++ LG  P            N  
Sbjct: 369 NGEPVKDARELARTIGGLAPGASVKLNVLQKGQEKTISLTLGKLPNTIEAKADTGGDNSS 428

Query: 385 HLEVGDKELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEV 441
                D   LGM +     +    K+ V +  ++P  +     +G ++G  I+ V    V
Sbjct: 429 PTRGADVPKLGMTVAPASSVAGAGKEGVVVTEVDP--KSAAADRGFKEGDVILEVAGKSV 486

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +   DV   I  A+   ++SVL+++K        +   SRFV++ + K
Sbjct: 487 TSAGDVREAINAARNDNKNSVLMRVK--------SGGQSRFVAVPLAK 526


>gi|300022657|ref|YP_003755268.1| protease Do [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524478|gb|ADJ22947.1| protease Do [Hyphomicrobium denitrificans ATCC 51888]
          Length = 530

 Score =  233 bits (595), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 172/495 (34%), Positives = 249/495 (50%), Gaps = 66/495 (13%)

Query: 32  KLPPSSVDLPPVIARVSPSIVSVMV----------EPKKKVSVEQMFNAYGFGN-----L 76
           + P S  DL   I RV P++VSV V          E KK       F+  G GN     L
Sbjct: 58  RAPLSFADL---IERVKPAVVSVSVVNDGGASKLAENKK----NDKFDKRGGGNFNMPDL 110

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMF----GSGFFITDDGYILTSNHIVEDG 132
           P DHPL ++F K+  K F  +E       ER       GSGF I+ DGY++T+NH++ DG
Sbjct: 111 PPDHPLHDFF-KNLPKDFGQQE-------ERPKIVQGQGSGFVISPDGYVVTNNHVI-DG 161

Query: 133 ASFSVIL--SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
           A+  VI   +DDT+  AKLVG D   D+A+LK+ S + F  V+F      RVG+    +G
Sbjct: 162 ATKIVITFDNDDTKYEAKLVGADQRTDVALLKIDSTKTFPAVKFS-TKAPRVGDWALAVG 220

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           NPF L GTV+AGIVSAL RDI   P  + QIDA +N+GNSGGP FN  G VIGVN  I +
Sbjct: 221 NPFGLGGTVTAGIVSALARDIGSGPYDYMQIDAAVNRGNSGGPTFNLDGDVIGVNTAIFS 280

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
               ++G+   IP   + + +  L + G V  GW G+  QN+ ++ A  LGL    G+L+
Sbjct: 281 PSGGNVGIAFDIPAKTVSEVVTQLKATGTVKRGWLGVKIQNVDEDTASSLGLNEAHGALV 340

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           + V    PA  AG+K  D I  ++   +   +D   +IA  SP   V I + +  ++  +
Sbjct: 341 SEVTANGPAAAAGIKTQDAILQVNDSKVADSRDLARKIAELSPDSPVNIKVWRNNAEKVI 400

Query: 371 AVVLGSSP-----------------TAKNDMHLEVGDKELLGMVLQDINDG-NKKLVRIV 412
            V LG  P                 + K D      +   LG+ L     G N++ V I 
Sbjct: 401 NVKLGLFPKNAEALLSGDNDQNDNNSNKEDSKPAQTELSQLGVTLMPARSGSNQEGVVIA 460

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
            ++P+   +   KG++ G  I+ V+   V    DV   + KA+  +R +VLL IK     
Sbjct: 461 EVDPS--SDAAEKGLKAGDVILEVSGETVKTPDDVSAGVKKAQGLQRKAVLLHIK----- 513

Query: 473 QSGNDNMSRFVSLKI 487
              + +  RFV++++
Sbjct: 514 ---SSDQKRFVAVQL 525


>gi|316936054|ref|YP_004111036.1| protease Do [Rhodopseudomonas palustris DX-1]
 gi|315603768|gb|ADU46303.1| protease Do [Rhodopseudomonas palustris DX-1]
          Length = 518

 Score =  233 bits (595), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 158/467 (33%), Positives = 238/467 (50%), Gaps = 27/467 (5%)

Query: 35  PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGN---LPEDHPLKNYFRKDFH 91
           P+      ++A+V P+++SV V+  +   V  +    G G+   LP        F + F 
Sbjct: 66  PAPAGFADLVAKVKPAVISVRVKIDEDRQVTPLVRDDGDGDQMRLPRGF---QQFERQFG 122

Query: 92  KFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVG 151
             F G E +          GSGFFIT DGY +T+NH+V+   S  V   D T   AK+VG
Sbjct: 123 --FRGPEGMPKGHQTITGEGSGFFITADGYAVTNNHVVDQAKSVQVTTDDGTIYTAKVVG 180

Query: 152 TDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI 211
            D   DLA++KV     F  V F D +  RVG+ V  +GNPF L GTV+AGIVSA  RDI
Sbjct: 181 IDPKTDLALIKVDGKSDFPHVNFAD-SPARVGDWVIAVGNPFGLGGTVTAGIVSARGRDI 239

Query: 212 PDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKA 270
              P   + QIDAPIN+GNSGGP F+  G+VIGVN  I +     +G+G  IP +  K  
Sbjct: 240 GSGPYDDYVQIDAPINKGNSGGPAFDTNGNVIGVNTAIYSPSGGSVGIGFDIPAATAKLV 299

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
           +  L  +G V  GW G+  Q +T E+A  LG++  +G+L+ +    SPA KAG+K GDVI
Sbjct: 300 VSQLKDRGYVSRGWLGVQVQPVTAEIADSLGMKQARGALVDSPQDGSPAAKAGIKAGDVI 359

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP-----TAKNDMH 385
             +DG+ +K  +     I++ +P   VK+ +   G   ++ + L   P      A N   
Sbjct: 360 TAVDGKEVKDSRALARTISTLTPGSSVKLDVLHNGQSKTIDLTLAEMPGDHQKVADNGGA 419

Query: 386 LEVGDKELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
                +  LG+ +    +++   K  V +  ++P  E     KG++ G  I+ V    V+
Sbjct: 420 ERGPGRPYLGLRVVPAGEVDGAGKAGVVVTGVDP--EGPAADKGLRTGDVILDVGGKTVA 477

Query: 443 CIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              DV   +  A +  + +VL+++K         D+ +RFV++ I K
Sbjct: 478 NTGDVRSALVAASKDGKKTVLMRVKT-------ADSAARFVAVPIAK 517


>gi|307945465|ref|ZP_07660801.1| serine protease [Roseibium sp. TrichSKD4]
 gi|307771338|gb|EFO30563.1| serine protease [Roseibium sp. TrichSKD4]
          Length = 380

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 216/384 (56%), Gaps = 15/384 (3%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGFFI+DDGY++T++H+++ G  F+VI  D  E  A+L+G DA  DLA+LK+ +D +F 
Sbjct: 4   GSGFFISDDGYVVTNHHVIDKGTEFTVIGHDGKEYEARLIGADARTDLALLKIDTDEEFT 63

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            V+F D +   VGE V  IGNPF L G+V+AGIVSA  RDI   P   F QIDAP+N+GN
Sbjct: 64  YVKFAD-DAPHVGEWVVAIGNPFGLGGSVTAGIVSARGRDIGAGPYDDFIQIDAPVNRGN 122

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP FN  G VIGVNA I +    ++G+   IP S     +  L   G+V  GW G+  
Sbjct: 123 SGGPAFNMNGEVIGVNAAIFSPSGGNVGIAFAIPASTATDVLMDLQDGGKVTRGWLGVQI 182

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           Q +++++A  L L   +G++++ V  +SPA+ AG++ GD I  ++G  IK  +D    IA
Sbjct: 183 QGVSEDIAESLDLDEARGAIVSEVQPDSPAEAAGLRSGDTILAVEGNEIKGPRDLSKVIA 242

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGS-----SPTAKNDMHLEVGDKELLGMVLQDINDG 404
              P   V I++ ++G +  VAV LGS     S  A   +       E LG+VL   +  
Sbjct: 243 GFDPDTLVDITVWRDGREQDVAVKLGSLKEPASVAAAVKVTPTETTLEDLGLVLSATDPS 302

Query: 405 NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
            +K   ++  +         K +++G  I+ V    V    DV   + KA+ + R +VL 
Sbjct: 303 GEKSEGVIVSDVKAGGPAAEKRLRRGDRILEVAGTPVKSPADVVEALSKAENEGRKAVLF 362

Query: 465 QIKYDPDMQSGNDNMSRFVSLKID 488
           +++        ++  +RFV+L ++
Sbjct: 363 RVE--------SNQNTRFVALPMN 378


>gi|319780155|ref|YP_004139631.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166043|gb|ADV09581.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 506

 Score =  232 bits (592), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 150/445 (33%), Positives = 230/445 (51%), Gaps = 26/445 (5%)

Query: 42  PVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDF--HKFFSGEEP 99
           P++A   P++V+V      K   E M +A  F       P  +YFR+ F      + + P
Sbjct: 54  PIVAADKPAVVTVTTV--MKAQPETMSDASPFDG---GSPFDDYFRQFFGDQGMPTPKTP 108

Query: 100 ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
                      GSGF +  DG I+T+NH+++  +S  V L D TELPAKLVG DA  DLA
Sbjct: 109 PQQQPQRAEALGSGFIVASDGTIVTNNHVIDGASSIKVTLDDGTELPAKLVGRDAKNDLA 168

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTF 218
           VLK++SD+    V++ D++ +  G+ V   GNPF +  TV+AGIVSA  RD+   P   F
Sbjct: 169 VLKIKSDKPLPTVKWGDSDKLMPGDQVLAFGNPFGIGTTVTAGIVSARGRDLHSGPFDDF 228

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            QIDAPIN GNSGGP  +  G+V+G+N  I +     +GVG  IP    +K +  L+  G
Sbjct: 229 IQIDAPINHGNSGGPLVDVAGNVVGINTAIYSPNGGSVGVGFAIPSDQAQKVVAKLMKGG 288

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
            + +G+ G+  Q +T ++A  +GL    G+L++ V   SPA KAG++ GDVI    G+ +
Sbjct: 289 SIQYGYLGVQIQEVTPDVASAIGLDHPGGALVSEVNDGSPAAKAGIETGDVITSFAGQDV 348

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE-------VGDK 391
           K  +D    +A  +P     + + ++G    ++V +G +        L+        G  
Sbjct: 349 KDPKDLSRAVADVAPGATETVDVWRKGKPMRISVDVGQNSADAKTASLDDGSDTPSAGRA 408

Query: 392 ELLGMVLQDIND---------GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
             +G+ L DI           G +    + ++NP  ++   A GIQ G  IV+VN   V 
Sbjct: 409 PAIGLGLMDITPDIRQQMNLAGKQHGAVVASVNP--DKAAAASGIQAGDIIVAVNQVPVK 466

Query: 443 CIKDVERLIGKAKEKKRDSVLLQIK 467
             + V + I +A +  R SVLL ++
Sbjct: 467 NARQVTQAIAQAGKSGRKSVLLLVE 491


>gi|114766775|ref|ZP_01445712.1| periplasmic serine protease, DO/DeqQ family protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114541032|gb|EAU44089.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. HTCC2601]
          Length = 494

 Score =  232 bits (592), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 151/480 (31%), Positives = 246/480 (51%), Gaps = 31/480 (6%)

Query: 24  STYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLK 83
           S +L++   L  S+ + P   A+++  I   +V      +V       G   +PE  P +
Sbjct: 28  SMFLIVSQTLMASAQNAPESFAKLAERISPAVVNITTSTTVAGRTGPQGI--VPEGSPFE 85

Query: 84  NYFRK-DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
           ++FR+        G+ P  S  +     GSGF I++DGYI+T+NH++E      +   + 
Sbjct: 86  DFFREFQDRNGGPGDRPRRSSAL-----GSGFVISEDGYIVTNNHVIEGADEIEIEFFEG 140

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
             LPA+LVGTD   D+A+LKV++D     V F +++N RVG+ V  +GNP     +VSAG
Sbjct: 141 FTLPAELVGTDPNTDIALLKVEADEALKFVSFGNSDNARVGDWVMAMGNPLGQGFSVSAG 200

Query: 203 IVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           IVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +
Sbjct: 201 IVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAILSPNGGSIGIGFSM 260

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
             +++ K +  L   G    GW G+  Q++T+++A  LGL  T+G++++  V E PA +A
Sbjct: 261 ASNVVTKVVDQLKEFGETRRGWLGVRIQDVTEDMAEALGLASTEGAMVSD-VPEGPAMEA 319

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG------- 375
           GM+ GDVI   DGR ++  +  V  + +    + V++ + + G+  ++ V LG       
Sbjct: 320 GMQAGDVIVSFDGREVQDTRQLVRIVGNTEVGKSVRVVVNRNGNTETLKVTLGRREEAER 379

Query: 376 SSPTAKNDMHLEVGDKELLGMVL----QDINDG---NKKLVRIVALNPNREREVEAKGIQ 428
           + P ++     E  + EL+G+ L    Q++ D          +     +   E   KG++
Sbjct: 380 TYPASQEMTPEEPAESELMGLTLSPLTQELRDEMGLQSSATGLAVTGVDETSEAFEKGLR 439

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            G  I      EV  I ++E  I +AKE  R S+LL ++   D         RFV+L +D
Sbjct: 440 AGDIITEAGQAEVLSISELETKIEEAKEAGRKSILLLVRRGGD--------PRFVALSLD 491


>gi|51244607|ref|YP_064491.1| serine protease DegQ [precursor] [Desulfotalea psychrophila LSv54]
 gi|50875644|emb|CAG35484.1| probable serine protease DegQ [Precursor] [Desulfotalea
           psychrophila LSv54]
          Length = 484

 Score =  232 bits (592), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 156/495 (31%), Positives = 252/495 (50%), Gaps = 42/495 (8%)

Query: 10  KSICTVALTCVIFSSTYLVLEAK-----LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           + IC + L C  F  T L   ++     L  SS     V  +  P++V++ VE  K +  
Sbjct: 10  RGIC-LHLLCSFFFVTSLAYASENDLEILEKSSKAFASVARQAKPAVVNIRVE--KTIKG 66

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFG--SGFFITDDGYI 122
            QM + +   +   +HP        F +FF  +     +   RL  G  SGF ++DDGYI
Sbjct: 67  GQM-DGWQIPDEMLEHPF-------FKQFFGPQLRKRQNVPPRLQQGQGSGFIVSDDGYI 118

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           LT+NH+V+   S +V L+DD+   AKL+GTD L D+A++K++S +K   +    +  + V
Sbjct: 119 LTNNHVVDGADSITVRLNDDSSYQAKLIGTDPLSDVALIKIESSKKLPSLAMGSSAALEV 178

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGH 240
           GE V  IGNPF L  TV+ GIVSA  R     +    F Q DA IN GNSGGP  N  G 
Sbjct: 179 GEWVIAIGNPFGLSQTVTVGIVSAKGRSQVGLNEYENFIQTDAAINPGNSGGPLLNIRGQ 238

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIG+N+ + +    +MG+G  IP+ ++K     L + G+V  GW G+M Q++ + LA   
Sbjct: 239 VIGINSALFSQTGGYMGIGFAIPIDMVKSIERQLQATGKVSRGWLGVMIQDIDENLAQSF 298

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL+ + G L+T V  +SPA+K G+  GDVI  +DG  +K+      ++A   P  +V + 
Sbjct: 299 GLKSSSGVLLTGVQPDSPAEKGGLLGGDVIIAIDGSAVKNASALRNRVALVLPGSKVVLQ 358

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLE----------VGDKELLGMVLQDINDGNKKLVR 410
           + ++G K  + V++G  P   N + +E          +  ++L   + +      KK V 
Sbjct: 359 VIRKGKKRDIGVLIGERPVGANGLSIEDHTVLNNNFGLSFEKLTPEIAKKFGYAQKKGVV 418

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
           I  + P  +      G++ GM I  VN   +  + D+++ +   K+ +   VLL++ +  
Sbjct: 419 IREVAP--QSPASRAGLKAGMLIEEVNRMAIGQVADIKKALALGKDARH--VLLRVGFGQ 474

Query: 471 DMQSGNDNMSRFVSL 485
                    SR+++L
Sbjct: 475 G--------SRYIAL 481


>gi|288962879|ref|YP_003453173.1| trypsin-like serine protease [Azospirillum sp. B510]
 gi|288915145|dbj|BAI76629.1| trypsin-like serine protease [Azospirillum sp. B510]
          Length = 543

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 165/521 (31%), Positives = 254/521 (48%), Gaps = 64/521 (12%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLP----PVIAR--VSPS---IVSVMVEPK 59
           ++ +  VAL  ++F +   V     P ++ D P    P  +R    PS   +    ++  
Sbjct: 13  LRRLPAVALCALLFGA---VFSPAAPVAAQDAPAGPQPGASRTYAPPSFRDLARTQIDTV 69

Query: 60  KKVSVEQMFNA-YGFGNLPED------HPLKNYFR--KDFHKFFSGEEP----------- 99
             +S  Q  +A  G G LPE        PL+ +FR  ++  +   GE P           
Sbjct: 70  VNISSTQAPSAPAGAGRLPEGMDIPPGSPLEEFFRGFRNRQRGGPGERPGERPGNGAGDG 129

Query: 100 ---ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
                      +  GSGF I   G ++T+NH+V D A  +V L D T LPAKLVG DA  
Sbjct: 130 PGSGGPPVPPSMALGSGFIIDPSGLVVTNNHVVADAAEIAVTLHDGTRLPAKLVGADAPT 189

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP- 215
           DLA+LKV+SDR      + D+ ++ VG+ V  IGNPF L G+V+AGI+SA  RDI   P 
Sbjct: 190 DLALLKVESDRPLAATHWGDSESVEVGDWVVAIGNPFGLGGSVTAGILSARARDIQQGPY 249

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             + Q DA IN+GNSGGP ++  G VIG+N  I +     +G+G  IP S+ K  +  L 
Sbjct: 250 DEYLQTDAAINRGNSGGPLYDVGGAVIGINTAIYSPTGGSVGIGFAIPSSLAKPIVDQLK 309

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
             G+V  GW G+  Q +T ++A  LG++GT G+L+T+V   SPA  AG++ GDVI   DG
Sbjct: 310 DGGKVRRGWLGVQVQRVTPDIAESLGVQGTGGALVTSVSPGSPAAAAGLRQGDVITAFDG 369

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL-------------GSSPTAKN 382
             ++  +     +AS +    V ++L + G + SV V +             GSS   ++
Sbjct: 370 GPLEQMRQLPRLVASTAIGRTVPLTLLRAGKERSVQVTVGELRNEPQQLAMSGSSGAPRS 429

Query: 383 DMHLEVGDKELLGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVS 435
               E      LG+ L  +  G ++   I       V     R+     +G+  G  IV 
Sbjct: 430 AQPEE--SASALGLKLAPLTPGLRESFSIGEDVNGLVVTEVERDSPAAERGLDLGDVIVE 487

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLL------QIKYDP 470
           V    ++   D++  I +A+E+ R ++L+      +++Y P
Sbjct: 488 VGQEPLATPADLDSRIARAREQGRKTLLMLVSRGGELRYVP 528


>gi|170751798|ref|YP_001758058.1| protease Do [Methylobacterium radiotolerans JCM 2831]
 gi|170658320|gb|ACB27375.1| protease Do [Methylobacterium radiotolerans JCM 2831]
          Length = 508

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 162/480 (33%), Positives = 246/480 (51%), Gaps = 25/480 (5%)

Query: 23  SSTYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLP 77
           +  Y     K P  + + PP     ++++V P +VSV V+     S +         NL 
Sbjct: 38  TPAYAQALPKSPIEAPEHPPGSFAGIVSKVKPGVVSVKVKLDDSASSDDDDGPSQGRNLQ 97

Query: 78  EDHP-LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
              P L+ +F++       G +P       R   GSGF I+ DGY++T+NH+V+   +  
Sbjct: 98  NVPPQLREFFKRFGQNGPGGMQP--QHQGPRGAVGSGFIISADGYVVTNNHVVDHAKTVQ 155

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V L D   L AK++G D+  D+A+LK+     F  V+F  A   +VG+ V  IGNPF L 
Sbjct: 156 VTLDDGRTLDAKVIGKDSKTDVALLKITEGSNFPYVQFGKAAP-QVGDWVVAIGNPFGLG 214

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+G+N  I +     
Sbjct: 215 GTVTAGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGMNTAIASPSGGS 274

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+   IP   ++  +  L + G+V  G+ G+  Q +TQ++A  LGL   KG+L+     
Sbjct: 275 VGLAFAIPAETVQAVVDQLRTDGKVARGYLGVQIQPVTQDIAEGLGLDKAKGALVDHAEN 334

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
            +PA KAG+K GDVI  ++G  + S ++   +IA   P  +V++S  + G   +  V LG
Sbjct: 335 GTPAAKAGLKAGDVIEKVNGDTVDSARELSRKIAGLKPGAKVELSYLRGGKTDTATVTLG 394

Query: 376 SSPTAKNDMHLEVGD----KELLGMVLQDINDG--NKKLVRIVALNPNREREVEAKGIQK 429
           + PT    M     D    +  LG+ L    D   + + V +V ++P  +    AKGI+ 
Sbjct: 395 TMPTDGTKMASRDDDSGNGQPRLGLQLAPAGDVGLSDQGVAVVQVDP--DGPAAAKGIEA 452

Query: 430 GMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           G  I+ V    VS   DV   I  A+   R +VL+++K            +RFV++ ++K
Sbjct: 453 GDVILDVGGQSVSRPADVATQIRAAETSGRKAVLMRVKS-------GKGQTRFVAVSLNK 505


>gi|85715371|ref|ZP_01046353.1| peptidase S1C [Nitrobacter sp. Nb-311A]
 gi|85697792|gb|EAQ35667.1| peptidase S1C [Nitrobacter sp. Nb-311A]
          Length = 516

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 148/465 (31%), Positives = 242/465 (52%), Gaps = 39/465 (8%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV +  K K   +    ++  G+     P++ +FR+     F G + +  
Sbjct: 72  IVERVKPSVISVKIRMKDKAEADGEEWSFQPGS-----PMERFFRR-----FGGPDGLPP 121

Query: 103 DTVERLMFG------SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
               R   G      SGFFI+ DGY +T+NH+V+      V   D     AK++GTD   
Sbjct: 122 GMRGRRGHGFVTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYTAKVIGTDPRT 181

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP- 215
           D+A++KV+    F   +  D + +R+G+ V  +GNPF L G+V+AGIVSA  RDI   P 
Sbjct: 182 DIALIKVEGGSNFAFAKLSD-DKVRIGDWVLAVGNPFGLGGSVTAGIVSASGRDIGTGPY 240

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F QIDAP+N+GNSGGP FN  G V+GVN  I +     +G+   IP + +K  +  L 
Sbjct: 241 DDFLQIDAPVNKGNSGGPAFNMKGDVVGVNTAIYSPSGGSVGIAFSIPANTVKSVVAQLK 300

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
            KG V  GW G+  Q +T ++A  LGL+  +G+L+      SPA KAG++ GDVI  ++G
Sbjct: 301 DKGSVSRGWIGVQIQPVTSDIADSLGLKKAEGALVAEPQSNSPAAKAGIQSGDVITAVNG 360

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT---AKNDMHLEVG--- 389
             +K  ++    I S +P   +K+++ ++G    V + LG+ P    A+ D H + G   
Sbjct: 361 DPVKDARELARTIGSFAPGTSIKLNILRKGKDKVVNLTLGTLPNTVEARADHHGDRGSLH 420

Query: 390 --DKELLGMVLQ---DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
             D   LG+ +     +     + V ++ ++P        +G ++G  I+ V    VS  
Sbjct: 421 DSDIPRLGLTVAPAGSVAGAGAEGVVVIDVDP--RSPAADRGFKEGDVILEVAGKSVSNS 478

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            DV + I  A+   ++SVL++++          + +RF+++ I K
Sbjct: 479 ADVRQAITSARADNKNSVLMRVR--------TGSTARFIAMPIAK 515


>gi|92116994|ref|YP_576723.1| peptidase S1C, Do [Nitrobacter hamburgensis X14]
 gi|91799888|gb|ABE62263.1| Peptidase S1C, Do [Nitrobacter hamburgensis X14]
          Length = 523

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 151/466 (32%), Positives = 243/466 (52%), Gaps = 40/466 (8%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV V  K KV      + +  G+     P++ +FR+     F G + +  
Sbjct: 78  IVERVKPSVISVKVRMKDKVVAGDDDSPFQPGS-----PMERFFRR-----FGGPDGLPP 127

Query: 103 DTVERLMFG------SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
               R   G      SGFFI+ DGY +T+NH+V+D     V         AK++GTD   
Sbjct: 128 GMHGRRGHGIVTGQGSGFFISADGYAVTNNHVVDDADKVEVTTDGGKTYTAKVIGTDPRT 187

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP- 215
           D+A++KV+    F   +  D +  R+G+ V  +GNPF L GTV++GIVSA+ RDI + P 
Sbjct: 188 DIALIKVEGGSNFPFAKLSD-DKARIGDWVLAVGNPFGLGGTVTSGIVSAIGRDIGNGPY 246

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F QIDAP+N+GNSGGP FN  G VIGVN  I +     +G+   IP + +K  +  L 
Sbjct: 247 DDFIQIDAPVNKGNSGGPAFNMKGDVIGVNTAIYSPSGGSVGIAFSIPANTVKNVVAQLK 306

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
            KG V  GW G+  Q +T ++A  LGL+ T+G+L+     +SPA KAG++ GDVI  ++G
Sbjct: 307 DKGSVSRGWIGVQIQPVTADIADSLGLKKTEGALVAEPQADSPAAKAGIQSGDVITQVNG 366

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT---AKNDMHLE----- 387
             +K  ++    I   +P   +K+++  +G+   + + LG  P    AK D++ +     
Sbjct: 367 ATVKDARELARTIGGLAPGTSIKLNVLHKGTDKVINLTLGILPNTAEAKADLYGDDHGPS 426

Query: 388 -VGDKELLGMVLQ---DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
              D   LGM +     +     + V +V ++P  +     +G ++G  I+ V   +VS 
Sbjct: 427 HGDDVPRLGMTVAPAGSVAGAGTEGVVVVDVDP--KSAAADRGFKEGDVILEVGGKDVSN 484

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             DV   I  A+   ++S+L++++            +RFV++ I K
Sbjct: 485 SADVREAIKAARADHKNSILMRVR--------TGGTARFVAVPIAK 522


>gi|27378241|ref|NP_769770.1| DO-like serine protease [Bradyrhizobium japonicum USDA 110]
 gi|27351388|dbj|BAC48395.1| serine protease DO-like precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 525

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 161/525 (30%), Positives = 253/525 (48%), Gaps = 55/525 (10%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPP-------------------- 42
           +R + S + I  +A     F +        + P+ +   P                    
Sbjct: 17  RRSVFSARKIALMASVVAGFGAAVYGFSPSVSPADLFSSPAHAQVNNEVRKVERPVGFAD 76

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PI 100
           ++ RV PS++SV V  K+K +     +       P   P++ +FR+     F G +  P 
Sbjct: 77  IVERVKPSVISVKVNIKEKTASNDDGDDSSSPFQP-GSPMERFFRR-----FGGPDGIPG 130

Query: 101 LSDTVERLMFG--SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
           +     R++ G  SGFFI+ DG+ +T+NH+V+      V   D     AK++GTD   DL
Sbjct: 131 MKGGRGRVVQGQGSGFFISADGFAVTNNHVVDGADKVEVTTDDGKTYTAKVIGTDQRTDL 190

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GT 217
           A++KV+    F   +  D    R+G+ V  +GNPF L GTV+AGIVSA  RDI + P   
Sbjct: 191 ALIKVEGGSNFPFAKLADGKP-RIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDD 249

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F QIDAP+N+GNSGGP FN  G V+GVN  I +     +G+   IP + +K  +  L  K
Sbjct: 250 FIQIDAPVNKGNSGGPAFNTDGEVMGVNTAIYSPSGGSVGIAFSIPANTVKTVVAQLKDK 309

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           G V  GW G+  Q +T ++A  LG++  +G+L+       PA KAG++ GDVI  ++G  
Sbjct: 310 GSVSRGWIGVQIQPVTSDIADSLGMKKAEGALVAEPQANGPAAKAGIESGDVITSVNGES 369

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT---AKNDMHLEVG----- 389
           +K  ++    I   +P   VK+++  +G    V + LG  P    AK D   + G     
Sbjct: 370 VKDARELARTIGGMAPGAIVKLNVLHKGQDKVVNLTLGQLPNTVEAKADTDNDSGKGATK 429

Query: 390 --DKELLGMVLQDIND---GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
             D   LGM +   N      K+ V +  ++P  +     +G ++G  I+ V    VS  
Sbjct: 430 GTDVPKLGMTVAPANSVAGAGKEGVVVTEVDP--KSAAAERGFKEGDVILEVGGKSVSTA 487

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            DV   I  A+   ++SVL+++K        +   SRFV++ + K
Sbjct: 488 GDVREAINTARTDNKNSVLMRVK--------SGGQSRFVAIPLAK 524


>gi|182679196|ref|YP_001833342.1| protease Do [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635079|gb|ACB95853.1| protease Do [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 529

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 173/516 (33%), Positives = 258/516 (50%), Gaps = 55/516 (10%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLP-------PVIARVS-------- 48
           R IL + +   VALT     S  L   A     ++++P       PV+  VS        
Sbjct: 29  RAIL-LGATAAVALTGAFTHSVLLPQAANAETPTLNVPVNAPNSSPVVGPVSFADVVDHV 87

Query: 49  -PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK-------DFHKFFSGEEPI 100
             ++VSV V+  +    E+              PL+ +FR+        F+K  SG+ P 
Sbjct: 88  RGAVVSVKVKITETADNEEANTGNDMPQFAPGDPLERFFRRFGEQGGVPFNKH-SGK-PR 145

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF I+ DGY++T+NH+VE+    S+       L A +VGTD   DLA+
Sbjct: 146 TGQAQ-----GSGFIISSDGYVVTNNHVVENATEVSLTTDGGQTLTASVVGTDKKTDLAL 200

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFT 219
           LK+     +  V+F +    RVGE V  +GNPF L GTV+AGI+SA  RDI   P   F 
Sbjct: 201 LKINGSGTYPFVKFSN-ETPRVGEWVIAVGNPFGLGGTVTAGIISARGRDIGAGPYDDFL 259

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q+DAP+N+GNSGGP FNA G V+GVN  I +     +G+G  IP  + +  I SL  KG 
Sbjct: 260 QVDAPVNRGNSGGPTFNAKGDVVGVNTAIFSPSGGSVGIGFAIPAEVAQNVITSLREKGT 319

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  GW G+  Q +T E+A  LGL+ +KG+L+      SPA  AG++ GDVI  +DG  I 
Sbjct: 320 VARGWIGVQIQPVTAEIADSLGLKTSKGALVAEAQPNSPALSAGIRSGDVILGVDGERID 379

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT---AKNDMHLEVGDKELLG- 395
             ++   +IA+  P +   +    +GS+ +VAV LG+ P    AK D+     DK +LG 
Sbjct: 380 GPRELARKIAALGPGKSTNLMYWHDGSEKTVAVKLGNLPNDKEAKADITTRP-DKNVLGD 438

Query: 396 ------MVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
                    Q    G++ +V +  ++P  +     KG++ G  I+    H VS   ++  
Sbjct: 439 LGLTLAPAAQVPGAGDEGVV-VSDIDP--DGVAAQKGLRVGDVILEAGGHAVSRPAEIGA 495

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
            +  AK+  R +VL+++K        N   +R+V+L
Sbjct: 496 TLSTAKKDGRKAVLMRVK--------NREGTRYVAL 523


>gi|222053515|ref|YP_002535877.1| protease Do [Geobacter sp. FRC-32]
 gi|221562804|gb|ACM18776.1| protease Do [Geobacter sp. FRC-32]
          Length = 466

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 163/484 (33%), Positives = 252/484 (52%), Gaps = 41/484 (8%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSV----MVEPKKKVSVEQMFNAYG 72
            TC +  S  L   A   P   D   +  ++ P++V++     ++P+++   ++ FN+  
Sbjct: 12  FTCSLALSVMLCGVAMAKPVLPDFVELAKKLKPTVVNISTAKTIKPQRRF--QRPFNSP- 68

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
           FGN P       +F +      S + P    +      GSGF I+D+GYI+T+NH+V + 
Sbjct: 69  FGNDPFQDFFDRFFDE------SQQHPYKQKS-----LGSGFIISDEGYIITNNHVVAEA 117

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE-FEDANNIRVGEAVFTIGN 191
               V LSD  E   ++ GTD   DLA+LK+ S +  +PV    D++ I +GE V  IGN
Sbjct: 118 DEIKVKLSDGREFKGEIKGTDEKLDLALLKI-STKDHLPVAALGDSDKIEIGEWVMAIGN 176

Query: 192 PFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FNA G VIG+N  IV 
Sbjct: 177 PFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNAQGEVIGINTAIVA 236

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
            GQ   G+G  IP+++ K  IP L  KG+V  GW G+  Q +T ELA    L+G KG+LI
Sbjct: 237 GGQ---GIGFAIPVNMAKNIIPMLKEKGKVTRGWIGVSIQPITPELAQSFELKGEKGALI 293

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             VVK+ PA+KAG+K GD+I   +GR I    +    +A+    +QV + + +EG    +
Sbjct: 294 AEVVKDGPAEKAGLKSGDIILEFNGRAIHEMNELPRMVAATPVDKQVNVKILREGKPVDL 353

Query: 371 AVVLGSSPTAKNDMHLEVGDKELLGMVLQDIND------GNKKLVRIVALNPNREREVEA 424
           ++ +      ++     V  +E LG+ +++++       G K+   +V  +   E   E 
Sbjct: 354 SINVERLKDGEDGDQAGV-SQEKLGITVRELSKDLAAKLGIKEQKGVVITDVKPESSAEQ 412

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVS 484
            GI KG  I  +N  +++ + D E+ +   K+     +LL+            +MS FV+
Sbjct: 413 TGIAKGDIIREINGSKINSVGDYEKAVNGHKKGTVMRMLLR----------RGDMSLFVA 462

Query: 485 LKID 488
            ++D
Sbjct: 463 FRVD 466


>gi|163746074|ref|ZP_02153433.1| periplasmic serine protease, DO/DeqQ family protein [Oceanibulbus
           indolifex HEL-45]
 gi|161380819|gb|EDQ05229.1| periplasmic serine protease, DO/DeqQ family protein [Oceanibulbus
           indolifex HEL-45]
          Length = 494

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 156/496 (31%), Positives = 255/496 (51%), Gaps = 47/496 (9%)

Query: 16  ALTCVIFSSTYLVLEAKLP---PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           A+   + + T L+L+A +    P S  L P+  ++SPS+V++        +VE      G
Sbjct: 20  AMAMGVMALTLLILQASMALAKPES--LAPLAEKISPSVVNITT----STTVEGRTGPQG 73

Query: 73  FGNLPEDHPLKNYFRKDFHKFFS--GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
              +PE  P +++FR +F    +  G+ P  S        GSGF I++DGY++T+NH++E
Sbjct: 74  I--VPEGSPFEDFFR-EFQDRNNDEGDRPRRSSA-----LGSGFVISEDGYVVTNNHVIE 125

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
                ++      EL AK++GTD   D+A+LKV++ +    V F D+N  RVG+ V  +G
Sbjct: 126 SADEITIEFFSGEELVAKVIGTDPKTDIALLKVEASQPLPFVSFGDSNAARVGDWVIAMG 185

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           NP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++
Sbjct: 186 NPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILS 245

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                +G+G  +  +++ + I  L   G    GW G+  Q++T ++A  +GL+   G+LI
Sbjct: 246 PNGGSIGIGFSMASNVVTRVIDQLKEFGETRRGWLGVRIQDVTDDVADAMGLKKAVGALI 305

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           T  V E PA +AG+K GDVI   DG  +   +  V Q+ +      V++++ ++G   ++
Sbjct: 306 TD-VPEGPAREAGLKTGDVIKSFDGVEVADTRGLVRQVGNSPVGATVRVTVLRDGKTQTI 364

Query: 371 AVVL-------GSSPTAKNDMHLEVGDKE-----LLGMVLQDIND-------GNKKLVRI 411
            VVL       G+ P A ++   E  + E     L+G+ L  ++D        +     +
Sbjct: 365 KVVLGRREDADGAVPAAMDENADEGTEAEPQSTMLMGLTLTPLSDALRAELGADDGTTGL 424

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
              + ++  E   KG++ G  I      +V+ I D+E  I  AK+  R S+LL ++   D
Sbjct: 425 AVADVDQTSEAYEKGLRMGDIITEAGQEKVASISDLEARIAAAKDAGRKSLLLLVRRGGD 484

Query: 472 MQSGNDNMSRFVSLKI 487
                    RFV+L +
Sbjct: 485 --------PRFVALSL 492


>gi|56417111|ref|YP_154185.1| hypothetical protein AM1066 [Anaplasma marginale str. St. Maries]
 gi|222475476|ref|YP_002563893.1| hypothetical protein AMF_805 [Anaplasma marginale str. Florida]
 gi|254995285|ref|ZP_05277475.1| hypothetical protein AmarM_04955 [Anaplasma marginale str.
           Mississippi]
 gi|255003464|ref|ZP_05278428.1| hypothetical protein AmarPR_04410 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004590|ref|ZP_05279391.1| hypothetical protein AmarV_04760 [Anaplasma marginale str.
           Virginia]
 gi|56388343|gb|AAV86930.1| hypothetical protein AM1066 [Anaplasma marginale str. St. Maries]
 gi|222419614|gb|ACM49637.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 487

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 156/505 (30%), Positives = 265/505 (52%), Gaps = 40/505 (7%)

Query: 2   FKRQILSVKSICTV-----ALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMV 56
           F    L + S+C++     AL+ V  S T +      P S      + A++ P++V++  
Sbjct: 4   FLSLFLLIASLCSIHSGGSALSSVAGSKTAV------PDSRRGFSGLAAKLLPAVVNIST 57

Query: 57  EPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVER---LMFGSG 113
           E         M   + F  +P         +  F +FF+  EP+L D ++    +  GSG
Sbjct: 58  EQTVDSDASSMGQGFRFPGIP---------KGIFEEFFNNLEPLLVDPLKPRKVVSLGSG 108

Query: 114 FFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
           F +   G I+T+ H++ +     V  SD++   A ++G D   DLAVLKV++ +   PV 
Sbjct: 109 FIVDKSGLIVTNYHVIANAKEIHVKFSDNSTAKATVLGKDPKTDLAVLKVKTKKDLQPVT 168

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGG 232
             +++ + VGE V  IGNPF L G+VS GI+S   RDI       F Q DA IN+G+SGG
Sbjct: 169 LGNSDEVLVGEWVLAIGNPFGLGGSVSVGIISGRARDINIGTASEFLQTDAAINRGHSGG 228

Query: 233 PCFNALGHVIGVNAMIVT-SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           P FNA G VIG+N  I++  G  ++GV   IP +   + I  L   GRV+HGW G++ Q+
Sbjct: 229 PLFNADGEVIGINTAIMSPQGGGNVGVAFAIPSNNAARVIRVLSKGGRVEHGWLGVVIQH 288

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +T ++   LGL   +G+LI+ V K+SPA+KAG+KVGDVI   +G+ I++       I   
Sbjct: 289 VTDDMTDSLGLESARGALISGVAKDSPAEKAGLKVGDVILEFNGQKIENMPQLTHLITKA 348

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----LGMVLQDINDGNKK 407
           +  E+ KI++ ++G   +V V +G  P   +D      D+E     +G+ + ++   +KK
Sbjct: 349 AVNEKAKITVQRDGRALNVMVTIGKLP---DDAVPGGADQEATDDSVGLTVGNLPKNSKK 405

Query: 408 LVR-IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK--RDSVLL 464
               ++ L  +   +  ++G++KG  ++ +N+  ++ + D  + + K K     + S+LL
Sbjct: 406 QQEGVLILRVDHRSDAFSEGVRKGDILLGINSATINSVSDFNKEMSKIKSGSGGKGSLLL 465

Query: 465 QIKYDPDMQSGNDNMSRFVSLKIDK 489
            +K     + G D    ++ +K++K
Sbjct: 466 LVK-----KGGGDAPPIYIPVKLNK 485


>gi|114569493|ref|YP_756173.1| protease Do [Maricaulis maris MCS10]
 gi|114339955|gb|ABI65235.1| protease Do [Maricaulis maris MCS10]
          Length = 506

 Score =  229 bits (585), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 142/460 (30%), Positives = 241/460 (52%), Gaps = 32/460 (6%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           +I  VSPS+V+V V    + S       +G GN P+   L    R+   + F G+     
Sbjct: 60  LIETVSPSVVTVQVSGLVESS------PFGGGNGPDLDNLPPQMREWMERQFGGQRQA-P 112

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
               R   GSGFFI+ DGY++T++H+V +    ++  ++  E PA+++GTD   DLA+LK
Sbjct: 113 QPQPRQSLGSGFFISADGYLVTNHHVVANADEITIGTAEGEEFPARVIGTDPQTDLALLK 172

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQI 221
           V  +  F  V  E+  N RVG+ V  +GNPF L GT +AGI+SA+ R I +     F Q 
Sbjct: 173 VDGETDFPFVRLEENPNYRVGDWVVAVGNPFGLGGTATAGIISAIGRPIGNSTYNDFIQT 232

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DA IN+GNSGGP F+  G+VIGVN+ I +    ++G+G  IP  +  + +  L   GRV 
Sbjct: 233 DASINRGNSGGPTFDLNGNVIGVNSQIFSPSGGNVGIGFAIPSDVAARIVGDLRDDGRVA 292

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            GW G+  QN+T+++A  LGL GT G++I+++V+  PAD+AG +  DV+  +DG  +   
Sbjct: 293 RGWLGVSIQNVTEDIAEALGLEGTTGAIISSIVEGGPADRAGFEREDVVLEIDGEAVDGS 352

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-----ELLGM 396
           +D   ++ +      V+  + ++G + ++   LG  P  +    +   D       + GM
Sbjct: 353 RDLTRRVGNIQAGGDVRFLVLRDGRERTIRATLGDRPGEEQLASMSSVDAAPARTSVFGM 412

Query: 397 VLQDINDGNKKL---------VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
            +  + + ++++         V +  + P    E   KG+Q G  I+    + V+  + +
Sbjct: 413 SMAPLAEEDREVRGLGAEVSGVVVDEIEPG--SEAARKGVQVGDIILEAGGNSVADAEAL 470

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             +  +A+E  R ++LL ++             R+V+L++
Sbjct: 471 RAIADEAREDGRSAILLLVE--------GRGGQRYVALQL 502


>gi|146339742|ref|YP_001204790.1| putative serine protease do-like [Bradyrhizobium sp. ORS278]
 gi|146192548|emb|CAL76553.1| Putative serine protease do-like precursor [Bradyrhizobium sp.
           ORS278]
          Length = 528

 Score =  229 bits (585), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 152/469 (32%), Positives = 233/469 (49%), Gaps = 41/469 (8%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI-- 100
           ++ RV PS++SV V   +KV+     +   F       P++ +FR+     F GE  I  
Sbjct: 78  IVERVKPSVISVKVNIAEKVAKNDNDDDTPF---QPGSPMERFFRR-----FGGENGIPG 129

Query: 101 ------LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
                           GSGFFI+ DGY +T+NH+V+      V   D     AK++GTD 
Sbjct: 130 MPGRGGRGGGRAVTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYSAKVIGTDQ 189

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             DLA++KV+    F   +  D    R+G+ V  +GNPF L GTV+AGIVSA+ RDI + 
Sbjct: 190 RTDLALIKVEGGSNFPFAKLADGKP-RIGDWVLAVGNPFGLGGTVTAGIVSAVGRDIGNG 248

Query: 215 P-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
           P   F QIDAP+N+GNSGGP F+  G+V+GVN  I +     +G+   IP S +K  I  
Sbjct: 249 PYDDFIQIDAPVNKGNSGGPAFDVDGNVVGVNTAIYSPSGGSVGIAFSIPASTVKSVIAQ 308

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           L   G V  GW G+  Q +TQ++A  LG++  +G+L+       PA KAG+  GDVI  +
Sbjct: 309 LKDNGSVSRGWIGVQIQPVTQDIADSLGMKKAEGALVAEPQANGPAAKAGIVSGDVITAV 368

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP----------TAKND 383
           +G+ +K  ++    I   +P   VK+++  +G + +V + LG  P             N 
Sbjct: 369 NGQPVKDARELARTIGGIAPGAAVKLNVLSKGQEKTVNLTLGKLPNTVEAKADNDNGDNS 428

Query: 384 MHLEVGDKELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
                 D   LGM +     +    K  V +  ++P  +     +G ++G  I+ V    
Sbjct: 429 SPTRGADVPKLGMTVAPASSVAGAGKDGVVVTEVDP--KSAAADRGFKEGDVILEVAGKS 486

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V+   DV   I  AK   ++SVL+++K        +   SRFV++ + K
Sbjct: 487 VTSAGDVREAINAAKADNKNSVLMRVK--------SGGQSRFVAVPLAK 527


>gi|217976384|ref|YP_002360531.1| protease Do [Methylocella silvestris BL2]
 gi|217501760|gb|ACK49169.1| protease Do [Methylocella silvestris BL2]
          Length = 524

 Score =  229 bits (585), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 138/365 (37%), Positives = 202/365 (55%), Gaps = 11/365 (3%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I+ DGY++T+NH+VE     ++   +   L A +VGTD   DLA+LK++ D  + 
Sbjct: 147 GSGFIISSDGYVVTNNHVVEKATEVTLTTDEGKTLHATVVGTDKKTDLALLKIKEDGSYP 206

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            V+F  A   RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   F QIDAP+N+GN
Sbjct: 207 HVKFSSATP-RVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDAPVNRGN 265

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP FN LG V+GVN  I +     +G+G  IP    +  I SL  KG V  GW G+  
Sbjct: 266 SGGPTFNTLGDVVGVNTAIFSPSGGSVGIGFAIPSETAQSIIASLKDKGAVARGWIGVQI 325

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           Q +T E+A  LGL+ +KG+L+      SPA +AG+K GDVI  ++G  +   +D   ++A
Sbjct: 326 QPVTDEIADSLGLKSSKGALVADAQDNSPAKEAGIKSGDVILGVNGERVDGPRDLAKKVA 385

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEV--GDKELLGMVLQ-----DIN 402
           +  P ++  +    +G++ +VAV LGS P  K          +  L G+ L+      + 
Sbjct: 386 ALGPGKKADLLYWHDGAEKTVAVKLGSLPDEKEAAKPAALQDNSALAGLGLKLAPASSVQ 445

Query: 403 DGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
                 V +  ++P  E     KG++ G  I+      VS   ++  +I  AK+  R +V
Sbjct: 446 GAGNDGVVVADIDP--EGSAAQKGLRVGDLILEAGGRAVSKPSEIAAIIADAKKDGRKAV 503

Query: 463 LLQIK 467
           LL++K
Sbjct: 504 LLRVK 508


>gi|253698882|ref|YP_003020071.1| protease Do [Geobacter sp. M21]
 gi|251773732|gb|ACT16313.1| protease Do [Geobacter sp. M21]
          Length = 457

 Score =  229 bits (584), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 158/485 (32%), Positives = 246/485 (50%), Gaps = 38/485 (7%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA 70
           +I    L   +F S+     A     + D   +  ++ P++V++       V   Q+   
Sbjct: 4   AIVARFLVLSVFLSSIFSTVAGASVLTPDFAKLAKKLKPAVVNISTSKTIAVKKRQI--- 60

Query: 71  YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
                     P ++ F++ F KFF G  P      +R + G+GF I+DDGYI+T+NH+V+
Sbjct: 61  ---------APGRDPFQEYFEKFFEG--PHQRPQKQRNL-GTGFIISDDGYIITNNHVVK 108

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
           D     V LSD  E    + G D   DLA++K+ +          D++ + VG+ V  IG
Sbjct: 109 DADEIKVKLSDGREFAGDVKGRDEKLDLALVKIDAKGHLPVAPLGDSDKMEVGDWVMAIG 168

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           NPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FN  G VIG+N  IV
Sbjct: 169 NPFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNTEGEVIGINTAIV 228

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
             GQ   G+G  IP+++ K+ +P L S G+V  GW G+  Q +T +LA   GL   KG+L
Sbjct: 229 AGGQ---GIGFAIPVNMAKEILPQLKSAGKVTRGWLGVSVQLVTPDLAKSFGLDSEKGAL 285

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +  VVKESPA+KAG+K GD+I   DG  IK   +   ++A+    ++VK+ + +EG + +
Sbjct: 286 VADVVKESPAEKAGLKGGDIILEYDGHPIKEMGELPRRVAATPVGKKVKLVVQREGRQET 345

Query: 370 VAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVR------IVALNPNREREVE 423
           + V +      K+D        + LG+ + ++     + +R      +V  +   +   +
Sbjct: 346 LQVTV---EQLKDDDQDSAVASDRLGVKVTELTPERAQQLRVQGDKGVVVTDVEPDSLAD 402

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
             GIQ+G  I  +N   VS + D  +LI  AK+     +LL+            + S FV
Sbjct: 403 RAGIQEGDLIREINGVRVSGVSDYSKLIAAAKKGGYLKMLLR----------RGDASLFV 452

Query: 484 SLKID 488
           +L+++
Sbjct: 453 ALRLE 457


>gi|288941446|ref|YP_003443686.1| protease Do [Allochromatium vinosum DSM 180]
 gi|288896818|gb|ADC62654.1| protease Do [Allochromatium vinosum DSM 180]
          Length = 474

 Score =  229 bits (583), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 148/491 (30%), Positives = 246/491 (50%), Gaps = 28/491 (5%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           ++ + T +LT  +     L +   L     D   ++A   P++V++    K+  S+ Q  
Sbjct: 1   MRPLSTPSLTRAVLLGCLLAVGPALGRDLPDFTRLVAENGPAVVNIST--KQSSSITQRL 58

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
             Y   NLPE  PL++ FR     FF  E PI  ++++    GSGFF++ DGY+LT++H+
Sbjct: 59  QPYSIPNLPEGSPLEDLFRH----FFDEEGPIPDESLQARSLGSGFFVSGDGYVLTNSHV 114

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           VE      V  SD  E  A+L+GTD   D+A+LKV+++            +++VGE V  
Sbjct: 115 VEGAEEIIVRTSDRREFVARLIGTDKRSDIALLKVEAE-GLPAARIGSGKDLQVGEWVLA 173

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IG+PF    + +AGIVSA  R +P      F Q D  IN GNSGGP FN  G V+GVN+ 
Sbjct: 174 IGSPFGFESSATAGIVSAKGRSLPSENYVPFIQTDVAINPGNSGGPLFNLDGEVVGVNSQ 233

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I +     MG+   IP+ +    +  L +KGRV  GW G++ Q++T+ELA   G+   +G
Sbjct: 234 IYSRTGGFMGLSFAIPIEVAMDVVEQLKTKGRVSRGWLGVLIQDVTRELAESFGMSQPRG 293

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+  V+ +SPA  AG++ GDVI   +GR + +       + +    E   + + + G +
Sbjct: 294 ALVAQVLPDSPAATAGLQPGDVILSYNGRDVPTSSSLPPLVGATPVGESAGLVVLRRGER 353

Query: 368 HSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLVRI----VALNPNR 418
             + + +   P   + +  E G     +   LG+V++D+    +    I    V +    
Sbjct: 354 IELTIKIQELPE-DDQLAAEPGPTDKPEANRLGVVVRDLTPEMRHQFEIEQGGVLIESVD 412

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
           +    + G+  G  I+ ++   V  + D ER++G  +  +  +VL        +Q G+  
Sbjct: 413 QGPAASAGLNAGDVILMLDNQPVGNLADFERILGAIEPGRATAVL--------VQRGDTR 464

Query: 479 MSRFVSLKIDK 489
           M  F +LK+ K
Sbjct: 465 M--FYALKLPK 473


>gi|224825658|ref|ZP_03698762.1| protease Do [Lutiella nitroferrum 2002]
 gi|224601882|gb|EEG08061.1| protease Do [Lutiella nitroferrum 2002]
          Length = 508

 Score =  229 bits (583), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 147/429 (34%), Positives = 224/429 (52%), Gaps = 23/429 (5%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   ++ R  P++V++      K+      N   F  +PED PL ++FR+    F   + 
Sbjct: 68  DFTQLVERDGPAVVNIQA---NKLEAAAAQNELPF-PIPEDDPLYDFFRR----FMPNQP 119

Query: 99  PILSDT-VERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
           P    T  E + FGSGF I+DDGYILT+ H+V  G+   V+++D  EL AKLVG D   D
Sbjct: 120 PQQDQTPSESVSFGSGFIISDDGYILTNAHVVAGGSQIKVVMTDKRELKAKLVGLDKRTD 179

Query: 158 LAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG 216
           +AVLKV++    +PV +  D   ++VGE V  IG PF    TV+AGIVSA  R +PD   
Sbjct: 180 VAVLKVEA--AGLPVAKIGDPAKLKVGEWVAAIGAPFGFDNTVTAGIVSAKGRSLPDENY 237

Query: 217 T-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q D  IN GNSGGP FN  G V+G+N+ I +     MG+   IP+ I       + 
Sbjct: 238 VPFIQTDVAINPGNSGGPLFNLRGEVVGINSQIYSRSGGFMGISFAIPIDIAINVAEQIK 297

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
           +KG+V  G  G+  Q ++QELA   GL+   G+L+  V    PA KAG++VGD+I  ++G
Sbjct: 298 TKGKVSRGQLGVHIQEVSQELAQSFGLKQPNGALVVRVEPNGPAAKAGLQVGDIILHMNG 357

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDK 391
           ++++S +D    +    P  ++K+ + ++G++  V VVLG     +  A      E   +
Sbjct: 358 KLVESSKDLPILVGGLQPGAKIKLGVWRKGAEKDVPVVLGELANEAANAPQPQQEEPAPQ 417

Query: 392 EL----LGMVLQDINDGNKKLVRIVA--LNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
                 LG+ L ++    K  + +    L    +      G+Q G  I+ +N  +V  +K
Sbjct: 418 SFQFNKLGLTLTELTAAQKTELGLPGGLLIQKAQGPAARAGLQHGDIIIGLNQSQVLDVK 477

Query: 446 DVERLIGKA 454
             ER +  A
Sbjct: 478 GFERALANA 486


>gi|225630545|ref|YP_002727336.1| Trypsin-like serine protease [Wolbachia sp. wRi]
 gi|225592526|gb|ACN95545.1| Trypsin-like serine protease [Wolbachia sp. wRi]
          Length = 494

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 136/410 (33%), Positives = 230/410 (56%), Gaps = 20/410 (4%)

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
           F +FF    P ++  V  ++ GSGF I   G I+T+ H++++    +V ++D+T   A++
Sbjct: 95  FDQFFMDRGPSVNKEV--VLLGSGFIIDKGGTIVTNYHVIKNAKDITVTMNDNTYFKAEV 152

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           +G DA  DLAVLK+ SD+    V F D++  RVG+ V  IGNPF L G+VS GI+SA  R
Sbjct: 153 LGYDARTDLAVLKINSDKDLSSVAFGDSDKARVGDTVMAIGNPFGLGGSVSTGIISARSR 212

Query: 210 DIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF--HMGVGLIIPLSI 266
           DI       F Q DA IN+GNSGGP F+  G VIG+N  I +  +   ++G+G  IP ++
Sbjct: 213 DISIGTMNEFIQTDAAINRGNSGGPLFDLNGKVIGINTAIYSPSESGGNVGIGFAIPSNL 272

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
               I +L S  ++ HGW G+  Q +T+E A  LGL+  KG+L+ ++VK+SPA+K G+KV
Sbjct: 273 AMSIIDTLKSGKKIKHGWLGVQVQPITKEFAESLGLKDIKGALVASIVKDSPAEKGGIKV 332

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL 386
           GD++   DG+ I         ++   P+++V++ L ++  + ++ VV+G S     D + 
Sbjct: 333 GDILLEFDGKKIDRMTQLPQMVSRAGPEKKVQVKLLRKSKEVNIKVVIGESTNDGQDNNQ 392

Query: 387 EVGDKE---LLGMVLQDINDGNKK---LVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
           E        + G+ + ++   +K+      ++  N +       +GI+KG  I+ ++  +
Sbjct: 393 EENKSTSDYVTGLTVSNLPKESKESNPTKGVIVTNVDSNSNATLRGIKKGDIIIQLDGTD 452

Query: 441 VSCIKDVERLIGKA-KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +    D ++ +  A K+  +DS++L I      ++GN     F S+K+ K
Sbjct: 453 IENTNDFQKQVDSAVKKNGKDSIMLLI-----YRNGN---QFFTSIKLKK 494


>gi|111073596|emb|CAL29442.1| Probable serine protease, HtrA [Wolbachia endosymbiont of
           Onchocerca volvulus]
          Length = 492

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 132/394 (33%), Positives = 228/394 (57%), Gaps = 14/394 (3%)

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           F + F +FF  + P ++   E ++ GSGF I   G I+T+ H+++D    +V ++DDT  
Sbjct: 88  FFEYFDQFFMDKSPSINR--EAVLLGSGFIIDKSGIIVTNYHVIKDAQHITVTMNDDTYF 145

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            A+++G DA  DLAVLK+++D+ F  V   +++  RVG+ V  IGNPF L G+VS GI+S
Sbjct: 146 KAEVLGYDAKTDLAVLKIKADKDFSFVTLGNSDEARVGDMVMAIGNPFGLGGSVSTGIIS 205

Query: 206 ALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF--HMGVGLII 262
           A  RDI       F Q DA IN+GNSGGP F+  G VIG+N  I +  +   ++G+G  I
Sbjct: 206 ARSRDISIGTMNEFIQTDAAINRGNSGGPLFDLNGKVIGINTAIYSPSESGGNVGIGFAI 265

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P ++    I  L +  +V HGW G+  Q +T E A  LGL+ TKG+L+ ++VK+SPA+K 
Sbjct: 266 PSNLAIPVIDKLKNGKKVKHGWLGVQVQRITVEFAESLGLKDTKGALVASIVKDSPAEKG 325

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRS-PKEQVKISLCKEGSKHSVAVVLGSSPTAK 381
           G+KVGDV+   DG+I+      + QI SR+ P ++V+I L ++G + ++ V++G S    
Sbjct: 326 GIKVGDVLLEFDGKIVDRMAQ-LPQIVSRTEPGKKVQIKLLRKGKEVNIKVIVGESTNDN 384

Query: 382 NDMHLEVG---DKELLGMVL----QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIV 434
            D++ +        + G+ +    +++ +GN  +  +V  + +  +    + +++G  I 
Sbjct: 385 QDINQKENASTSDYITGLTISNLSRELKEGNASIKGVVITSVDIYKNPTLRDLKRGDIIT 444

Query: 435 SVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
            +N  ++  ++  +  +  AK++     ++ + Y
Sbjct: 445 QINDADIENVESFQNQVNLAKKQDSKKAIMLLVY 478


>gi|114798730|ref|YP_760031.1| Do family protease [Hyphomonas neptunium ATCC 15444]
 gi|114738904|gb|ABI77029.1| protease, Do family [Hyphomonas neptunium ATCC 15444]
          Length = 512

 Score =  228 bits (581), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 162/510 (31%), Positives = 251/510 (49%), Gaps = 67/510 (13%)

Query: 7   LSVKSICTVALTCVIFSST-----YLVLEAKLPPSSVDLPP--------VIARVSPSIVS 53
           +S +++   A   VI          +  EA   P ++  PP        +I +V P++VS
Sbjct: 6   ISAQALVAAAFGAVIMGGAISVPKLIAPEAGAQPIAIQAPPGAPLSFADLIEKVEPAVVS 65

Query: 54  VMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFR--KDFHKFFSGEEPILSDTV---ERL 108
           V V   ++V           G++P        FR      +FF  + P   +T    E  
Sbjct: 66  VNVIATQEV-----------GSVPGIEEFFEQFRGAPGMEEFFQ-QRPAPQETPRQRESR 113

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGFFI++DG ++T++H+++      ++ SD  EL A+LVGTD   DLAV++V+   K
Sbjct: 114 SLGSGFFISEDGLVVTNHHVIDRATQIQIVTSDGKELEAELVGTDRQTDLAVVRVKEKGK 173

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGT-FTQIDAPIN 226
           +  VEF  + N+R G+ V  +GNPF L GT +AGI+SA  R++    P T F QIDAPIN
Sbjct: 174 YPHVEFGSSENVRKGDWVVALGNPFGLGGTATAGILSANGRELGAGSPYTDFIQIDAPIN 233

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
           +GNSGGP F+  G+VIGVN+ I++     +G+G  IP  + K+   +LI  GRV  GW G
Sbjct: 234 RGNSGGPTFDLRGNVIGVNSQILSPTGGSVGIGFAIPSELAKEVTDTLIKDGRVSRGWLG 293

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +   +LT E A  LG+  TKGSLI  V   SPA+KAG++  D+I  ++G+ +        
Sbjct: 294 VQIADLTPEFAEALGIADTKGSLIADVTVGSPAEKAGLRRNDIILSVNGQKVTDATSTTR 353

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSP-----TAKNDMHLEVGDKE----LLGMV 397
            +         K  + +EG + ++ V +G  P     T  N    + G  +    + G +
Sbjct: 354 IVGRLIANTANKFDIIREGKRQTINVTVGERPEDPYATPGNPGSPDAGPGDQSSGVPGAL 413

Query: 398 LQDINDGNKKLVRIVALNPN-RER------------------EVEAK-GIQKGMTIVSVN 437
           L D+       VR+V +    RER                   V AK G + G+ I+  N
Sbjct: 414 LDDLG------VRLVPMTEEIRERLALRPGDTGLAITEVTPDSVFAKAGFESGLVILESN 467

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              V  +   E+ + +A+   R  +LL ++
Sbjct: 468 GQPVPSVAAFEKTVSEARAANRSKILLAVR 497


>gi|42520671|ref|NP_966586.1| protease DO [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|42410411|gb|AAS14520.1| protease DO [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 497

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 136/413 (32%), Positives = 229/413 (55%), Gaps = 23/413 (5%)

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
           F +FF    P ++  V  ++ GSGF I   G I+T+ H++++    +V ++D+T   A++
Sbjct: 95  FDQFFMDRGPSVNKEV--VLLGSGFIIDKGGTIVTNYHVIKNAKDITVTMNDNTYFKAEV 152

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           +G DA  DLAVLK+ SD+    V F D++  RVG+ V  IGNPF L G+VS GI+SA  R
Sbjct: 153 LGYDARTDLAVLKINSDKDLSSVAFGDSDKARVGDTVMAIGNPFGLGGSVSTGIISARSR 212

Query: 210 DIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF--HMGVGLIIPLSI 266
           DI       F Q DA IN+GNSGGP F+  G VIG+N  I +  +   ++G+G  IP ++
Sbjct: 213 DISIGTMNEFIQTDAAINRGNSGGPLFDLNGKVIGINTAIYSPSESGGNVGIGFAIPSNL 272

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
               I +L S  ++ HGW G+  Q +T+E A  LGL+  KG+L+ ++VK+SPA+K G+KV
Sbjct: 273 AMSIIDTLKSGKKIKHGWLGVQVQPITKEFAESLGLKDIKGALVASIVKDSPAEKGGIKV 332

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL 386
           GD++   DG+ I         ++   P+++V++ L ++  + ++ VV+G S     D + 
Sbjct: 333 GDILLEFDGKKIDRMTQLPQMVSRAGPEKKVQVKLLRKSKEVNIKVVIGESTNDGQDNNQ 392

Query: 387 EVGDKE---LLGMVLQDI------NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVN 437
           E        + G+ + ++      +  N     ++  N +       +GI+KG  I+ ++
Sbjct: 393 EENKSTSDYVTGLTVSNLPKESKESKNNVPTKGVIVTNVDSNSNATLRGIKKGDIIIQLD 452

Query: 438 THEVSCIKDVERLIGKA-KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             ++    D ++ +  A K+  +DS++L I      ++GN     F S+K+ K
Sbjct: 453 GTDIENTNDFQKQVDSAVKKNGKDSIMLLI-----YRNGN---QFFTSIKLKK 497


>gi|188584419|ref|YP_001927864.1| protease Do [Methylobacterium populi BJ001]
 gi|179347917|gb|ACB83329.1| protease Do [Methylobacterium populi BJ001]
          Length = 501

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 161/474 (33%), Positives = 239/474 (50%), Gaps = 19/474 (4%)

Query: 25  TYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
            Y     K P  + + PP     V+ +V P +V+V V  K   S     ++ G  NL + 
Sbjct: 35  AYAQALPKTPIEAPEHPPGSFANVVDKVKPGVVAVKV--KLDNSAGDDDDSSGNPNLQQV 92

Query: 80  HPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
            P    F K F +   G   +     ER   GSGF I+ DGY++T+NH+V+   +  V L
Sbjct: 93  PPQLREFFKRFGQGGPGGRGMPQQRGERGAVGSGFIISADGYVVTNNHVVDHAKTVQVTL 152

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
            D   L AK++G D   D+A+LK+     +  V+F      RVG+ V  IGNPF L GTV
Sbjct: 153 DDGRTLDAKVIGKDPKTDIALLKITESGSYPYVQFGKGAP-RVGDWVVAIGNPFGLGGTV 211

Query: 200 SAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+GVN  I +     +G+
Sbjct: 212 TAGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGVNTAIASPSGGSVGL 271

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP   ++  +  L + G+V  G+ G+  Q +T+++A  LGL   KG+L+      +P
Sbjct: 272 AFAIPAETVQTVVDQLRTDGKVVRGYLGVQVQPVTKDIAEGLGLDKAKGALVDHAENGTP 331

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  +   +D   +IA   P  +VK++  + G      V LG+ P
Sbjct: 332 AAKAGLKSGDVIESVNGAPVNDARDLSRRIAGLKPGTEVKLAYLRGGKSDIATVELGTLP 391

Query: 379 TAKNDMHL---EVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVS 435
           T      L     G +  LG+ L   ND       +  ++ + +    AKGI +G  I+ 
Sbjct: 392 TDGKVASLGDGASGGQPRLGLSLAPANDVGLGDEGVAVMDVDPDGPAAAKGIAQGDVILD 451

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V    V+   DV+  I  A+   R +VL+++K        +   +RFV++ + K
Sbjct: 452 VAGTSVAKPSDVQAQIRAAESNGRKAVLMRVKS-------SKGQTRFVAVALGK 498


>gi|83593536|ref|YP_427288.1| peptidase S1C, Do [Rhodospirillum rubrum ATCC 11170]
 gi|83576450|gb|ABC23001.1| Peptidase S1C, Do [Rhodospirillum rubrum ATCC 11170]
          Length = 508

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 209/378 (55%), Gaps = 20/378 (5%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF +   GYI+T+NH+++D    +VIL DDT + A+LVG D   D+A+L++++D+  
Sbjct: 115 LGSGFIVDAAGYIVTNNHVIQDADEITVILHDDTAIKAELVGKDEKTDVALLRIKTDKPL 174

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
             V + ++   RVG+ V  IGNPF L GTV+AGI+SA  RDI   P  +F Q DA IN+G
Sbjct: 175 TAVPWGNSEAARVGDWVMAIGNPFGLGGTVTAGIISAKTRDINAGPYDSFIQTDAAINKG 234

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G VIG+N  I +     +G+G  +P ++  + I  +   GR   GW G+ 
Sbjct: 235 NSGGPLFNMHGEVIGINTAIFSPSGGSIGIGFSVPSNLAHQVIDDIKKFGRTRRGWIGVR 294

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q++T E+A  LGL  + G+LI AV    PA  AG+KVGDVI   DGR +   +     +
Sbjct: 295 IQSVTDEIAEGLGLEKSAGALIAAVTPGGPAAAAGLKVGDVIVSFDGRPVPDMRTLPRIV 354

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE------VGDKE------LLGM 396
           A     +   I + +EG +  + + +G    A+++  L       V D +       +G+
Sbjct: 355 AETEIGKDAAIGVWREGKRQDLKMKVGELEVAEDEGLLNEPETSGVTDSQGGTAVATIGL 414

Query: 397 VLQDINDG-------NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
            +  ++D        +     +V  +   E + + KG++ G  IV +N  EV+  +DV +
Sbjct: 415 TVTKLDDRLRSQFGFDAASEGVVVTDVTNESDAQEKGLEPGTLIVKINQTEVASPEDVVK 474

Query: 450 LIGKAKEKKRDSVLLQIK 467
            + KAK++ R +VLL ++
Sbjct: 475 AVAKAKDEGRKTVLLLVE 492


>gi|260460969|ref|ZP_05809218.1| protease Do [Mesorhizobium opportunistum WSM2075]
 gi|259033003|gb|EEW34265.1| protease Do [Mesorhizobium opportunistum WSM2075]
          Length = 513

 Score =  227 bits (578), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 153/447 (34%), Positives = 231/447 (51%), Gaps = 28/447 (6%)

Query: 42  PVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDF--HKFFSGEEP 99
           PV+A   P++V+V      K   E M  A  F    ++ P  +YFR+ F          P
Sbjct: 59  PVVAATKPAVVTVTTV--MKAQPEAMNEASPF---QDNSPFDDYFRQFFGDQGMPMPRTP 113

Query: 100 ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
                      GSGF +  DG I+T+NH+V+  +S  V L D TELPAK+VG+DA  DLA
Sbjct: 114 PQQQAPRTEALGSGFIVGADGTIVTNNHVVDGASSIKVTLDDGTELPAKVVGSDAKNDLA 173

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTF 218
           VLK+++ +    V++ D++ +  G+ V  IGNPF +  TVSAGIVSA  RD+   P   F
Sbjct: 174 VLKIKASKPLPTVKWGDSDRLMTGDQVLAIGNPFGIGTTVSAGIVSARGRDLHSGPFDDF 233

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            QIDAPIN GNSGGP  +  G+VIG+N  I +     +GVG  IP    +K +  L   G
Sbjct: 234 IQIDAPINHGNSGGPLVDVNGNVIGINTAIYSPNGGSVGVGFAIPSDQAQKVVAKLEKGG 293

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
            + +G+ G+  Q +T ++A  +GL    G+L++ V   SPA  AG++ GDVI    G+ +
Sbjct: 294 SIQYGYLGVDIQPVTPDVASAMGLDHPGGALVSQVNDGSPAALAGVETGDVITGFAGQDV 353

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDKE-- 392
           K  +D    +A  +P  +  + + ++G    ++V +G     + TA        G ++  
Sbjct: 354 KDPKDLSRAVADVAPGTRETLDVWRKGKAMKISVDVGRNSDDAKTASTGGSGAPGAEQGS 413

Query: 393 ---LLGMVLQDIND---------GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
               LG+ L DI            N++   +  +NP  ++   A GIQ G  IV+VN   
Sbjct: 414 GAPALGLGLMDITPDIRQQMNLADNERGAVVARVNP--DKAAAAAGIQPGDIIVAVNQVP 471

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIK 467
           V   K V + + +A +  R SVLL ++
Sbjct: 472 VKSAKQVTQAVAQAGKSGRKSVLLLVE 498


>gi|85858210|ref|YP_460412.1| trypsin-like serine protease [Syntrophus aciditrophicus SB]
 gi|85721301|gb|ABC76244.1| trypsin-like serine protease [Syntrophus aciditrophicus SB]
          Length = 506

 Score =  227 bits (578), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 135/400 (33%), Positives = 222/400 (55%), Gaps = 24/400 (6%)

Query: 79  DHPLKNYFRKD--FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           + P   +F  D  F +FF   + +    +++   GSGF I+ DGYI T+NH+VE      
Sbjct: 90  ETPFDRFFGSDEFFRRFF---DDLPERELKQRSLGSGFIISSDGYIFTNNHVVEKADKIR 146

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V LS   E  A++ G D+  D+A++K+++DR    V   +++ +RVGE VF IGNPF L 
Sbjct: 147 VKLSSGKEYDAEVKGRDSNTDIALIKIKADRVLPVVTLGNSDKLRVGEWVFAIGNPFGLD 206

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
            TV+AGI+SA  R I   P   F Q DA IN GNSGGP FN  G V+G+N  IV  GQ  
Sbjct: 207 HTVTAGIISAKGRVIGAGPYDNFLQTDASINPGNSGGPLFNMAGEVVGINTAIVAQGQ-- 264

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
            G+G  IP+++ ++ +  L + GRV  GW GI  Q++T+E++  L L+ ++G+L++ V++
Sbjct: 265 -GIGFAIPINMAREILEDLKTSGRVTRGWLGITVQDITEEISANLKLKNSQGALVSQVLE 323

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             P DKAGMK GD+I  +DG+ + S +D +  +A+    ++V++   ++G + +++ V+G
Sbjct: 324 GEPGDKAGMKAGDIIIGIDGKPVTSTKDLLKIVAALKVGKKVQVRTLRDGREMTLSAVIG 383

Query: 376 SSPTAKNDMHLEVGDKE----LLGMVLQDI------NDGNKKLVRIVALNPNREREVEAK 425
               A+     E+  KE     LGM +Q++      N G K    ++          +  
Sbjct: 384 ERKDAR-----EIAAKEPVHQQLGMTVQEVTPEIARNLGRKVQGGVIITRIRPGSAADDA 438

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
           G++    I+ +N   +  +KD +  + +  E     +L+Q
Sbjct: 439 GLKIQDIILQINRARIRTLKDYQNALSRGPENNTWLLLVQ 478


>gi|260575476|ref|ZP_05843475.1| protease Do [Rhodobacter sp. SW2]
 gi|259022396|gb|EEW25693.1| protease Do [Rhodobacter sp. SW2]
          Length = 493

 Score =  226 bits (577), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 160/494 (32%), Positives = 255/494 (51%), Gaps = 44/494 (8%)

Query: 15  VALTCVIFSSTYLVLEA---KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           +ALT  I  +   V +A    +P S  DL     ++SPS+V++               A 
Sbjct: 24  LALTLGIGLALAQVSQAVAQTMPDSFADL---AEKISPSVVNITTSS---------VVAG 71

Query: 72  GFGN---LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
           G G+   LP+  P +++F KDF        P      E L  GSGF +++DG+I+T+NH+
Sbjct: 72  GMGDGPTLPDGSPFQDFF-KDFMDRNGNGGPAEPRRSEAL--GSGFVVSEDGFIVTNNHV 128

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           +E      +       L AKLVGTD   D+A+LKV+SD+    V F D++ +RVG+ V  
Sbjct: 129 IEGADDIEIEFFSGDRLKAKLVGTDTKTDIALLKVESDKPLPFVTFGDSDLMRVGDWVVA 188

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           +GNP     +VSAGIVSA +R I      F Q DA IN+GNSGGP FN  G V+GVN  I
Sbjct: 189 MGNPLGQGFSVSAGIVSARNRAISGAFDDFIQTDAAINRGNSGGPLFNMDGQVVGVNTAI 248

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           ++     +G+G  +  +++   +  L   G    GW G+  Q++T ++A  +GL  +KG+
Sbjct: 249 MSPNGGSIGIGFSMASNVVSDVVDQLREFGETRRGWLGVRIQDVTPDVAEAMGLTASKGA 308

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           LIT  V + PA  AGM  GDVI   DG+ +   +D V ++A     + V + + +EG+  
Sbjct: 309 LITD-VPDGPAKDAGMLSGDVIVTFDGKEVADTRDLVRRVAGAPVGQAVSVVVLREGASQ 367

Query: 369 SVAVVLGSSPTAKNDMHL-------EVGDKELLGMVLQDINDGN-------KKLVRIVAL 414
           +++V LG   TA+ +  +       E    ELLG+ + +++  +       K    +V  
Sbjct: 368 TLSVTLGRRETAEGEETVTPAATPAEPAKGELLGLTVAELSPSDAEGLGLPKGSEGLVIT 427

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           + +   E   KG+++G  I      +V  ++D++  + +AK+  R S+LL I+ D D   
Sbjct: 428 DVDVNAEAYEKGLRQGDLITEAGQQKVLKVQDLKDRVTEAKDAGRKSLLLLIRRDGD--- 484

Query: 475 GNDNMSRFVSLKID 488
                 RFV+L ++
Sbjct: 485 -----PRFVALSLE 493


>gi|225677239|ref|ZP_03788231.1| protease DO [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225590723|gb|EEH11958.1| protease DO [Wolbachia endosymbiont of Muscidifurax uniraptor]
          Length = 497

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 136/413 (32%), Positives = 228/413 (55%), Gaps = 23/413 (5%)

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
           F +FF    P ++  V  ++ GSGF I   G I+T+ H++++    +V ++D+T   A++
Sbjct: 95  FDQFFMDRGPSVNKEV--VLLGSGFIIDKGGTIVTNYHVIKNAKDITVTMNDNTYFKAEV 152

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           +G DA  DLAVLK+ SD+    V F D++  RVG+ V  IGNPF L  +VS GI+SA  R
Sbjct: 153 LGYDARTDLAVLKINSDKDLSSVAFGDSDKARVGDTVMAIGNPFGLGSSVSTGIISARSR 212

Query: 210 DIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF--HMGVGLIIPLSI 266
           DI       F Q DA IN+GNSGGP F+  G VIG+N  I +  +   ++G+G  IP ++
Sbjct: 213 DISIGTMNEFIQTDAAINRGNSGGPLFDLNGKVIGINTAIYSPSESGGNVGIGFAIPSNL 272

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
               I +L S  ++ HGW G+  Q +T+E A  LGL+  KG+L+ +VVK+SPA+K G+KV
Sbjct: 273 AMSIIDTLKSGKKIKHGWLGVQVQPITKEFAESLGLKDIKGALVASVVKDSPAEKGGIKV 332

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL 386
           GD++   DG+ I         ++   P+++V++ L ++  + ++ VV+G S     D + 
Sbjct: 333 GDILLEFDGKKIDRMTQLPQMVSRAGPEKKVQVKLLRKSKEVNIKVVIGESTNDGQDNNQ 392

Query: 387 EVGDKE---LLGMVLQDI------NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVN 437
           E        + G+ + ++      +  N     ++  N +       +GI+KG  I+ ++
Sbjct: 393 EENKSTSDYVTGLTVSNLPKESKESKNNVPTKGVIVTNVDSNSNATLRGIKKGDIIIQLD 452

Query: 438 THEVSCIKDVERLIGKA-KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             ++    D ++ +  A K+  +DS++L I      ++GN     F S+K+ K
Sbjct: 453 GTDIENTNDFQKQVDLAVKKNGKDSIMLLI-----YRNGN---QFFASIKLKK 497


>gi|227819134|ref|YP_002823105.1| serine protease do-like precursor [Sinorhizobium fredii NGR234]
 gi|227338133|gb|ACP22352.1| putative serine protease do-like precursor [Sinorhizobium fredii
           NGR234]
          Length = 493

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 163/487 (33%), Positives = 238/487 (48%), Gaps = 56/487 (11%)

Query: 18  TCVIFSSTYLVLEAKLPPSSV---DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           T    S+      A  PPS+    D   ++ARV P+++SV VE         +  A    
Sbjct: 43  TTGTGSTVRAATNAVQPPSAAEPGDFADIVARVKPAVISVRVE---------LDGAQQQA 93

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFG--SGFFITDDGYILTSNHIVEDG 132
           +  ED    +                  D  + +M G  SGFFI+ DGY +T+NH+V+  
Sbjct: 94  SSDEDDGTPD-----------------PDAGQGVMMGEGSGFFISADGYAVTNNHVVDHA 136

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
            +  V+ SD     A +VGTD   DLA++KV   R    V F D    RVG  V  IGNP
Sbjct: 137 KTLEVMTSDGRSYDATVVGTDPKTDLALIKVDG-RDLPHVRFAD-RRPRVGNWVIAIGNP 194

Query: 193 FRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           + L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP F+  G VIGVN  I + 
Sbjct: 195 YGLGGTVTAGIVSAEGRDIGAGPYDDFIQIDAPINRGNSGGPAFDVNGDVIGVNTAIFSP 254

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+G  IP    K  I  L  KG V  GW GI  Q +T ++A  LGL+  KG+L+ 
Sbjct: 255 SGGSVGIGFDIPADTAKAVIAELKDKGHVTRGWLGIKEQQVTADIAEGLGLKEAKGALVD 314

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
                 PA +AG++ GD+I  LDG  I   ++   ++ + +P   V +S+ + G+   ++
Sbjct: 315 EADPAGPAGRAGIRSGDLIIALDGATINDPRELAQRVGAMAPGTSVTVSILRNGAPKDLS 374

Query: 372 VVLGSSP-------TAKNDMHLEVGDKELLGMVLQD----INDGNKKLVRIVALNPNRER 420
             L + P          +D       ++  G++L         G K +V +VA+NP  + 
Sbjct: 375 FSLATMPEESPAPVETASDASAAPTSEQGFGLLLAPATKVAGSGGKGMV-VVAINP--KG 431

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
                G++ G  I+ V    VS  +D  R +   +++ R + LL+I      QSG  + +
Sbjct: 432 AAAQHGLEAGDVILDVGGKAVSSARDFRRDLASLRKEGRAAALLRI------QSG--DTT 483

Query: 481 RFVSLKI 487
           RFV+L +
Sbjct: 484 RFVALPL 490


>gi|322417815|ref|YP_004197038.1| protease Do [Geobacter sp. M18]
 gi|320124202|gb|ADW11762.1| protease Do [Geobacter sp. M18]
          Length = 458

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 154/485 (31%), Positives = 243/485 (50%), Gaps = 37/485 (7%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA 70
           +I    L   +F S+     A     + D   +  R+ P++V++       +   Q+   
Sbjct: 4   AIVARFLVFSLFLSSIFSTVAGAATLTPDFAKLAKRLKPAVVNISTSKTIGMKKRQL--- 60

Query: 71  YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
                 P   P + YF     KFF  E P      +R M GSGF I+DDGY++T+NH+V+
Sbjct: 61  -----APGGDPFQEYF----EKFF--ESPRQHPYKQRSM-GSGFIISDDGYLITNNHVVK 108

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
           +     V LSD  E   ++ G D   DLA++K+ +          D++ + VG+ V  IG
Sbjct: 109 EADEIKVKLSDGREFKGEVKGRDEKLDLALIKIDAKGHLPVAPLGDSDKMEVGDWVMAIG 168

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           NPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FN  G VIG+N  IV
Sbjct: 169 NPFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNTDGEVIGINTAIV 228

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
             GQ   G+G  IP+++ K+ +P L   G+V  GW G+  Q +TQ+LA   G+   +G+L
Sbjct: 229 AGGQ---GIGFAIPVNMAKEILPQLKESGKVIRGWLGVSVQLVTQDLANSFGMDSERGAL 285

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +  V KESPA+KAG+K GD+I   DG  IK   +   ++A+    ++VK+ + ++G +  
Sbjct: 286 VAEVAKESPAEKAGIKGGDIILEYDGHPIKDMGELPRRVAATPVGKKVKMVVLRDGKQVP 345

Query: 370 VAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVR------IVALNPNREREVE 423
           + V +      +++     GD+  LG+ + D+     + +R      ++ ++   E   E
Sbjct: 346 LQVTIEKLKEGEDEDAAVTGDR--LGLKVIDLTPERAQQLRLQGEKGVLVVDVQPESIAE 403

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
             GI  G  I  +N   ++ +KD  ++I   K+     +LL+              S FV
Sbjct: 404 RAGIVDGDLIREINGVRITSVKDYSKVIAGVKKGGYLKMLLK----------RGEASLFV 453

Query: 484 SLKID 488
           +L++D
Sbjct: 454 ALRLD 458


>gi|75675388|ref|YP_317809.1| peptidase S1C, Do [Nitrobacter winogradskyi Nb-255]
 gi|74420258|gb|ABA04457.1| peptidase S1C, Do [Nitrobacter winogradskyi Nb-255]
          Length = 516

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 147/463 (31%), Positives = 237/463 (51%), Gaps = 35/463 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV +  K +       + +  G+     P++ +FR+     F G + +  
Sbjct: 72  IVERVKPSVISVKIRMKDRAVASGDDSPFQPGS-----PMERFFRR-----FGGPDGLPP 121

Query: 103 DTVER------LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
               R         GSGFFI+ DGY +T+NH+V+      V   D     AK++G D   
Sbjct: 122 GMRGRRGPGLVTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYTAKVIGADPRT 181

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP- 215
           D+A++KV+    F   +  D + +R+G+ V  +GNPF L G+V+AGIVSA  RDI   P 
Sbjct: 182 DIALIKVEGGSSFPFAKLSD-DKVRIGDWVLAVGNPFGLGGSVTAGIVSASGRDIGTGPY 240

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F QIDAP+N+GNSGGP FN  G VIGVN  I +     +G+   IP + +K  +  L 
Sbjct: 241 DDFIQIDAPVNKGNSGGPAFNMKGDVIGVNTAIYSPSGGSVGIAFSIPANTVKSVVAQLK 300

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
            KG V  GW G+  Q +T ++A  LGL+  +G+L+      SPA KAG+K GDVI  ++G
Sbjct: 301 DKGSVSRGWIGVQIQPVTSDIADSLGLKKAEGALVAEPQANSPAAKAGIKSGDVITAVNG 360

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP---TAKNDMHLEVG--- 389
             +K  ++    I S +P   +K+++ ++G+   V + LG+ P    A+ D + + G   
Sbjct: 361 DPVKDARELARTIGSLAPGTSIKLNVLRKGTDKVVNLTLGTLPDTVEARADHYGDRGSSR 420

Query: 390 --DKELLGMVLQDINDGNKKLVRIVALNPNREREVEA-KGIQKGMTIVSVNTHEVSCIKD 446
             D   LG+ +             V +     +   A +G ++G  I+ V    VS   D
Sbjct: 421 DNDIPRLGLTVAPAGSVAGAGGEGVVVVDVDPKSPAAERGFREGDVILEVAGKSVSSSAD 480

Query: 447 VERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +   I  A+ + ++SVL++++          + +RFV++ I K
Sbjct: 481 IREAIKAARAEDKNSVLMRVR--------TGSTARFVAMPIAK 515


>gi|115523952|ref|YP_780863.1| protease Do [Rhodopseudomonas palustris BisA53]
 gi|115517899|gb|ABJ05883.1| protease Do [Rhodopseudomonas palustris BisA53]
          Length = 528

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 153/467 (32%), Positives = 232/467 (49%), Gaps = 37/467 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV ++   +       N       P   P++ +FR+     F G + +  
Sbjct: 78  IVERVKPSVISVKIKINDRSDRSDSANNEDSPFQP-GSPMERFFRR-----FGGPDGMPP 131

Query: 103 DTVERLMF-------GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
                          GSGF I+ DGY +T+NH+V+      V   D     AK++GTDA 
Sbjct: 132 GQRGHRGGRGVVTGQGSGFLISPDGYAVTNNHVVDGADKVEVTFDDGKNYTAKVIGTDAR 191

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            DLA++K++    F P         R+G+ V  +GNPF L GTV+AGIVSA  RDI   P
Sbjct: 192 TDLALIKIEGGSNF-PFAKLSEGKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGSGP 250

Query: 216 -GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F QIDAP+N+GNSGGP FN  G VIGVN  I +     +G+   IP + +K  I  L
Sbjct: 251 YDDFIQIDAPVNKGNSGGPAFNVEGEVIGVNTAIYSPSGGSVGIAFSIPSNTVKTVIEQL 310

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
             KG V  GW G+  Q +TQE+A  LGL+   G+L+     + PA KAG++ GDVI  ++
Sbjct: 311 KDKGSVSRGWIGVQIQPVTQEIADSLGLKKADGALVAEPQADGPAAKAGIESGDVITAVN 370

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP---TAKNDM-HLEVGD 390
           G  +K  ++    I   +P   VK+++  +G    V + LG  P    AK D+   + GD
Sbjct: 371 GEPVKDARELARTIGGFAPGNSVKLNIIHKGQDKVVNLTLGQLPNQVNAKADLGRGDYGD 430

Query: 391 KE-----LLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
                   LGM +     +    K+ V +  ++P  +     +G ++G  I+ V    V+
Sbjct: 431 STRSDLPRLGMTVAPAASVAGAGKEGVVVTDVDP--KGAAADRGFKEGDVILEVGGKSVA 488

Query: 443 CIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              DV   +  AK   ++SVLL+++        +   SRFV++ + K
Sbjct: 489 SPGDVRDALAAAKTDNKNSVLLRVR--------SGGSSRFVAIPLAK 527


>gi|86748144|ref|YP_484640.1| peptidase S1C, Do [Rhodopseudomonas palustris HaA2]
 gi|86571172|gb|ABD05729.1| Peptidase S1C, Do [Rhodopseudomonas palustris HaA2]
          Length = 525

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 145/389 (37%), Positives = 211/389 (54%), Gaps = 21/389 (5%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGFFI+ DGY +T+ H+V+   S  V   D     AK+VGTD   DLA++KV     F 
Sbjct: 147 GSGFFISPDGYAVTNYHVVDHAKSVQVTTDDGAVHTAKVVGTDKKTDLALIKVDGKSDFT 206

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            V+F D    RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + QIDAPIN+GN
Sbjct: 207 YVKFAD-QPARVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYVQIDAPINKGN 265

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F+  G+VIGVN  I +     +G+G  IP +  K  I  L  KG V  GW G+  
Sbjct: 266 SGGPAFDTSGNVIGVNTAIYSPSGGSVGIGFDIPAATAKLVIAQLKDKGVVTRGWLGVQV 325

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           Q +T E+A  +GL+  +G+L+ +    SPA KAG+  GDVI  ++G  IK  +     I+
Sbjct: 326 QPVTAEIADSMGLKQARGALVDSPQDGSPAAKAGIAAGDVITAVNGAEIKDSRALARTIS 385

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSP--TAK----NDMHLEVGDKELLGMVL---QD 400
             +P   VK+ +  +G   +V + L   P  +AK     D   E G +  LG+ +    +
Sbjct: 386 MMAPGSAVKLDVLHKGDSKTVTLSLAEMPNESAKVADSGDAGRESG-RPYLGLRVAPASE 444

Query: 401 INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
           + D  +K V +  ++P  E     +G++ G  I+ V    V+   DV   + +A E  + 
Sbjct: 445 VGDSGQKGVVVTGVDP--EGPAADRGLRSGDVILDVGGKPVANSGDVRDALKQASEHGKK 502

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +VL+++K         D+ +RFV++ I K
Sbjct: 503 TVLMRVKT-------ADSAARFVAVPIAK 524


>gi|289522226|ref|ZP_06439080.1| protease DegQ [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289504062|gb|EFD25226.1| protease DegQ [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 440

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 224/412 (54%), Gaps = 36/412 (8%)

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
           F +FF  +    +  +     GSGF ++ DGYILT+NH++E     +V L+D  +L AK+
Sbjct: 49  FRQFFGDQWDQFTQIIPMKGKGSGFIVSKDGYILTNNHVIEGADKITVSLADGRQLDAKI 108

Query: 150 VGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALD 208
           VG D  FDLAV+KV +    +PV    D++ ++VGE V  IGNPF L  TV+ G++SA +
Sbjct: 109 VGKDPTFDLAVIKVTAGN--LPVLPLGDSDALQVGEWVVAIGNPFGLDHTVTVGVISAKN 166

Query: 209 RDIPDRPGT-----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           R I  R G      F Q DA IN GNSGGP  +  G V+G+N  I+   Q   G+G  IP
Sbjct: 167 RSI--RAGNVSFDGFLQTDAAINPGNSGGPLLDLDGKVVGINTAIIPYAQ---GIGFAIP 221

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
           +++ K  I  L+S GRV  GW G+  Q LT ++A   GL+  KG+++  VV  SPADKAG
Sbjct: 222 VNMAKSVIDDLVSYGRVRRGWLGVYVQPLTSDIAQAYGLKVEKGAVVADVVPNSPADKAG 281

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND 383
           +K G VI  +D   I + QD V+QI  R   ++VK+ +     K SV V L   P     
Sbjct: 282 IKRGVVITKVDDVEINNAQDLVFQIRKRMAGDKVKVEIATSSGKRSVTVTLEEIPGQTEA 341

Query: 384 MHLEVGD-KELLGMVL--------QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIV 434
             LEV D +E LG+ +        Q  N  ++K V +V + P      +  GI++G  I+
Sbjct: 342 PRLEVSDLEESLGIEVSPVTPALKQKYNIDSEKGVVVVRVKPGSIS--DRVGIREGDLIL 399

Query: 435 SVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
             N   +  + D++    KA ++  DSV+L +     M+ G    + FVSL+
Sbjct: 400 EANGVALKTVDDLK----KALQRNPDSVVLLV-----MREGR---TFFVSLR 439


>gi|320355419|ref|YP_004196758.1| protease Do [Desulfobulbus propionicus DSM 2032]
 gi|320123921|gb|ADW19467.1| protease Do [Desulfobulbus propionicus DSM 2032]
          Length = 490

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 156/487 (32%), Positives = 247/487 (50%), Gaps = 46/487 (9%)

Query: 9   VKSICTVALTCVI-----FSSTYLVLE---AKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
            K+I    L C+      F +++   E   A L  S+     V+ +  P++V        
Sbjct: 9   TKTILASCLLCLTLLAGGFHASHAQSEEDLALLDRSAKAFSSVVKKAGPAVV-------- 60

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMF-----GSGFF 115
            V VE+   A G G  P D     +F + F   F    P  +   ++  F     GSGF 
Sbjct: 61  HVGVEKETTARGMGQFPSDLFNDPFFERFFGPQF--RHPRTNPKQDKRTFKQEAAGSGFI 118

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EF 174
           I  DGYILT+NH+VE+ +  +V L+D  E PAK+VGTD   D+A++K+  D K +PV   
Sbjct: 119 IASDGYILTNNHVVEEASKITVRLADQREFPAKVVGTDPQSDVAIIKI--DGKNLPVLPL 176

Query: 175 EDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD---IPDRPGTFTQIDAPINQGNSG 231
            +++ + VGE V  IG+PF L  TV+ G+VSA  R+   I D    F Q DA IN GNSG
Sbjct: 177 GNSDTLEVGEWVIAIGSPFELNQTVTVGVVSAKGRNRMGITDYE-NFIQTDAAINPGNSG 235

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP  N  G  +G+N  I +    +MG+G  IP+++ K     L   G+V  GW GI+ Q+
Sbjct: 236 GPLLNIHGEAVGMNTAIFSRSGGYMGIGFAIPINMAKSIEQQLRKSGKVTRGWLGILIQD 295

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           + +E+A   G +   G+LI+ V   SPA K G++ GD+I  ++G  +    D   +IA  
Sbjct: 296 VNEEMAKSFGGKQGGGALISDVTDGSPAHKNGLQQGDIITAINGEPVTDVADLRNKIAMT 355

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL--LGMVLQDINDGNKKLV 409
            P  ++++ + ++G +  + V +G  P     +  ++G   L  LG+ LQD+    K++ 
Sbjct: 356 PPNTELRLRILRDGQEKELTVTVGEQPADMASVAKKMGGSTLSELGLSLQDL---TKEVA 412

Query: 410 RIVALNPNR-------EREVEAK--GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
                + N+       E+   A   G+Q GM I  VN   V  +K++++ + K+     +
Sbjct: 413 EQFGYSSNQGVLIADVEQGSAAAELGLQAGMLIEEVNRTRVRTLKELQQALKKSSNA--N 470

Query: 461 SVLLQIK 467
            VLL+I+
Sbjct: 471 QVLLRIR 477


>gi|84500011|ref|ZP_00998277.1| periplasmic serine protease, DO/DeqQ family protein [Oceanicola
           batsensis HTCC2597]
 gi|84391945|gb|EAQ04213.1| periplasmic serine protease, DO/DeqQ family protein [Oceanicola
           batsensis HTCC2597]
          Length = 475

 Score =  224 bits (570), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 156/508 (30%), Positives = 260/508 (51%), Gaps = 58/508 (11%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIV----SVMVEPKKK 61
           +LS +++ T+ L  ++     +   A+ P S  DL     R SPS+V    S MV  +++
Sbjct: 1   MLSPRALWTLMLATLLVLVQAVQAMAR-PESFADLAD---RFSPSVVNITTSTMVAGREQ 56

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
                     G   +PE  P +++FR+   +      P  S        GSGF I++DGY
Sbjct: 57  ----------GSPIVPEGSPFEDFFREFQDRNRGDRAPRRSSA-----LGSGFVISEDGY 101

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH++      ++   +  EL A+LVGTD   D+A+LKV++D     V F D++  R
Sbjct: 102 IVTNNHVISGADEITIEFFNGEELDAELVGTDEKTDIALLKVETDEPLPYVNFGDSDLAR 161

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHV 241
           VG+ V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G V
Sbjct: 162 VGDWVVAMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNLDGEV 221

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           IGVN  I++     +G+G  +  +++K  +  L   G    GW G+  Q++T+++A  +G
Sbjct: 222 IGVNTAILSPTGGSIGIGFSMASNVVKGVVDQLKEYGETRRGWLGVRIQDVTEDMADAMG 281

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L   +G++++  V E PA +AGMK GDVI   DG  ++  +  V Q+ +    + V++++
Sbjct: 282 LEEVRGAMVSD-VPEGPAMEAGMKAGDVITSFDGVDVEDTRGLVRQVGNTQVGKTVRVTV 340

Query: 362 CKEGSKHSVAVVLGSSPTAK----------NDMHLEVGDKELLGMVLQDINDGNKKLVRI 411
            ++G   ++ V LG    A+           D  +E   K+L+GM L  +    + L   
Sbjct: 341 WRDGETETLRVTLGRREEAEAQAVPAAQPGGDEPME---KDLMGMSLSAV---TEDLAGQ 394

Query: 412 VALNPNRE----REVE------AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + L+ + E    R+V+       KG++ G  I      +++ I D+E  +  A++  R S
Sbjct: 395 LGLDADAEGLVVRDVDQASDAYEKGLRAGDLITEAGQQQIATIGDLEERVAAARDAGRKS 454

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +LL I+ + +         RFV+L I +
Sbjct: 455 ILLLIRREGE--------PRFVALPISE 474


>gi|78224552|ref|YP_386299.1| peptidase S1C, Do [Geobacter metallireducens GS-15]
 gi|78195807|gb|ABB33574.1| Peptidase S1C, Do [Geobacter metallireducens GS-15]
          Length = 464

 Score =  224 bits (570), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 154/456 (33%), Positives = 221/456 (48%), Gaps = 54/456 (11%)

Query: 20  VIFSSTYLVLEAKLPPSSVDLPPVI---ARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           ++F++   VL     P+ V  P  +    ++ P++V++      K    Q      F   
Sbjct: 12  IVFAACLAVLAVGESPAKVLTPDFVDLAEKLKPTVVNIST---TKTLTPQ------FRMR 62

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
            +  P  + F+  F  FF  EE       ER + GSGF I+  G+I+T+NH++       
Sbjct: 63  RQPSPFPDPFQDFFEHFF--EEMPRRPQRERSL-GSGFIISKQGFIITNNHVIAGADEIK 119

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V LSD  E  A++ G+D   DLA++K+ +       E  D+  I+VGE V  IGNPF L 
Sbjct: 120 VRLSDGREFKAEVKGSDEKLDLALIKIDAKENLPVAELGDSAQIKVGEWVMAIGNPFGLA 179

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
            TV+AGIVSA  R I   P   F Q DA IN GNSGGP FNA G VIG+N  IV  GQ  
Sbjct: 180 QTVTAGIVSATGRVIGSGPYDDFIQTDASINPGNSGGPLFNAEGKVIGINTAIVAGGQ-- 237

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
            G+G  IP+++ K  +P L  KG+V  GW G+  Q ++ ELA   GL G KG+LIT VVK
Sbjct: 238 -GIGFAIPVNMAKDVLPQLEEKGKVTRGWLGVTMQPMSPELAKSFGLEGEKGALITDVVK 296

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           + PA  AG++ GD+I   DG+ I    +    +A+    + VKI + +EG      V +G
Sbjct: 297 DGPAANAGLRSGDIILEFDGKKINEMSELPRLVAAEPIGKAVKIKVLREGKPREFTVSVG 356

Query: 376 --------------------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALN 415
                               S+     D+   +G KE  G+V+  +  G+          
Sbjct: 357 RLAESGDENNQKTAGDAFGLSARELTKDLAARLGLKESRGVVVTGVKQGSI--------- 407

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
                  E  G Q G  I+ +    V+ + D E+LI
Sbjct: 408 ------AELGGFQSGDIILEIGDKAVATVMDYEKLI 437



 Score = 42.7 bits (99), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 48/88 (54%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
           FG+  + LT++LA  LGL+ ++G ++T V + S A+  G + GD+I  +  + + +  D+
Sbjct: 374 FGLSARELTKDLAARLGLKESRGVVVTGVKQGSIAELGGFQSGDIILEIGDKAVATVMDY 433

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAV 372
              I      + V+  L +  S + +A+
Sbjct: 434 EKLIKEYGKGDVVRFLLRRGDSNYYLAL 461


>gi|114327046|ref|YP_744203.1| endopeptidase degP [Granulibacter bethesdensis CGDNIH1]
 gi|114315220|gb|ABI61280.1| endopeptidase degP [Granulibacter bethesdensis CGDNIH1]
          Length = 545

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 139/374 (37%), Positives = 211/374 (56%), Gaps = 21/374 (5%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I  +G I+T+NH+V+D  + SV L D TELPA +VG D   DLAVLKV +     
Sbjct: 155 GSGFIIDANGTIVTNNHVVKDAKTVSVTLDDGTELPATIVGRDPRTDLAVLKVSAGHPLP 214

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            +E  D++++  G+ V  +GNPF L GTV+AGIVSA  RDI   P   + Q+DAPINQGN
Sbjct: 215 YIELGDSDHVLPGQWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYIQVDAPINQGN 274

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F+  G VIGVN  I +     +G+G  IP SI++  +  L S G+V  G+ G+  
Sbjct: 275 SGGPLFSQDGKVIGVNTAIFSPTGGSVGIGFAIPSSIVRNVVSQLESGGKVTRGFIGVTA 334

Query: 290 QNLTQELA----IPLGLRGT-KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
           Q + +++A    +PL   G+ KG+LI+++ + SPA KA ++ GDV+  ++G+++ S +D 
Sbjct: 335 QQVDKDMAAALNLPLAKEGSPKGALISSIEENSPAFKASLRPGDVVQTVNGQVVGSPRDL 394

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQ 399
             +++S  P     +S+  +G+   VAV +G+ P+ +    L+ G      +  +G+ LQ
Sbjct: 395 ALKVSSLKPGSNATLSVVHDGTARDVAVTIGAMPSTET-ASLQSGTGAESGQGRIGVALQ 453

Query: 400 DINDGNKKLVRIVA-------LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
            +    +  + I A        N       E  GI+ G  +V VNT  V+        I 
Sbjct: 454 PLTPELRNELEIPAEIKGAVIANVQPGSAAEQAGIKAGDVLVGVNTTSVTSPSQAASAIH 513

Query: 453 KAKEKKRDSVLLQI 466
            A   KR++V L+I
Sbjct: 514 AA--SKRNTVALRI 525


>gi|209885692|ref|YP_002289549.1| protease Do subfamily [Oligotropha carboxidovorans OM5]
 gi|209873888|gb|ACI93684.1| protease Do subfamily [Oligotropha carboxidovorans OM5]
          Length = 528

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 140/462 (30%), Positives = 240/462 (51%), Gaps = 31/462 (6%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV V+ ++K S  +    +     P   P++ +FR+              
Sbjct: 82  IVERVKPSVISVRVKIEEKQSANEDDLPF-----PPGSPMERFFRRFGGPDGFPGGRGPR 136

Query: 103 DTVERLMF-GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
                    GSGFFI+ DGY +T+NH+V+      V   D     AK++G+D   DLA++
Sbjct: 137 GRGHLTTGQGSGFFISADGYAVTNNHVVDGAEQVEVTTDDGKTYKAKVIGSDKRTDLALI 196

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQ 220
           KV+    F   +  D+   R+G+ V  +GNPF L GTV++GI+SA  RDI + P   F Q
Sbjct: 197 KVEGGSDFPFAKLSDSEP-RIGDWVLAVGNPFGLGGTVTSGIISARGRDIGNGPYDDFIQ 255

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
           IDA +N+GNSGGP FN  G VIGVN  I +     +G+   IP + +K  +  L  KG V
Sbjct: 256 IDAAVNKGNSGGPAFNTAGEVIGVNTAIYSPSGGSVGIAFSIPSATVKNVVAQLKDKGSV 315

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             GW G+  Q +T E+A  LGL+  +G+L+       PA KAG++ GDVI  ++ + +K 
Sbjct: 316 SRGWIGVQIQPVTPEIADSLGLKKPEGALVAEPQANGPAAKAGIESGDVINKVNDQPVKD 375

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS----------SPTAKNDMHLEVGD 390
            ++    I   +P   +K+ +  +G++ +V + LG           +P ++++   +  D
Sbjct: 376 ARELARTIGGLAPGASIKLGVLHKGAEKTVTLTLGELPNNVSPKSFNPESRSERPGQGAD 435

Query: 391 KELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
              LG+ +   + +    ++ V I +++P        +G+++G  I+ V    V+   D+
Sbjct: 436 VPNLGLTVAPARSVAGAGREGVVITSVDPGGAS--AERGLKEGDVILEVAGKSVATAGDI 493

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              +  A+++ ++SVL++I+        + + SRFV+L + K
Sbjct: 494 RSALTTARDENKNSVLIRIR--------SGDASRFVALPVGK 527


>gi|58585027|ref|YP_198600.1| trypsin-like serine protease [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419343|gb|AAW71358.1| Trypsin-like serine protease [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 496

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 134/413 (32%), Positives = 231/413 (55%), Gaps = 23/413 (5%)

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
           F +FF+   P ++  V  ++ GSGF I   G I+T+ H++++    +V ++D+T   A++
Sbjct: 94  FDQFFTDRNPSINREV--VLLGSGFIIDKSGTIVTNYHVIKNAQDITVTMNDNTYFKAEV 151

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           +G DA  DLAVLK+++D+    V F +++  RVG+ V  IGNPF L G+VS GI+SA  R
Sbjct: 152 LGYDARTDLAVLKIKADKDLSFVTFSNSDKARVGDTVMAIGNPFGLGGSVSTGIISARSR 211

Query: 210 DIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF--HMGVGLIIPLSI 266
           DI       F Q DA IN+GNSGGP F+  G VIG+N  I +  +   ++G+G  IP ++
Sbjct: 212 DISIGTTSEFIQTDAAINRGNSGGPLFDLNGKVIGINTAIYSPSESGGNVGIGFAIPSNL 271

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
               I +L S  ++ HGW G+  Q +T+E A  LGL+  KG+L+  +VK+SPA+K G+KV
Sbjct: 272 AISIIDTLKSGKKIKHGWLGVQVQPITREFAESLGLKDVKGALVANIVKDSPAEKGGIKV 331

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL 386
           GD++   DG+ I         ++   P ++V+I L ++G + +V VV+  S     D + 
Sbjct: 332 GDILLEFDGKKIDRMTQLPQMVSRTEPGKKVQIKLLRKGKEVNVKVVIEESVNDSKDSNT 391

Query: 387 EVG---DKELLGMVLQDI------NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVN 437
           E        + G+ + ++      +  +  +  ++  N +       +GI+KG  I+ ++
Sbjct: 392 EENRSISDYITGLTVSNLPKEPKESKNDTPIKGVIVTNVDSNSNATLRGIKKGDIIIQLD 451

Query: 438 THEVSCIKDVERLIGKA-KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             ++   ++ ++ +  A K+  +DS++L I      ++GN     F S+K+ K
Sbjct: 452 GVDIENTENFQKQVDLAIKKSGKDSIMLLI-----YRNGN---QFFTSIKLKK 496


>gi|209884421|ref|YP_002288278.1| protease Do subfamily [Oligotropha carboxidovorans OM5]
 gi|209872617|gb|ACI92413.1| protease Do subfamily [Oligotropha carboxidovorans OM5]
          Length = 503

 Score =  223 bits (568), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 159/503 (31%), Positives = 250/503 (49%), Gaps = 41/503 (8%)

Query: 17  LTCVIFSSTYLVLEAKLP-PSSVDLPPVIARVSPSIVSVMV-----------EPKKKVSV 64
           L  +  +    VL A  P P+S   P  IA  +  ++  +V           +  +  + 
Sbjct: 11  LLPLAVAGGLFVLTAGTPVPASARGPEGIADTAEKVIDAVVNISTSQTLKNRDRDEDAAP 70

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
           ++     G   LP D P    F  +F K   G++      V  L  GSGF I  DG+++T
Sbjct: 71  KKNGREKGDPRLPPDSPFNELF-DEFFKNRRGDKSPQQHKVNSL--GSGFIIDTDGFVVT 127

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVG 183
           +NH++ D    +VIL+D +++ A+L+G D   DLAVLK Q  ++K   V+F D++ +R+G
Sbjct: 128 NNHVIADADEINVILNDGSKIKAELIGRDKKSDLAVLKFQPPEKKLTAVKFGDSDKLRLG 187

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVI 242
           E V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP FN  G V+
Sbjct: 188 EWVVAIGNPFSLGGTVTAGIVSARNRDINSGPYDNYIQTDAAINRGNSGGPLFNLEGEVV 247

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           GVN  I++     +G+G  +P + +   +  L     V  GW G+  Q +T E+A  LG+
Sbjct: 248 GVNTAIISPSGGSIGIGFAVPSNTVVGIVNQLRQYKEVRRGWLGVRIQQVTDEIADSLGI 307

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
           +  +G+L+  V  + PA  AG++ GDVI   DG+ I+  +D    +A     + V +   
Sbjct: 308 KPPRGALVAGVDDKGPAKPAGIEAGDVIISFDGKAIREMKDLPRAVADAPVGKNVDVVFI 367

Query: 363 KEGSKHSVAVVLGSSPTAKN--DMHLEVGDKEL--------LGMVLQDINDGNKKLVRI- 411
           ++G + +  V LG     +   +  L+V + E+        LG+ L  +    +   +I 
Sbjct: 368 RKGKEETRKVTLGRLDDGEKLAEASLKVPEPEVEKTVTQKALGLDLASLGKDLRTRYKIK 427

Query: 412 ------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                 V +  +R  +   + +  G  IV V    V+   DV+  I K K+  + SVLLQ
Sbjct: 428 EKVKGVVIVGVDRNSDAAERRLSAGDVIVEVAQEAVNSPADVKTRIDKLKKDGKKSVLLQ 487

Query: 466 IKYDPDMQSGNDNMSRFVSLKID 488
           +       S  +   RFV+L +D
Sbjct: 488 V-------SNGEGELRFVALSVD 503


>gi|83950528|ref|ZP_00959261.1| Putative trypsin-like serine protease [Roseovarius nubinhibens ISM]
 gi|83838427|gb|EAP77723.1| Putative trypsin-like serine protease [Roseovarius nubinhibens ISM]
          Length = 379

 Score =  223 bits (568), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 207/390 (53%), Gaps = 25/390 (6%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMV 56
             R+I   ++   VAL  V+ +++ + L    P S++ +PP     +I   SP++V V V
Sbjct: 5   MSRKISLGRTPLAVALAAVLGTTSLVAL---TPSSALAIPPGGYADLIEDFSPAVVLVEV 61

Query: 57  EPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP---ILSDTVERLMFGSG 113
             K          A   G LP D      F K+F + F    P    L D   R   GSG
Sbjct: 62  SAKPT-------PANAEGPLPNDE-----FLKEFQRRFGDRLPELRQLPDEGARRGVGSG 109

Query: 114 FFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
           F I+ DG I+T+NH+V+  +S ++  +D +E  A++VGTD L D+A+L ++       V 
Sbjct: 110 FIISSDGLIVTNNHVVDGASSVTIKFADGSEHEARVVGTDPLTDIALLDIEG-SDLPTVS 168

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGG 232
           F  +  +RVG+ V  +GNPF L GTV+ GIVSA DR+I   P   F Q DA IN+GNSGG
Sbjct: 169 FGSSEEMRVGDEVIAMGNPFGLGGTVTTGIVSAKDRNINAGPFDEFIQTDAAINRGNSGG 228

Query: 233 PCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNL 292
           P FN  G VIGVN  I +      G+G  +P  ++ + +  L   G++D GW G+  + +
Sbjct: 229 PLFNDRGEVIGVNTAIFSPDGASAGIGFAVPSDLVSRIVADLKDDGKIDRGWLGVRIKPV 288

Query: 293 TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRS 352
           + E+A  LGL   +G  +  V+  SPADK G+K GD++   DG  I   +D    + + +
Sbjct: 289 SDEVASVLGLDAGEGIQVEGVIDGSPADKVGLKAGDIVLSFDGTPINEARDLTRAVGNAA 348

Query: 353 PKEQVKISLCKEGSKHSVAVVLGSSPTAKN 382
           P    KI + + G + ++ V L +  TA++
Sbjct: 349 PDTASKIEILRRGDRQTLDVTLANRATAQD 378


>gi|307545616|ref|YP_003898095.1| protease Do [Halomonas elongata DSM 2581]
 gi|307217640|emb|CBV42910.1| protease Do [Halomonas elongata DSM 2581]
          Length = 474

 Score =  223 bits (568), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 149/452 (32%), Positives = 233/452 (51%), Gaps = 23/452 (5%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM-FNAYGFGN 75
           L+  I +S    +  KLP    D   ++   +P++V++     + V    M F  +G   
Sbjct: 14  LSLAILASQS-AMAQKLP----DFTSLVEEAAPAVVNIST--SRTVETRNMPFGQFGGQE 66

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           LPE    K++F + F             + ER   GSGF I++DGYI+T+ H+VE     
Sbjct: 67  LPE--IFKHFFGERFGDQMPMPPGAQGHSEERRSLGSGFIISEDGYIMTNAHVVEGADEI 124

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            V L+D  EL A+LVG D   D+AVLKV +D     +   D+ +++VG+ V  IG+PF L
Sbjct: 125 LVSLNDGRELKAELVGADTKTDVAVLKVDAD-NLPTLTLGDSEDLKVGQWVAAIGSPFGL 183

Query: 196 RGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
             +V++GI+SA++R +P D    F Q D  IN GNSGGP FN  G VIG+N+ I T    
Sbjct: 184 DHSVTSGIISAINRTLPRDVYVPFIQTDVAINPGNSGGPLFNLDGEVIGINSQIFTRSGG 243

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
           +MG+   IP+ +       L + G V  GW G+M Q +++ELA   G+   +G+LI  + 
Sbjct: 244 YMGLSFAIPIDVAMDVADQLRNDGSVSRGWLGVMIQPVSRELADSFGMDKPQGALIADLD 303

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA + G+K GDV+  +DG+ + S       I   SP   V++ + + G   +V V +
Sbjct: 304 PDGPAARDGLKAGDVVLEVDGQTVDSSSALPRLIGRVSPGNDVELKVLRNGEHRNVTVTV 363

Query: 375 GSSPTAKNDMHLEVGDK--ELLGMVLQDINDGNKKL-----VRIVALNPNREREVEAK-G 426
           G  P ++       GD     LG+ ++ + +G         VR+V ++P     V AK G
Sbjct: 364 GDWPDSQKGAGGSAGDTAPARLGLAVRPLEEGQHDQAIDNGVRVVEVDPT---GVAAKAG 420

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           I+ G  +VS+  H V   + +  LIG+  E +
Sbjct: 421 IRAGDILVSIGEHAVESPEQLSELIGELPEDR 452


>gi|288958202|ref|YP_003448543.1| hypothetical protein AZL_013610 [Azospirillum sp. B510]
 gi|288910510|dbj|BAI71999.1| hypothetical protein AZL_013610 [Azospirillum sp. B510]
          Length = 554

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 142/402 (35%), Positives = 211/402 (52%), Gaps = 32/402 (7%)

Query: 110 FGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
            GSGF I   +GY++T+NH+V+D    +VIL DDT + A+LVG D+  DLA+LK+++   
Sbjct: 160 LGSGFIIDAKNGYVVTNNHVVQDADEITVILQDDTNIKAELVGKDSKTDLALLKIKTSHP 219

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQ 227
            + V F D++ +RVG+ V  IGNPF L G+V+AGI+SA  R+I   P   F Q DA IN+
Sbjct: 220 LVAVPFGDSDAMRVGDWVLAIGNPFGLGGSVTAGIISARQRNIDAGPYDDFLQTDASINR 279

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP FN  G VIG+N  I +     +G+G  IP ++ K+ +  L   G+   GW G+
Sbjct: 280 GNSGGPMFNLNGEVIGINTAIFSPSGGSVGIGFAIPSNLAKQVVAQLKDYGKTRRGWLGV 339

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T E+A  LGL   KG+L+ +V  + PA K G++ GDV+   DG+ I   +     
Sbjct: 340 RIQAVTPEIAESLGLPNHKGALVASVTPDGPAAKGGIQAGDVVTRFDGKEIDEMRRLPRV 399

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG--------DK-------E 392
           +A     + V + + ++G   +V V +G    A+    L  G        DK       E
Sbjct: 400 VAETGIDKAVPVEVWRKGKAQTVQVKVGELEAAEEQGLLAAGPDEKQQPKDKAPAQKPTE 459

Query: 393 LLGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
            LGM L  I    ++   I       V  +         KG++ G  I+ V   EV   +
Sbjct: 460 SLGMKLTTITPDLRQQYEIKPEMKGVVITDVAGNSTAAEKGLRAGDVIIEVGQEEVRKPE 519

Query: 446 DVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           DV   + KAKE+ + SVLL +    D+        RFV++ +
Sbjct: 520 DVTAKVQKAKEQSKKSVLLLVDRKGDL--------RFVAIPL 553


>gi|329888202|ref|ZP_08266800.1| serine protease MucD [Brevundimonas diminuta ATCC 11568]
 gi|328846758|gb|EGF96320.1| serine protease MucD [Brevundimonas diminuta ATCC 11568]
          Length = 467

 Score =  223 bits (567), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 226/448 (50%), Gaps = 35/448 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           +  +V+P++V + V+ + +     +F   GFG +P                 SGEE    
Sbjct: 16  IFQQVAPAVVQIDVKTRVQRPRGGVFQIPGFGAVPIPGAPGG----------SGEEG-ED 64

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
           +T      GSGFFI+ DG+I+T+NH+VE+    +V L+D+ EL A+L+G D L DLAV+K
Sbjct: 65  NTQLAAGAGSGFFISGDGFIVTNNHVVENAEEITVRLNDERELKARLIGRDPLTDLAVIK 124

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGT-FT 219
           V+    F  V FED    RVG+ V  +GNPF L GT +AGIVSA  R I   + P T F 
Sbjct: 125 VEGS-AFPFVSFEDKAEPRVGDWVIAVGNPFGLGGTATAGIVSAKSRAIGGNENPYTDFI 183

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           QIDA IN+GNSGGP F+  G VIGVN  I +     +G+G  IP  I K     L+   +
Sbjct: 184 QIDAAINRGNSGGPTFDIYGRVIGVNTAIFSPTGGSVGIGFAIPAGIAKDTTDRLMRGEK 243

Query: 280 VDHGWFGIMTQNLTQELAIPLGL-RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
           ++ G+ G+   NLT E    LGL  GTKG+ IT V   +P ++ G++ GDV+  L+GR I
Sbjct: 244 IERGYLGVTIGNLTNEYRESLGLPEGTKGAYITEVTAGAPGEQGGLQAGDVVVSLNGRPI 303

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE----------- 387
               +    + S  P + +++ L +EG + ++ V  G+ P        E           
Sbjct: 304 IGSNELTRAVGSAKPGDVLRLELLREGRRQTINVRAGTRPANLGAAEAESDDATTPDTPE 363

Query: 388 -VGDKELLGMVLQDINDGNKKLVR-------IVALNPNREREVEAKGIQKGMTIVSVNTH 439
            V  +++ G+ +  I+   +           +V    + +      G + G  +V  N  
Sbjct: 364 AVAGEKIEGLTVAPISAALRSRFELPAETRGVVVTAIDAQSRAARLGFRPGFVVVQANGR 423

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            VS +K++   +  A+   R  VLL ++
Sbjct: 424 AVSSVKELRDAVEAARSANRPGVLLLVR 451


>gi|258404964|ref|YP_003197706.1| protease Do [Desulfohalobium retbaense DSM 5692]
 gi|257797191|gb|ACV68128.1| protease Do [Desulfohalobium retbaense DSM 5692]
          Length = 476

 Score =  223 bits (567), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 152/462 (32%), Positives = 242/462 (52%), Gaps = 35/462 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           +C +AL  V+  ST L   A+LP  + +L     +   +I +V    + +  VE+ FN +
Sbjct: 9   VCGLAL-LVLSGSTAL---AQLPEFT-ELAKSAGKAVVNISTVKTVDQSQ-GVEEFFNRF 62

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
                    P +++F + F +FF    P      ++   GSGF ++ DGYI+T+NH+VE 
Sbjct: 63  ----HRRGGPFEDFFDQ-FERFFG---PQQMPKRQQRSLGSGFIMSRDGYIVTNNHVVEQ 114

Query: 132 GASFSVILSD-DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
               +V L   +T   A +VG D   DLA+LK++ DR+   +EF D+  + +G+ V  IG
Sbjct: 115 ADKITVNLQGGETSYQADIVGRDPETDLALLKIEVDRELPVLEFGDSGEMEIGDWVMAIG 174

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           NPF L  +V+AGI+SA  R I   P   F Q DA IN GNSGGP  N  G VIG+N  I+
Sbjct: 175 NPFGLDHSVTAGIISAKGRVIGAGPYDDFLQTDASINPGNSGGPLLNTDGKVIGINTAII 234

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
            SGQ   G+G  IP  + K+ I  L    +V  GW G+  Q++ + +A  LGL   KG+L
Sbjct: 235 ASGQ---GIGFAIPSDMAKQVIAQLKKYQKVKRGWLGVTIQDVDENMAKALGLDAPKGAL 291

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           I  V    PAD+AG+K GDV+  L+G  ++       +I    P  +  +++ ++G    
Sbjct: 292 IAGVRAGDPADEAGLKAGDVVVSLNGEPVEDADGLTRRIGRMEPDTKANMTIWRQGKVKK 351

Query: 370 VAVVLGSSPTAKNDMHLEVGDKE----LLGMVLQDINDGNKKLVRIVALNPNRE---REV 422
           +AVVLG   TA+ +   E  D E     LG+V++ + D   +  R + ++  R    ++V
Sbjct: 352 IAVVLGERDTAQEEARAEQPDSEQTSGRLGIVVRPVRD---EEARALGMDEARGLLIQDV 408

Query: 423 EA------KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           E        G++ G  I++ N  EV  ++ + +++ +   +K
Sbjct: 409 EQASLAAEAGLRPGDVILAANGQEVETVRGLSQILNEDAAEK 450


>gi|126729291|ref|ZP_01745105.1| periplasmic serine protease, DO/DeqQ family protein [Sagittula
           stellata E-37]
 gi|126710281|gb|EBA09333.1| periplasmic serine protease, DO/DeqQ family protein [Sagittula
           stellata E-37]
          Length = 483

 Score =  223 bits (567), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 151/504 (29%), Positives = 251/504 (49%), Gaps = 37/504 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M +     ++     AL+ V+  S  L+ +A+  P S     +  RVSP++V++      
Sbjct: 1   MTREDATPLRLFWLTALSMVLILSQSLMAQARGAPES--FAELAERVSPAVVNITT---- 54

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
             +V       G   +PE  P +++FR+   +   G  P  S        GSGF I++DG
Sbjct: 55  STTVAGRTGPQGV--VPEGSPFEDFFREFQDRNGQGNRPRRSSA-----LGSGFVISEDG 107

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YI+T+NH++E      +   +  +LPA LVGTD   D+AVLKV++D     V F D+N  
Sbjct: 108 YIVTNNHVIEGADEIMIEFFEGFDLPATLVGTDPNTDIAVLKVEADEPLKYVNFGDSNIA 167

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
           RVG+ V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G 
Sbjct: 168 RVGDWVMAMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGE 227

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVN  I++     +G+G  +  +++ + +  L   G    GW G+  Q++T++LA  L
Sbjct: 228 VIGVNTAILSPNGGSIGIGFSMASNVVTRVVDQLKEFGETRRGWLGVRIQDVTEDLAEGL 287

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL   KG+L++  V E PA +AGM+ GDVI   DG  +   +  V  +A+    + V++ 
Sbjct: 288 GLEQAKGALVSD-VPEGPAMEAGMEAGDVIVTFDGTEVVDTRQLVRIVANTPVGKTVRVV 346

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVG--------DKELLGMVLQDINDGNKKLVRI- 411
           + ++G   ++ V L     A+  +             + E LG+ L  + D  +  + + 
Sbjct: 347 VNRDGETKTLKVTLSRREEAEGAIPAAAAGPDAAEPQELETLGLTLSPLTDELRAELEVP 406

Query: 412 ------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                   +  +   +   KG++ G  +       V+ + D+E  I +A+++ R S+LL 
Sbjct: 407 EGTDGLAVMAVDEASQAFEKGLRAGDVVTEAGQSAVTSVTDLEDRITEARDEGRKSILLL 466

Query: 466 IKYDPDMQSGNDNMSRFVSLKIDK 489
           ++   D         RFV+L +++
Sbjct: 467 VRRGGD--------PRFVALGLEE 482


>gi|288957922|ref|YP_003448263.1| hypothetical protein AZL_010810 [Azospirillum sp. B510]
 gi|288910230|dbj|BAI71719.1| hypothetical protein AZL_010810 [Azospirillum sp. B510]
          Length = 522

 Score =  222 bits (566), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 149/479 (31%), Positives = 247/479 (51%), Gaps = 42/479 (8%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMV--EPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFH 91
           P S  DL    A+VSP++V++    E K +   ++     GF   P   P + +FR+   
Sbjct: 59  PASFADL---AAKVSPAVVNIAATQEAKAEPRAQRGPAVPGF---PPGSPFEEFFRQFQD 112

Query: 92  KFFSGEEPILSDTVERL-----MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELP 146
           +             +         GSGF I   GY++T+NH+++  +  +V L D T +P
Sbjct: 113 QMGRNGGDQGDQGDQEPHGKTGALGSGFIIDPAGYVVTNNHVIDGASEITVTLQDGTAMP 172

Query: 147 AKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           AK++G DA  DLA+LKV+SD+    V++ D++  RVG+ V  +GNPF L GTV+ GIVSA
Sbjct: 173 AKVIGRDAKTDLALLKVKSDKPLPAVDWADSDKTRVGDWVMAVGNPFGLGGTVTKGIVSA 232

Query: 207 LDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLS 265
             RDI   P   + Q+DA IN+GNSGGP F+  G VIG+N  I +     +G+G  IP +
Sbjct: 233 RGRDIHSGPYDDYFQLDAAINRGNSGGPTFDLSGRVIGINTAIYSPNGGSVGIGFAIPSN 292

Query: 266 IIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMK 325
           + K+ +  L   G+V+ GW G+  Q +T ++A  +GL G KG+L+  V  +SPA +AG+ 
Sbjct: 293 LAKEVVAQLKDSGKVERGWLGVKIQEVTPDIADSVGLPGAKGALVAEVTADSPAQRAGLH 352

Query: 326 VGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH 385
            GDV+    G+ + + +D    +A     + V + + ++G + +VAV +    T +  M 
Sbjct: 353 QGDVVLSYAGKPVTTLRDLTRNVAETKAGDTVDLKILRDGREKTVAVRI-DRLTDQQQMA 411

Query: 386 LEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREV----EAKG-------------IQ 428
              GD        +++     K +++  L+P   + +    E +G             I+
Sbjct: 412 SADGDTGKGSAGREEV--APVKGLKLAPLDPAARKRLGIGEEVQGVVVTGLAANVDVPIR 469

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            G  I  +   EV    DV R + +A++  + ++L+ I      + GN++   FV+LK+
Sbjct: 470 PGDVIERIGDTEVKSPADVRRQVTEAEKAGQKALLMLIN-----RQGNES---FVALKL 520


>gi|16126990|ref|NP_421554.1| serine protease HtrA [Caulobacter crescentus CB15]
 gi|221235782|ref|YP_002518219.1| endopeptidase DegP [Caulobacter crescentus NA1000]
 gi|13424352|gb|AAK24722.1| serine protease HtrA [Caulobacter crescentus CB15]
 gi|220964955|gb|ACL96311.1| endopeptidase degP [Caulobacter crescentus NA1000]
          Length = 530

 Score =  222 bits (566), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 143/417 (34%), Positives = 214/417 (51%), Gaps = 44/417 (10%)

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
           T ++   GSGFFI+ DGYI+T+NH+V D     V+L D  EL A LVG D   DLAV+KV
Sbjct: 123 TPKQQSAGSGFFISADGYIVTNNHVVADADDIQVVLKDGRELKATLVGRDESTDLAVIKV 182

Query: 164 ----QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT 219
                  + F  V FE+    RVG+ V TIGNPF L GT +AGI+SA DR++ D   +F 
Sbjct: 183 VDPKAKGKDFTFVNFENQAKPRVGDWVITIGNPFGLGGTATAGIISAYDRNLNDTTSSFV 242

Query: 220 ---QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
              QIDAPIN+GNSGGP F+  G VIGVN+ I +     +G+G  IP  + +     LI 
Sbjct: 243 PYIQIDAPINRGNSGGPSFDIYGRVIGVNSAIYSPSGGSVGIGFAIPAEVAEGVAKQLIE 302

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G+V  G+ G+       E+A  LG+   KG+++ +VV   PA KAG+   D++  ++G 
Sbjct: 303 NGKVVRGYIGVSIMAFNAEMAEALGMSDVKGAIVASVVPGGPAAKAGLLPDDILVAVNGV 362

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE---- 392
            I    +   +++   P E +K+S+ ++G    V V  G+ P+   +  L V D E    
Sbjct: 363 KISDSSELTREVSKARPGETIKVSIIRDGKPRIVDVKSGTRPS---ESSLAVTDDEQGQD 419

Query: 393 ---------------LLGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKG 430
                           LG+ L  I+  +++  +I       + +    + +   KG+ KG
Sbjct: 420 GAAPTPDKPASQKVDALGLTLGPIDAASRQTYKIEPDIKGLLIIGVKGDSDAGEKGLAKG 479

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             + ++N   V+ + DV   +  AK+  R SVL++I           N   F+ LKI
Sbjct: 480 DVLSNINGAPVTSVADVTSAVETAKKAGRASVLVKIV--------RQNRPVFIPLKI 528


>gi|269958486|ref|YP_003328273.1| putative serine protease [Anaplasma centrale str. Israel]
 gi|269848315|gb|ACZ48959.1| putative serine protease [Anaplasma centrale str. Israel]
          Length = 484

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 148/471 (31%), Positives = 251/471 (53%), Gaps = 31/471 (6%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF-NAYGFGNLPEDHPLKNYFRKDFH 91
           +P S      + AR+ P++V++  E         M    + F  +P         +  F 
Sbjct: 29  VPDSRKGFSELAARLLPAVVNISTEQTVDGDASSMGGQGFRFPGIP---------KGIFE 79

Query: 92  KFFSGEEPILSDTVER---LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAK 148
           +FF+  EP+L D  +    +  GSGF +   G I+T+ H++ +     V  SD++   A 
Sbjct: 80  EFFNNLEPLLVDPPKPRKVVSLGSGFIVDKSGLIVTNYHVIANAKEIHVKFSDNSTAKAT 139

Query: 149 LVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALD 208
           ++G D   DLAVLKV++ +   PV   +++++ VGE V  IGNPF L G+VS GI+S   
Sbjct: 140 VLGKDPKTDLAVLKVKTKKDLQPVTLGNSDDVLVGEWVLAIGNPFGLGGSVSVGIISGRA 199

Query: 209 RDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT-SGQFHMGVGLIIPLSI 266
           RDI       F Q DA IN+G+SGGP FNA G VIG+N  I++  G  ++GV   IP + 
Sbjct: 200 RDINIGTASEFLQTDAAINRGHSGGPLFNADGEVIGINTAIMSPQGGGNVGVAFAIPSNN 259

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
             + I  L   GRV+HGW G++ Q++T ++   LGL   +G+LI+ V K+SPA+KAG+KV
Sbjct: 260 AARVISVLSKGGRVEHGWLGVVIQHVTDDMTDSLGLERARGALISGVAKDSPAEKAGLKV 319

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL 386
           GDVI   +G+ I++       I   +  E+ K+++ ++G   +V V +G  P   +D   
Sbjct: 320 GDVILEFNGQKIENMPQLTHLITKAAVNEKAKVTVQRDGRTLNVVVTIGKLP---DDAVP 376

Query: 387 EVGDKEL----LGMVLQDINDGNKKLVR--IVALNPNREREVEAKGIQKGMTIVSVNTHE 440
              D+E     +G+ +  +   +KK  +  ++ L  +   +  ++G++KG  ++ +N+  
Sbjct: 377 GGADQEATDDSIGITVGSLPKSSKKQQQEGVLILRVDHRSDAFSEGVRKGDILLGINSTT 436

Query: 441 VSCIKDVERLIGKAKEKK--RDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++ + D  + +GK K     + S+LL +K     + G D    ++ +K +K
Sbjct: 437 INSVSDFSKEMGKIKGSSGGKGSLLLLVK-----KGGGDAPPIYIPVKFNK 482


>gi|163793360|ref|ZP_02187335.1| Peptidase S1C, Do [alpha proteobacterium BAL199]
 gi|159181162|gb|EDP65677.1| Peptidase S1C, Do [alpha proteobacterium BAL199]
          Length = 511

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 159/502 (31%), Positives = 242/502 (48%), Gaps = 33/502 (6%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           ++S+  + +  V+  +T LV+    P  +   P   A ++  ++  +V      +V    
Sbjct: 21  LRSVTRLGMAAVL--ATALVIPVAAPAVAKAPPESFADLAERLLPAVVNVATTQTVTDRG 78

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
            A      P   PL++ F+  F +      P      + L  GSGF ++ DG ++T+NH+
Sbjct: 79  PAMDMPQFPPGSPLEDLFKDFFERNGGNNRPQQPRRAQSL--GSGFIVSADGIVVTNNHV 136

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVF 187
           + D    +V L DD E PAKL+GTD   D+AVLK+ +  + +P V+F D++ +RVG+ V 
Sbjct: 137 IADADEITVRLHDDAEFPAKLLGTDPKTDVAVLKIDTGGRVLPFVKFGDSDRMRVGDWVV 196

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IGNPF L GTV+AGIVSA  RDI   P   F Q DA IN+GNSGGP FN  G VIG+N 
Sbjct: 197 AIGNPFGLGGTVTAGIVSARGRDIGQGPYDDFIQTDASINRGNSGGPLFNLEGDVIGINT 256

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
            I +     +G+G  I   +    +  L   GR   GW G+  Q +T E+A  LGL   +
Sbjct: 257 AIFSQSGGSIGIGFAISSKLATNVVTQLREFGRTRRGWLGVRIQQVTDEIAESLGLDKAR 316

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+  V  + PA  AG++ GDVI    G+ +   ++    +A     + V + + + G 
Sbjct: 317 GALVADVTADGPAKAAGIQSGDVILSFAGQDVSEMRELPRIVAETEVGKTVSVKVWRNGK 376

Query: 367 KHSVAVVLGSSPTA-----KNDMHLEV-------GDKELLGMVLQDINDG-------NKK 407
               +  LG    A     + D   E        G  + LG+ L  +           ++
Sbjct: 377 PVEFSAKLGELEQAEQASLQKDKPAEAATPKGTQGRVDSLGLGLATLTPQLRAQYTIGEQ 436

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
           +  +V    +       KG++ G  IV V  +EV   +DV R +  A E  R SVLL I 
Sbjct: 437 VKGVVVTQVDEAGIASEKGLRPGDVIVEVAQNEVGAPEDVVRGVKAAAESGRKSVLLLID 496

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
              D+        RF +L+IDK
Sbjct: 497 RQGDL--------RFFALRIDK 510


>gi|330991050|ref|ZP_08315004.1| putative periplasmic serine protease DO-like protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329761871|gb|EGG78361.1| putative periplasmic serine protease DO-like protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 526

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 157/468 (33%), Positives = 234/468 (50%), Gaps = 47/468 (10%)

Query: 32  KLPPSSVDLPPVIARVSPSIVSV----MVEPKKKVSVEQMF--NAYGFGNLPEDHPLKNY 85
            +P S  DL    AR+ P++V+V    MV P +    +     +     N PE  P    
Sbjct: 56  NMPDSFADL---AARLLPAVVNVSTTEMVRPGEDDGDDGDDGDSTPQVPNFPEGSP---- 108

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           F K FH F + ++   +   +    GSGF I   G I+T+NH+V      ++ L D+T L
Sbjct: 109 FEKFFHDFMNRQDSPNAPPRKMQALGSGFIIDPSGVIVTNNHVVRHADQITITLQDNTVL 168

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            A+L+G D   DLAVLKV S R    V F D++N RVG+ V  IGNPF L GTV+AGIVS
Sbjct: 169 KARLLGHDDRTDLAVLKVDSPRPLPAVPFGDSDNARVGDWVLAIGNPFGLSGTVTAGIVS 228

Query: 206 ALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPL 264
           +  R+I   P   F Q DAPIN+GNSGGP FN  G VIG+N  I +     +G+G  IP 
Sbjct: 229 SRGRNIEQGPYDDFIQTDAPINKGNSGGPLFNLHGEVIGINTAIFSPSGGSIGIGFSIPS 288

Query: 265 SIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGM 324
           +  +  I  L   GRV  GW G+  Q++TQE+A  LGL+   G+LI  V  + PA  A +
Sbjct: 289 AEAQGIIAQLRQHGRVTRGWIGVRIQDVTQEIADGLGLKSAHGALIAGVEPKGPAANAHL 348

Query: 325 KVGDVICMLDGRII--KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN 382
           + GDVI  L+G+ I  ++    V ++A  S      + + + G + +V + +G+ P  K 
Sbjct: 349 QTGDVIQSLNGKDIDGRALPRLVAELAGGS---VAHLGIWRRGQQMNVNITIGALPEEKT 405

Query: 383 D---------------------MHLEVGDKELLGMVLQDINDGNKKLV--RIVALNPNRE 419
           D                     M   VG+ + +     ++ DG K ++   +   +P  E
Sbjct: 406 DRADSAHPAARNSALGSMAVEGMGFTVGEIDDIARQKYNMADGQKGVLVTGVTDDSPAAE 465

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
           R     G++ G  +  V    V+   D+ R +  A+ + R +VL  ++
Sbjct: 466 R-----GLRPGDVVTEVQQSAVNTPADLRRQLDAARSQHRKTVLFLVQ 508


>gi|90423349|ref|YP_531719.1| peptidase S1C, Do [Rhodopseudomonas palustris BisB18]
 gi|90105363|gb|ABD87400.1| Peptidase S1C, Do [Rhodopseudomonas palustris BisB18]
          Length = 528

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 151/468 (32%), Positives = 235/468 (50%), Gaps = 39/468 (8%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV V   +KV+     ++          P++ +FR+     F G + +  
Sbjct: 78  IVERVKPSVISVKVNINEKVAKND--DSAEDSPFQPGSPMERFFRR-----FGGPDGMPP 130

Query: 103 DTVERLMF-------GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
                          GSGFFI+DDGY +T+NH+V+      V   D     AK++GTD  
Sbjct: 131 GLRGGRGGRGAVTGQGSGFFISDDGYAVTNNHVVDGADKVEVTTDDGRTFKAKVIGTDPR 190

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            DLA++KV+    F P         R+G+ V  +GNPF L GTV+AGIVSA  RDI + P
Sbjct: 191 TDLALIKVEGGNNF-PFAKLAEGKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGP 249

Query: 216 -GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F QIDAP+N+GNSGGP F+  G V+GVN  I +     +G+   IP S +K  +  L
Sbjct: 250 YDDFIQIDAPVNKGNSGGPAFDTSGEVMGVNTAIYSPSGGSVGIAFSIPASTVKTVVAQL 309

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
             KG V  GW G+  Q +TQE+A  LGL+   G+L+     + PA KAG++ GDVI  ++
Sbjct: 310 KDKGSVSRGWIGVQIQPVTQEIADSLGLKKADGALVAEPQADGPAAKAGIQSGDVITAVN 369

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT---AKNDM----HLE 387
              +K  ++    I   +P   VK+++  +G    V + LG  P    AK D+    H +
Sbjct: 370 DTPVKDARELARTIGGFAPGNSVKLNVIHKGQDKVVNLTLGQLPNTIEAKADVDRGDHGD 429

Query: 388 V---GDKELLGMVLQ---DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEV 441
                D   LG+ L     +    K  V +  ++P  +     +G ++G  I+ V    V
Sbjct: 430 AKRGSDIPRLGLTLAPAGTVAGAGKDGVVVTEVDP--KSAAAERGFKEGDVILEVAGKSV 487

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +   +V   +  AK + ++SVL++++        +   SRFV++ + K
Sbjct: 488 ASPTEVREALASAKTENKNSVLIRVR--------SGGSSRFVAVPLAK 527


>gi|312114977|ref|YP_004012573.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
 gi|311220106|gb|ADP71474.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
          Length = 522

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 118/265 (44%), Positives = 169/265 (63%), Gaps = 3/265 (1%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGFFI+ DGYI+T+NH+VE      V+ ++   LPAK++GTDA  DLA+LKV+  R F 
Sbjct: 147 GSGFFISQDGYIVTNNHVVEGAMKVEVLTTEGRVLPAKIIGTDAGTDLALLKVEG-RNFP 205

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGN 229
            ++F    +++VGE V  +GNPF L GTV+AGIVSA  RDI       F QIDA +NQGN
Sbjct: 206 AIKFSK-GDVKVGEWVIALGNPFGLEGTVTAGIVSARGRDIGMGAYDNFIQIDASVNQGN 264

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP FN  G VIGVN  I +     +G+   +P   ++  +  L  KGRV  GW G+  
Sbjct: 265 SGGPTFNQSGEVIGVNTAIFSPSGGSVGIAFAVPAKTVETIVAQLKEKGRVTRGWLGVEV 324

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           Q +T ELA  LGLR  +G+L+T++++ SPADK G+  GDV+  ++   +K  +D   +IA
Sbjct: 325 QPVTPELADSLGLRDPQGALVTSLMQGSPADKGGLLRGDVVLKINEGDVKDSRDLARRIA 384

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVL 374
           S  P+  V++++ + G + ++AV L
Sbjct: 385 SIPPQTAVRLAIFRNGRREALAVKL 409


>gi|240141542|ref|YP_002966022.1| periplasmic serine protease (DegP) [Methylobacterium extorquens
           AM1]
 gi|240011519|gb|ACS42745.1| periplasmic serine protease (DegP) [Methylobacterium extorquens
           AM1]
          Length = 503

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 164/484 (33%), Positives = 249/484 (51%), Gaps = 31/484 (6%)

Query: 22  FSSTYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
            +  Y     K P  + + PP     V+ +V P +V+V V  K   S +   ++ G  NL
Sbjct: 32  MTQAYAQALPKTPIEAPEHPPGSFANVVDKVKPGVVAVKV--KLDKSADDDDDSAGGPNL 89

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTV--ERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            +  P    F K F +   G +         ER   GSGF I+ DGY++T+NH+V+   +
Sbjct: 90  QQVPPQLREFFKRFGQGGPGGQGGRGMPQRGERGAVGSGFIISADGYVVTNNHVVDKAKT 149

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D+  L AK++G D   D+A+LK+     +  V+F      RVG+ V  IGNPF 
Sbjct: 150 VQVTLDDNRTLDAKVIGKDPKTDIALLKITESGSYPYVQFGKGAP-RVGDWVVAIGNPFG 208

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+GVN  I +   
Sbjct: 209 LGGTVTAGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGVNTAIASPSG 268

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +G+   IP   ++  +  L + G+V  G+ G+  Q +T+++A  LGL   KG+L+   
Sbjct: 269 GSVGLAFAIPAETVQTVVDQLRTDGKVVRGYLGVQVQPVTKDIADGLGLDKAKGALVDHA 328

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
              +PA KAG+K GDVI  ++G  +   +D   +IA   P  +VK++  + G      V 
Sbjct: 329 ENGTPAAKAGLKSGDVIESVNGAPVNDARDLSRRIAGLKPGTEVKLAYLRGGKSDVATVE 388

Query: 374 LGSSPT-----AKNDMHLEVGDKELLGMVL---QDINDGNKKLVRIVALNPNREREVEAK 425
           LG+ PT     +++D     G +  LG+ L    +I  G++  V ++ ++P  +    AK
Sbjct: 389 LGTQPTDAKVASRSDSS--SGGQARLGLSLAPASEIGLGDEG-VAVMDVDP--DGPAAAK 443

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           GI +G  I+ V    VS   DV+  I  A+   R +VL+++K            +RFV++
Sbjct: 444 GIAQGDVILDVAGTSVSKPSDVQAQIRAAESNGRKAVLMRVKS-------AKGQTRFVAV 496

Query: 486 KIDK 489
            + K
Sbjct: 497 ALGK 500


>gi|159045273|ref|YP_001534067.1| protease do [Dinoroseobacter shibae DFL 12]
 gi|157913033|gb|ABV94466.1| protease do precursor [Dinoroseobacter shibae DFL 12]
          Length = 501

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 149/480 (31%), Positives = 244/480 (50%), Gaps = 40/480 (8%)

Query: 25  TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGN----LPEDH 80
           T +V   ++P S  DL     RVSP++V++              N    G     +PE  
Sbjct: 44  TLIVQAREIPGSFADLA---ERVSPAVVNITTST----------NVATPGGPQPMVPEGS 90

Query: 81  PLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
           PL+++FR    +      P         + GSGF I++DGYI+T+NH++E      +   
Sbjct: 91  PLEDFFRDFMDRQEQDGRPAPRQRRSNAL-GSGFVISEDGYIVTNNHVIEQADEILIEFF 149

Query: 141 DDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVS 200
              EL A++VGTD   D+A+LKV+SD     V F D++  RVG+ V  +GNP     +VS
Sbjct: 150 SGEELAAEVVGTDPNTDIALLKVESDTPLPFVTFGDSDAARVGDWVMAVGNPLGQGFSVS 209

Query: 201 AGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           AGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G 
Sbjct: 210 AGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPNGGSIGIGF 269

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            +   ++   +  L   G    GW G+  Q++T ++A  LGL    G+L+T  V + P+ 
Sbjct: 270 SMAAGVVTNVVDQLKEFGETRRGWLGVRIQDVTDDVAEALGLEQAAGALVTD-VPDGPSL 328

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
            AGM+ GDVI   DGR ++  ++ V  + + +  + V++ + ++G+  ++ V LG    A
Sbjct: 329 DAGMEAGDVILTFDGRDVEDTRELVQIVGNTAVGKAVRVVVFRDGATQTLLVTLGRREEA 388

Query: 381 KNDMHL------EVGDKELLGMVLQDINDGNKKLVRIVALNP-------NREREVEAKGI 427
           +  +        E+ +KE++G+ + ++ D  ++ + I A +        +   E   KG+
Sbjct: 389 ERAIPASASADEEILEKEIMGLTVSELTDELREQLGIAASDTGLVVADIDETSEAFDKGL 448

Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           + G  IV      V+ I++ E  +  AKE  R S+L+ ++ D D         RFV+L +
Sbjct: 449 RAGDLIVEAAQVRVTTIEEFEERVEAAKEAGRKSILVLVRRDGD--------PRFVALSL 500


>gi|119503984|ref|ZP_01626065.1| ATPase [marine gamma proteobacterium HTCC2080]
 gi|119459987|gb|EAW41081.1| ATPase [marine gamma proteobacterium HTCC2080]
          Length = 461

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 152/468 (32%), Positives = 240/468 (51%), Gaps = 43/468 (9%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           + T+AL  ++  ST    +A LP    D  P++   +P++V ++VE + +     M +A 
Sbjct: 4   LVTIALLTLLPWST----KAALP----DFQPIVESAAPAVVKILVESEAQ----SMPSAD 51

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
               LPE      Y R+ F   F G+ P      +R   GSGF +++DGY++T++H+VE 
Sbjct: 52  ELEELPE------YLRRFFE--FRGQAP----QQQRQNTGSGFIVSEDGYVVTNHHVVEG 99

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
             S +V L D  E  A++VGTD   DLA+LK++SD   +    ED  ++ VGE V  IG+
Sbjct: 100 ATSVTVRLLDRREFEAEIVGTDVRSDLALLKIESDGLAVLEIAED--DVAVGEWVLAIGS 157

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPGT----FTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           PF L  +V+AGIVSA  R +P   G     F Q D  IN GNSGGP F+  G V+GVN+ 
Sbjct: 158 PFGLDFSVTAGIVSAKGRSLPTEAGENYVPFIQTDVAINPGNSGGPLFDLDGEVVGVNSQ 217

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I T     +G+   IP ++++  +  L + G V  GW G+  Q++  +LA   GL   +G
Sbjct: 218 IFTRSGGSIGLSFAIPAAVVRNVVMQLKTSGEVTRGWLGVSIQDVDLDLAESFGLDRPRG 277

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +LI  V  +SPA +AG++ GD+I   DG+ I S  D    +   +P  +VK  + +EGS 
Sbjct: 278 ALIAQVGVDSPAQEAGLQSGDIILEFDGQAINSSSDLPHVVGLIAPGSEVKAVVRREGSN 337

Query: 368 HSVAVVLGS-----SPTAKNDMHLEVGDKELLGMVLQDIND------GNKKLVRIVALNP 416
            ++ VV+G       P+    M     ++ + GMVL+  +D      G    V ++ + P
Sbjct: 338 QTLQVVVGGLDAGDRPSVSGRMPDANSNEAVFGMVLETADDEMMAELGLSGGVLVLEVAP 397

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
             E      GI  G  +  + +  V    D E  + + +  +  ++ L
Sbjct: 398 --ESPAAMAGIVGGDVVTRLGSSAVQSTNDFETAVARLRPGQSVAIRL 443



 Score = 50.1 bits (118), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 2/88 (2%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
           FG++ +    E+   LGL G  G L+  V  ESPA  AG+  GDV+  L    ++S  DF
Sbjct: 369 FGMVLETADDEMMAELGLSG--GVLVLEVAPESPAAMAGIVGGDVVTRLGSSAVQSTNDF 426

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAV 372
              +A   P + V I L + G+   +A+
Sbjct: 427 ETAVARLRPGQSVAIRLIRRGAPLFLAI 454


>gi|126462761|ref|YP_001043875.1| protease Do [Rhodobacter sphaeroides ATCC 17029]
 gi|126104425|gb|ABN77103.1| protease Do [Rhodobacter sphaeroides ATCC 17029]
          Length = 506

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 142/431 (32%), Positives = 224/431 (51%), Gaps = 33/431 (7%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE  P +++FR        GE P  S+       GSGF I++DGYI+T+NH++E     
Sbjct: 92  VPEGSPFEDFFRDFMDPQNRGEGPRRSEA-----LGSGFVISEDGYIVTNNHVIEGADDI 146

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            +      +L AKLVGTD   D+A+LKV  ++    V F +++  RVG+ V  +GNP   
Sbjct: 147 QIEFFSGKKLEAKLVGTDPKTDIALLKVDGNQPLPFVSFGNSDLARVGDWVVAMGNPLGQ 206

Query: 196 RGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
             +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     
Sbjct: 207 GFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAILSPNGGS 266

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +  +++ K +  L   G    GW G+  Q++T ++A  +GL   KG+L+T  V 
Sbjct: 267 IGIGFSMASNVVVKVVQQLREFGETRRGWLGVRIQDVTPDVAEAMGLTEAKGALVTD-VP 325

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           E PA +AGM+ GDVI   D   +   +D V ++A     E V++ + +EG   +++V LG
Sbjct: 326 EGPAKEAGMQSGDVIVTFDSAPVADTRDLVRRVADAPIGEAVRVIVMREGKTRTLSVTLG 385

Query: 376 SSPTAKNDMHLEVGDKE--------LLGMVLQDIN---------DGNKKLVRIVALNPNR 418
               A+N+     G  E        LLG+ +  +           G  + + +  ++P  
Sbjct: 386 RREEAENEGPEAPGAAEPTEPSTADLLGLTVAPLTAEQAGELGLPGGTEGLAVTDVDP-- 443

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
             E  +KG+++G  I      +V  IKD++  + +A+E  R S+LL I+   D       
Sbjct: 444 ASEAYSKGLREGDVITEAGQQKVVSIKDLQDRVTEAREAGRKSLLLLIRRGGD------- 496

Query: 479 MSRFVSLKIDK 489
             RFV+L + +
Sbjct: 497 -PRFVALTVSE 506


>gi|298290745|ref|YP_003692684.1| protease Do [Starkeya novella DSM 506]
 gi|296927256|gb|ADH88065.1| protease Do [Starkeya novella DSM 506]
          Length = 522

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 157/480 (32%), Positives = 244/480 (50%), Gaps = 36/480 (7%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
           L    P  +     ++ +VSP++VSV V+ K +  V    +  G  N+P   P    F +
Sbjct: 53  LSTNQPAGTFSFADIVEKVSPAVVSVKVK-KDEDQVAANDDEDGNQNIP---PQIERFMR 108

Query: 89  DFHKFFSGEEPILSDTVERLMF--------GSGFFITDDGYILTSNHIVEDGASFSVILS 140
            F     G        +             GSGFFI+ DGY++T+NH+V+  +   V  +
Sbjct: 109 RFGFGPGGPGAPGGPGMGPRGGQHRAVVGQGSGFFISADGYVVTNNHVVDGASEVDVTTT 168

Query: 141 DDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVS 200
           D     AK++GTD   D+A+LKV     F  V+   A   RVG+ V  +GNPF L GTV+
Sbjct: 169 DGKSYTAKVIGTDPRTDVALLKVNGKGDFPWVKLA-AKAPRVGDWVVAVGNPFGLGGTVT 227

Query: 201 AGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVG 259
           AGIVSA  RDI   P   F QIDAPIN+GNSGGP F   G VIGVN  IV+    ++G+ 
Sbjct: 228 AGIVSARGRDIGSGPYDDFLQIDAPINRGNSGGPTFGLDGEVIGVNTAIVSPSGGNVGIA 287

Query: 260 LIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPA 319
             IP   + + + +L + G+V  G+ G+  Q ++ E+A  + L+  +G+LI  V   +P 
Sbjct: 288 FAIPSETVSEVVEALKAGGQVARGYVGVQIQPVSDEVAEAMDLKQAEGALIAQVQPGTPG 347

Query: 320 DKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP- 378
           +KAG+K GD++  +DG +IK  ++   +IA + P   VK+S+ ++G   ++ V L   P 
Sbjct: 348 EKAGLKAGDIVTAIDGEVIKDSREMSREIARKKPGTTVKLSVLRDGKTTTIPVTLEQLPT 407

Query: 379 -TAKNDMHLEVGDKE-------LLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGI 427
            TA      + GD E        LG+ L   + +     + V I  ++PN       +G+
Sbjct: 408 ETAMAGDKDKGGDTEQQNHGIPRLGLSLAPAKGVAGAGDQGVVITEVDPNGPG--AERGL 465

Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           + G  I+ V    V    DV   I  AK+  R +VL+++K        ++  +RFV++ +
Sbjct: 466 KSGDVILDVAGKPVMTPADVRDGIAAAKKDNRKAVLMRVK--------SEQGTRFVAISL 517


>gi|218781544|ref|YP_002432862.1| protease Do [Desulfatibacillum alkenivorans AK-01]
 gi|218762928|gb|ACL05394.1| protease Do [Desulfatibacillum alkenivorans AK-01]
          Length = 474

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 154/478 (32%), Positives = 237/478 (49%), Gaps = 33/478 (6%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPP----VIARVSPSIVSVMVEPK 59
           + I +  S    A    +F   +       P  S  LP     ++ + SPS+V++ V   
Sbjct: 2   KSITTFSSKTGAAALATLFVFVFFASLTPSPAWSRGLPKSFSDLVEKASPSVVNISV--M 59

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFITD 118
           K V  +Q+     FG    D P  ++F K F +   G          RL   G+GF I  
Sbjct: 60  KVVKGKQLMP---FG---PDDPFHDFFEKYFGEKMPGNR--------RLGGLGTGFIIDK 105

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DGYILT+NH+V+D     V L++D E  AK+VG D   DLA++K++ D   +P+   D+ 
Sbjct: 106 DGYILTNNHVVDDADEIKVKLTNDKEYDAKIVGKDPKTDLALIKIEPDEAIVPLPLGDSE 165

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNSGGPCFNA 237
            ++VG+ V  IGNP+ L  TV+AGI SA  R I       F Q DA IN GNSGGP  N 
Sbjct: 166 ALKVGDWVMAIGNPYGLGNTVTAGICSAKYRRIGAGAYDNFIQTDASINPGNSGGPLLNM 225

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+G+N  I +     +G+G  IP ++ K  +P L   G+V  GW G++ Q +T EL 
Sbjct: 226 DGEVVGINTAIFSRSGGSVGIGFAIPSNMAKDLLPQL-KDGKVIRGWLGVLVQGITPELK 284

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
             L L  TKG+L+++V    PA+KAGM+ GDV+   DG  IK   D  + +AS    + V
Sbjct: 285 DALDLEDTKGALVSSVTPGGPAEKAGMERGDVVVTFDGTPIKEMGDLPYVVASTPVGKNV 344

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL--LGMVLQDIND------GNKKLV 409
           ++ + ++G K ++ V +      +  +     D +   +G+ LQ++        G  K  
Sbjct: 345 EVEIIRKGKKKTIEVKIAQLQEDEKSLMASQEDAQGPDIGLALQEVTPEIASSLGLSKST 404

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            +V              ++ G  IV ++  EV  + D  +++  +K KK D+VL  I+
Sbjct: 405 GVVISRVTPYSAAAEADLRSGDLIVELDGKEVETVSDANKIL--SKFKKGDTVLFLIE 460



 Score = 42.0 bits (97), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 46/87 (52%)

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q +T E+A  LGL  + G +I+ V   S A +A ++ GD+I  LDG+ +++  D  
Sbjct: 384 GLALQEVTPEIASSLGLSKSTGVVISRVTPYSAAAEADLRSGDLIVELDGKEVETVSDAN 443

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAV 372
             ++     + V   + ++GS H   V
Sbjct: 444 KILSKFKKGDTVLFLIERQGSTHFATV 470


>gi|77463926|ref|YP_353430.1| serine protease [Rhodobacter sphaeroides 2.4.1]
 gi|221639783|ref|YP_002526045.1| protease Do [Rhodobacter sphaeroides KD131]
 gi|77388344|gb|ABA79529.1| possible serine protease [Rhodobacter sphaeroides 2.4.1]
 gi|221160564|gb|ACM01544.1| Protease Do precursor [Rhodobacter sphaeroides KD131]
          Length = 493

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 142/431 (32%), Positives = 224/431 (51%), Gaps = 33/431 (7%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE  P +++FR        GE P  S+       GSGF I++DGYI+T+NH++E     
Sbjct: 79  VPEGSPFEDFFRDFMDPQNRGEGPRRSEA-----LGSGFVISEDGYIVTNNHVIEGADDI 133

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            +      +L AKLVGTD   D+A+LKV  ++    V F +++  RVG+ V  +GNP   
Sbjct: 134 QIEFFSGKKLEAKLVGTDPKTDIALLKVDGNQPLPFVSFGNSDLARVGDWVVAMGNPLGQ 193

Query: 196 RGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
             +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     
Sbjct: 194 GFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAILSPNGGS 253

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +  +++ K +  L   G    GW G+  Q++T ++A  +GL   KG+L+T  V 
Sbjct: 254 IGIGFSMASNVVVKVVQQLREFGETRRGWLGVRIQDVTPDVAEAMGLTEAKGALVTD-VP 312

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           E PA +AGM+ GDVI   D   +   +D V ++A     E V++ + +EG   +++V LG
Sbjct: 313 EGPAKEAGMQSGDVIVTFDSAPVADTRDLVRRVADAPIGEAVRVIVMREGKTRTLSVTLG 372

Query: 376 SSPTAKNDMHLEVGDKE--------LLGMVLQDIN---------DGNKKLVRIVALNPNR 418
               A+N+     G  E        LLG+ +  +           G  + + +  ++P  
Sbjct: 373 RREEAENEGPEAPGATEPTEPSTADLLGLTVAPLTAEQAGELGLPGGTEGLAVTDVDP-- 430

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
             E  +KG+++G  I      +V  IKD++  + +A+E  R S+LL I+   D       
Sbjct: 431 ASEAYSKGLREGDVITEAGQQKVVSIKDLQDRVTEAREAGRKSLLLLIRRGGD------- 483

Query: 479 MSRFVSLKIDK 489
             RFV+L + +
Sbjct: 484 -PRFVALTVSE 493


>gi|85860823|ref|YP_463025.1| endopeptidase [Syntrophus aciditrophicus SB]
 gi|85723914|gb|ABC78857.1| endopeptidase [Syntrophus aciditrophicus SB]
          Length = 494

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 147/445 (33%), Positives = 236/445 (53%), Gaps = 24/445 (5%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
           ++ + P S  DL   + R+ P++V++        ++    N +      E  P + YF  
Sbjct: 51  IDPRTPGSFADL---VDRLKPAVVNISTTK----TIRSGSNPFSSPFSGEGSPFERYFWG 103

Query: 89  D--FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELP 146
           D  F +FF G+ P      ++   GSGF I+ DGYI T+NH+VE      V LSD  E  
Sbjct: 104 DEFFDRFF-GDVP--KREFKKKSLGSGFIISHDGYIFTNNHVVEQADKILVKLSDGKEFE 160

Query: 147 AKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           A+++G DA  D+A++K++       VE  D++ +RVGE V  IGNPF L  TV+AGIVSA
Sbjct: 161 ARVIGKDAKTDIALIKIKPTVSLPVVEIGDSDKLRVGEWVLAIGNPFGLEQTVTAGIVSA 220

Query: 207 LDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLS 265
             R I   P   F Q DA IN GNSGGP F+  G VIG+N  IV  GQ   G+G  IP++
Sbjct: 221 KGRVIGAGPYDNFIQTDASINPGNSGGPLFSMDGQVIGINTAIVAQGQ---GIGFAIPVN 277

Query: 266 IIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMK 325
           + K  +P L +KG+V  GW G+  Q++T+++A  +  +  +G+L+  V K  PA  AG+K
Sbjct: 278 MAKNILPDLKTKGKVSRGWLGVSVQDITEDIAKSMKQKDRQGALVAEVFKGDPASNAGIK 337

Query: 326 VGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH 385
            GD+I  ++G+ + +  + +  IA+    +++ I+L + G++     VL +  T + +  
Sbjct: 338 PGDIITEINGKTVINSHELLLMIANFHVGDRINITLLR-GNRPMNVNVLVAERTDRGEYA 396

Query: 386 LEVGDKELLGMVLQDIND------GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTH 439
                ++  GMV+ DI        G      ++  +       +  GIQ    I+ VN  
Sbjct: 397 ARKTSRDDYGMVVHDITPEIAQYLGLSSRTGVIVTDVREGSPADDVGIQPQDVILQVNRA 456

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLL 464
           +++  KD  + + + KE K++ +LL
Sbjct: 457 KIASKKDYLKELSR-KEAKQNLLLL 480



 Score = 46.6 bits (109), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 71/138 (51%), Gaps = 16/138 (11%)

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP---SLISKGRVDHGWF----------GI 287
           VI  + +++    FH  VG  I +++++   P   +++   R D G +          G+
Sbjct: 350 VINSHELLLMIANFH--VGDRINITLLRGNRPMNVNVLVAERTDRGEYAARKTSRDDYGM 407

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
           +  ++T E+A  LGL    G ++T V + SPAD  G++  DVI  ++   I S +D++ +
Sbjct: 408 VVHDITPEIAQYLGLSSRTGVIVTDVREGSPADDVGIQPQDVILQVNRAKIASKKDYLKE 467

Query: 348 IASRSPKEQVKISLCKEG 365
           ++ +  K+ + + L K G
Sbjct: 468 LSRKEAKQNL-LLLVKRG 484


>gi|152995133|ref|YP_001339968.1| protease Do [Marinomonas sp. MWYL1]
 gi|150836057|gb|ABR70033.1| protease Do [Marinomonas sp. MWYL1]
          Length = 469

 Score =  220 bits (561), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 142/450 (31%), Positives = 228/450 (50%), Gaps = 22/450 (4%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           +K +C V ++  + +S  L   A LP    D   ++ + SP++V++  E   +    +  
Sbjct: 5   LKQVCMVVVSSFMMAS-MLTHAASLP----DFTELVEKASPAVVNISTE---QTVTTKTA 56

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE----RLMFGSGFFITDDGYILT 124
           N  G    P    L  +F     K F G++P           R   GSGF I+ DGY+LT
Sbjct: 57  NEGGQQLGPNSEELNEFF-----KHFFGQQPFGQQAPPQQGQRSSLGSGFIISHDGYVLT 111

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH+++      V L+D  E  AKLVGTD   DLA+LK+++D   I V+  D++ ++ G+
Sbjct: 112 NNHVIDGADVIHVRLNDRREYVAKLVGTDPRTDLALLKIEADDLPI-VKMGDSDKLKPGQ 170

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IG+PF    TV+AGIVSA  R +P D    F Q D  IN GNSGGP FN  G V+G
Sbjct: 171 WVLAIGSPFGFDYTVTAGIVSATGRSLPSDNYVPFIQTDVAINPGNSGGPLFNLDGEVVG 230

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I T     MGV   IP  +    +  L S G+V   W G++ Q++  ELA   GL 
Sbjct: 231 INSQIYTRSGGFMGVSFAIPSKVAMSVVDQLKSDGKVSRAWLGVLIQDVNNELAESFGLD 290

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
            + G+LI+ V+ +SPA+KAG+K GD+I   +G+ I    +  + +      E+V   + +
Sbjct: 291 RSNGALISRVLPDSPAEKAGLKSGDIILEFNGQSIAHSGELPYIVGQMKADEKVDAKVYR 350

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI---VALNPNRER 420
           +G + +++V L + P     +     D+  LGM++ ++     K   I   V +      
Sbjct: 351 DGKEQTISVTLEARPNDPKVVAQSQQDQNRLGMIVGEVPADMAKKFEIDNGVVIEQVLGG 410

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
                G+Q+G  I  +N   ++ + +  ++
Sbjct: 411 TAARNGLQQGDVITMLNGKRITSVAEFAKI 440


>gi|56696219|ref|YP_166576.1| periplasmic serine protease [Ruegeria pomeroyi DSS-3]
 gi|56677956|gb|AAV94622.1| periplasmic serine protease, DO/DeqQ family [Ruegeria pomeroyi
           DSS-3]
          Length = 485

 Score =  220 bits (561), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 156/500 (31%), Positives = 252/500 (50%), Gaps = 59/500 (11%)

Query: 22  FSSTYLVLE---AKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
            S  +L+L+   A+  P S  L P+  +VSP++V++         VE      G   +PE
Sbjct: 13  LSVLFLLLQTLIAQARPES--LAPLADKVSPAVVNITT----STLVEGSTGPQGI--VPE 64

Query: 79  DHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
             P +++FR+   +   G+ P  S        GSGF I++DGYI+T+NH++   A    I
Sbjct: 65  GSPFEDFFREFQDRNGGGDRPRRSSA-----LGSGFVISEDGYIVTNNHVI---AKADEI 116

Query: 139 LSD--------DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
           L +          ELPAK+VGTD   D+A+LKV++D     V+F +++  RVG+ V  +G
Sbjct: 117 LIEFFPGDGQPARELPAKVVGTDENTDIALLKVEADGPLKYVKFGNSDTARVGDWVMAMG 176

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           NP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++
Sbjct: 177 NPLGQGFSVSAGIVSARNRALSGSYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILS 236

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  +GL  T G+LI
Sbjct: 237 PNGGSIGIGFSMASNVVTKVVGQLREYGETRRGWLGVRIQDVTEDMAEAMGLEKTGGALI 296

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           +  V E PA +AG+K GDVI   DG  ++  +D V ++      + V++ + ++G   ++
Sbjct: 297 SD-VPEGPAKEAGLKAGDVIVSFDGAEVRDTRDLVRRVGESEVGKSVRVLVFRDGGTQTI 355

Query: 371 AVVLGSSPTAKNDMHL------------EVGDKELLGMVLQDIN---------DGNKKLV 409
            V LG    A+                 E   KE LG+ +  +            +   +
Sbjct: 356 LVTLGRREDAERAGSGSEEEGEGGQTTPEASKKEFLGLTVSVLTAEMRAELGLAEDATGL 415

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            IVA+  +   E   KG++ G  I      +V+ + D+E  I +A+E  R S+LL ++  
Sbjct: 416 AIVAV--DEASEAFEKGLRTGDVITEAGQQKVATLADLETRIDEAREAGRKSLLLLVRRG 473

Query: 470 PDMQSGNDNMSRFVSLKIDK 489
            +         RFV+L + +
Sbjct: 474 GE--------PRFVALSLGQ 485


>gi|154247444|ref|YP_001418402.1| protease Do [Xanthobacter autotrophicus Py2]
 gi|154161529|gb|ABS68745.1| protease Do [Xanthobacter autotrophicus Py2]
          Length = 537

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 160/495 (32%), Positives = 241/495 (48%), Gaps = 63/495 (12%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGF-GNLPEDHPLKNYFRKDF-- 90
           P  +     ++ +VSP++VSV V  KK    EQM     F GN+P   P    F K F  
Sbjct: 61  PAGTFSFADIVEKVSPAVVSVKV--KKDAGNEQMAMGGDFGGNVP---PQIEQFLKRFGF 115

Query: 91  ---------------------HKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                                     GE P++         GSGF I+ DGY++T+NH+V
Sbjct: 116 GDGQGPMGPGGPGGPGMGPRGGHGPKGERPVVGQ-------GSGFIISADGYVVTNNHVV 168

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           +      V  +D  E  AK++GTD   D+A+LK+++      V+  D    RVG+ V  +
Sbjct: 169 DGADEVDVTTTDGKEYQAKVIGTDPRTDVALLKIENVTNLPWVKLADGAP-RVGDWVIAV 227

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP F+  G VIG+N  I
Sbjct: 228 GNPFGLGGTVTAGIVSARGRDIGSGPYDDFIQIDAPINRGNSGGPTFSLNGEVIGMNTAI 287

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           V+    ++G+   IP   +K  +  L  KG V  G+ G+  Q +T++LA  LG++  +G+
Sbjct: 288 VSPSGGNVGIAFAIPSETVKTVVAQLRDKGSVARGYIGVQIQPVTEDLASGLGIKDAEGA 347

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  V   +P  KAG+K GDVI  ++   IK  +D   ++    P  ++K+SL ++    
Sbjct: 348 LVAQVQPNTPGAKAGLKAGDVIVKVNNEPIKEARDLTRKVGMMKPGTEIKLSLIRDAKPM 407

Query: 369 SVAVVL------------GSSPTAKNDMHLEVGDKELLGMVL---QDINDGNKKLVRIVA 413
            +++VL            G+    ++D      D   LG+ L   + +     + V +  
Sbjct: 408 DLSLVLDQLPNDQVASRSGAPQQGEDDTAGATKDLPRLGLQLAPSKSVQGAGGEGVVVTG 467

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           + PN       +G + G  I+ V    VS  KDV   +  AK   R +VL+Q+K    + 
Sbjct: 468 VEPN--GPAAQRGFKTGDVILKVGDKAVSTPKDVRDGLAAAKADNRKAVLIQVKSGEGV- 524

Query: 474 SGNDNMSRFVSLKID 488
                  RFV++ +D
Sbjct: 525 -------RFVAITLD 532


>gi|86750554|ref|YP_487050.1| peptidase S1C, Do [Rhodopseudomonas palustris HaA2]
 gi|86573582|gb|ABD08139.1| Peptidase S1C, Do [Rhodopseudomonas palustris HaA2]
          Length = 528

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 148/464 (31%), Positives = 232/464 (50%), Gaps = 35/464 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVS-VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL 101
           ++ +V PS++SV V   +KV+  ++              P++ +FR+     F GE P  
Sbjct: 77  IVEKVKPSVISVKVNIAEKVAKTDERSERSEESPFAPGSPMERFFRR-----FGGEMPPG 131

Query: 102 SDTVERLMF----GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                        GSGFFIT DGY +T+NH+V+      V   D     AK++GTD   D
Sbjct: 132 MRGHRGGGMMTGQGSGFFITADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTD 191

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-G 216
           LA++K +    F P         R+G+ V  +GNPF L GTV+AGIVSA  RD+ + P  
Sbjct: 192 LALIKAEGRTDF-PFAKLSEGKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDLGNGPYD 250

Query: 217 TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F QIDAP+N+GNSGGP F+  G V+GVN  I +     +G+   IP S +K  +  L  
Sbjct: 251 DFIQIDAPVNKGNSGGPAFDVNGEVMGVNTAIYSPSGGSVGIAFSIPASTVKAVVQQLKD 310

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
           KG V  GW G+  Q +T E+A  LGL+   G+L+       PA KAG++ GDVI  ++G 
Sbjct: 311 KGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGPAAKAGIESGDVITAVNGA 370

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT---AKNDMHLEVGDKE- 392
            +K  ++    I   +P   VK+++  +G+   +++ LG  P    AK ++  + G +  
Sbjct: 371 PVKDARELARTIGGFAPGNTVKLTVFHKGADRELSLTLGQLPNQVEAKANLDGDNGRQSS 430

Query: 393 ------LLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
                  LG+ +     +    K  V +  ++P  +     +G ++G  I+ V    V+ 
Sbjct: 431 RGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDP--KSAAADRGFKEGDVILEVAGKNVAS 488

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             DV   I  AK   ++SVL++++        +   SRFV++ I
Sbjct: 489 PGDVRDAINTAKNDNKNSVLIRVR--------SGGSSRFVAVPI 524


>gi|323700586|ref|ZP_08112498.1| protease Do [Desulfovibrio sp. ND132]
 gi|323460518|gb|EGB16383.1| protease Do [Desulfovibrio desulfuricans ND132]
          Length = 473

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 154/470 (32%), Positives = 244/470 (51%), Gaps = 44/470 (9%)

Query: 39  DLP---PVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF- 94
           DLP    + A+   ++V +  E   +    + F       +PE HP   +F++ F +FF 
Sbjct: 26  DLPVFTELAAKAGKAVVFISTEKTAQAPSMEQFRQQ----VPEGHPFHEFFKR-FDQFFG 80

Query: 95  -SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT-ELPAKLVGT 152
             G++P      + L  GSGF I+ DG I+T+NH++      +V   DD  E PA++VG 
Sbjct: 81  PQGQQP-----RKMLGQGSGFVISPDGLIVTNNHVINGADKVTVRFQDDKKEYPAEVVGA 135

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   DLAV+K+++D     ++F D++ ++VGE V  IGNPF L  TV+AGI+SA  R I 
Sbjct: 136 DQETDLAVIKIKADHTLSTLKFGDSDKLQVGEWVLAIGNPFGLDNTVTAGIISAKHRIIG 195

Query: 213 DRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
             P   F Q DA IN GNSGGP  +  G VIG+N  I  + +    +G  IP +   K I
Sbjct: 196 AGPFDNFLQTDASINPGNSGGPLLDMDGEVIGINTAINAAAE---NIGFAIPSTQAAKVI 252

Query: 272 PSLISKGRV-DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
            +L+ +G+    GW G+  Q +++  A  LGL    G+L+ +V K +PADK G+K GDVI
Sbjct: 253 -ALLKEGKAPQRGWLGVTIQQVSETQAKALGLAEPVGALVASVGKGAPADKGGVKQGDVI 311

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS------SPTAKNDM 384
             ++G+ I+ + D + +IA  +P E+  + L + G K +  V LG       +  A N  
Sbjct: 312 LEVNGQKIEDNNDLLKKIAGLAPGEKADLVLWRNGEKVTRTVTLGQRNEKALAAMAPNQQ 371

Query: 385 HLEVGDKELLGMVLQDIND------GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNT 438
                   +LGM L+ + D      G  K   ++ +N +       +GI++G  I+  N 
Sbjct: 372 DQGPAAATVLGMALKPLTDQEAQALGLDKTQGLLVVNVDPNTPAGEEGIRQGDVILQANQ 431

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            +V+ + D+  +I  A  +KR +V+L +K            + FV+L +D
Sbjct: 432 KDVNSVADLNDVIKSA--EKRGAVMLLVKR--------QGRNSFVALPLD 471


>gi|303326815|ref|ZP_07357257.1| S1C (protease Do) subfamily peptidase MucD [Desulfovibrio sp.
           3_1_syn3]
 gi|302862803|gb|EFL85735.1| S1C (protease Do) subfamily peptidase MucD [Desulfovibrio sp.
           3_1_syn3]
          Length = 476

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 148/481 (30%), Positives = 246/481 (51%), Gaps = 33/481 (6%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           VK      LT    +S  L   A LP    D   + A+  P++V++  E K      + F
Sbjct: 3   VKKYLAALLTVAFLASAQLSQAADLP----DFSELAAKSGPAVVNIGTERKASGGGPEDF 58

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
               F N+P        F K F +F            ++   GSGF ++ DGYI+T+NH+
Sbjct: 59  FGEMFRNMPPG------FEKFFDQFGGKGRGGKRPQQKQKSLGSGFLVSADGYIVTNNHV 112

Query: 129 VEDGASFSVILSDDT----ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           V D     V L +D      L A L+G+D   DLA+LKV + +    + F D++ ++VGE
Sbjct: 113 VADADVIHVTLDEDNGKSETLKATLIGSDEETDLALLKVDAKKPLPFLTFGDSDALKVGE 172

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIG 243
            +  IGNPF L  TV+AGI+SA  R+I   P   F Q DA IN GNSGGP  N  G V+G
Sbjct: 173 WLLAIGNPFGLDHTVTAGILSAKGRNIRSGPFDNFLQTDASINPGNSGGPLLNMAGQVVG 232

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I+ SGQ   G+G  IP ++  K I  + S  ++  GW G+  Q++ +  A  LG++
Sbjct: 233 INTAIIASGQ---GIGFAIPSNMAAKIINQIKSGKKISRGWIGVSIQDMDENTAKALGMK 289

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+ +V++  PA K G++ GDVI  +D + ++     +  IA ++P     +++ +
Sbjct: 290 EPSGALVGSVMENEPAAKGGVQDGDVIIAVDKKDVEDAAALLRAIADKAPGSTAVLTVWR 349

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVGDKE----LLGMVLQDINDGNKKLVR--------I 411
           +G    + V LG   + +ND    +G K+    LLG+ ++ + +  ++ ++        I
Sbjct: 350 DGKNFDLKVTLGERKSGQNDGRPGMGQKQQDEGLLGLSVRPLKEEERREMKLSKDEGLLI 409

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V ++P++    EA  ++ G  I+  N   V+  + + +++ K    KR +++LQI+   D
Sbjct: 410 VDVDPDKP-AAEAD-LRPGDVILKANLKPVNSGEALSKIV-KEVGVKRGAIMLQIERRGD 466

Query: 472 M 472
           +
Sbjct: 467 V 467


>gi|330720633|gb|EGG98889.1| HtrA protease/chaperone protein [gamma proteobacterium IMCC2047]
          Length = 469

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 151/464 (32%), Positives = 236/464 (50%), Gaps = 54/464 (11%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSV-----------MVEPK 59
           S   +AL  ++FS +     A LP    D   +   + P++V++           +  P+
Sbjct: 9   SFFALALASLLFSMS--ARAASLP----DFTELADELKPAVVNISAVQEVQTKPALQNPE 62

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDD 119
               V ++F  + FG +P+           FH+    + P L         GSGF I++D
Sbjct: 63  LYQHVPELFRQF-FGQMPQ-----------FHQPQRRKAPSL---------GSGFIISED 101

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDAN 178
           GYILT+NH+V+      V L D  E  A+++G D   DLA+LK+ +D   +PV E  D +
Sbjct: 102 GYILTNNHVVKGADKVLVRLIDRREFEAEVIGQDGRSDLALLKIDADH--LPVVELADPD 159

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDR-DIPDRPGTFTQIDAPINQGNSGGPCFNA 237
           +I+VGE V  IG+PF    +V+AGIVSA  R    D    F Q D  IN GNSGGP FN 
Sbjct: 160 DIKVGEWVMAIGSPFGFDYSVTAGIVSATGRTSFQDSYVPFIQTDVAINPGNSGGPLFNL 219

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+G+N +IVT    +MG+   IP+S+    +  L +KG V  GW G+  Q+++++LA
Sbjct: 220 DGEVVGINTIIVTRSGGYMGLSFAIPMSVAMDVVEQLKNKGEVSRGWLGVEIQDVSRQLA 279

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
              GLR   G+ IT +V + PA  AG+KVGDVI   DG  +K   D    + S     +V
Sbjct: 280 ESFGLRQASGAAITRLVPDGPAAAAGLKVGDVILNFDGYDVKLSSDLPHLVGSTKAGSKV 339

Query: 358 KISLCKEGSKHSVAVVLGSSP-------TAKNDMHLEVGDKELLGMVLQDINDGNKKLVR 410
            + + + G K  + VV+G  P       + KN      G+ E L M++ ++ND  ++   
Sbjct: 340 TVEVFRNGKKKKLTVVVGDLPQEFVADRSQKN--QPARGEIERLNMIVDNLNDQLRERTG 397

Query: 411 I---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           I   V +   ++ +    G+++G  I   N  +VS + ++ R++
Sbjct: 398 IDEGVVVIEVKQGDAAQAGLRRGDVITMFNGQQVSSVAELARIV 441


>gi|114799653|ref|YP_759202.1| Do family protease [Hyphomonas neptunium ATCC 15444]
 gi|114739827|gb|ABI77952.1| protease, Do family [Hyphomonas neptunium ATCC 15444]
          Length = 483

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 155/474 (32%), Positives = 240/474 (50%), Gaps = 37/474 (7%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
           ++AK  P S     +  R+ P++V++        S  Q+  A      PE  P +     
Sbjct: 34  VDAKTAPQS--FSALSKRLMPAVVNI--------STSQVV-ASRLPTFPEGSPAER---- 78

Query: 89  DFHKFFSGEEPILSDTVERL-MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
            F+++F   +    D  +R    GSGF I+ DGYI+T+NH++E   +  V  SD   + A
Sbjct: 79  -FNEYFGRND----DGFQRQGSLGSGFVISADGYIVTNNHVIEKADTIEVTFSDGRTMDA 133

Query: 148 KLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           K++G D   D+AVLKV + R  +P V+  D++   VG+ V  IGNP    G+VSAGI+SA
Sbjct: 134 KIIGRDRDSDIAVLKVTA-RGALPFVDLADSDRAEVGDWVIAIGNPLGFGGSVSAGIISA 192

Query: 207 LDRDI-PDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLS 265
             RD+   R   F Q DA INQGNSGGP FN  G V+GVN  I++     +G+G  +P +
Sbjct: 193 TGRDLNTGRSDNFIQTDAAINQGNSGGPLFNLNGQVVGVNTAIISQSGGSIGLGFSVPSN 252

Query: 266 IIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMK 325
            +K+    LI  GRV+  W G+  Q+  + L      +G+ G+++T V   SPA KA ++
Sbjct: 253 TVKRISAQLIKDGRVNRPWLGVNVQDADESLIKAYKAKGSAGTIVTRVTDASPAAKAKLE 312

Query: 326 VGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT----AK 381
           VGD+I  +DGR +   +D   Q++ +   + + +S+ ++G    VAV LG  P     A 
Sbjct: 313 VGDLILSIDGRAVAGVRDMTRQLSEKPIGKAITLSIVRDGRARDVAVTLGELPDEDEPAT 372

Query: 382 NDMHLEVGDKELLGMVLQDIND------GNKKLVRIVALNPNREREVEAKGIQKGMTIVS 435
                 VG    LG  L  ++D      G  + +  VA+     R      ++KG  IV 
Sbjct: 373 AAPSEAVGMSNDLGADLVALDDDVRRRFGAPRDMNGVAVTGVSTRGRAYNKLRKGDVIVE 432

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           VN   VS + DV + +  A +     +L+++K   +     D   +FVS+ I K
Sbjct: 433 VNFQSVSAVADVIKRLDTAMQTPNQPILIRVKRRGETGGWFD---QFVSVDIKK 483


>gi|326386019|ref|ZP_08207643.1| peptidase S1C, Do [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209244|gb|EGD60037.1| peptidase S1C, Do [Novosphingobium nitrogenifigens DSM 19370]
          Length = 492

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 151/477 (31%), Positives = 236/477 (49%), Gaps = 71/477 (14%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKF 93
           PPS  DL     ++ P++V++    + KV     F    FG+L                 
Sbjct: 30  PPSFADL---TQQLQPAVVNISTRQRVKVQANNPFAGTPFGDL----------------- 69

Query: 94  FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVE-----DGASFSVILSDDTELPAK 148
           F G +   S T E    GSGF I+ DGYI+T+NH++      +  S +V ++D T+ PAK
Sbjct: 70  FGGGQGGGSQTREAQSLGSGFIISADGYIVTNNHVITAEGQGEVESITVTMTDGTDYPAK 129

Query: 149 LVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALD 208
           L+G DA  DLAVLK+ + + F  V+F D+ + RVG+ V  IGNPF L GTV+ GI+SA+ 
Sbjct: 130 LIGKDAASDLAVLKINAPKPFPFVKFGDSRHARVGDWVIAIGNPFGLGGTVTQGIISAVY 189

Query: 209 RDIP-----DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           R+       DR   + Q DA IN+GNSGGP F+  G+VIG+N  I +     +G+G  IP
Sbjct: 190 RNTGSGSAYDR---YLQTDASINRGNSGGPMFDMRGNVIGINNAIFSPTGGSVGIGFAIP 246

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
                  +  L+    ++ G+ GI  Q L+ +LA  LGL    G  + AV     A KAG
Sbjct: 247 AETAAPIVEKLMKGQAIERGYLGIRIQPLSDDLAASLGLPKRTGEFVQAVEPAQGAAKAG 306

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT---- 379
           M+ GDV+  +DG+ +   Q   + +A+  P +++ I L + G   +V  V+G  P+    
Sbjct: 307 MQAGDVVVRVDGKDVTPEQTLSYIVANTQPGKRIPIELIRNGQHVTVNAVVGKRPSEEEL 366

Query: 380 AKNDM---------HLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREV-------- 422
           AK             L  G  E    ++Q         V ++ + P   R++        
Sbjct: 367 AKQSFDPDQGQDDDGLGNGKSEKAAPIIQQALG-----VAVIPVTPQIARQLGMSEDVHG 421

Query: 423 ------------EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
                        AKG+Q+G  I+S N   V+   +++ ++ +AK + R+++LL+I+
Sbjct: 422 VVITEVDDSSDAAAKGLQRGDIILSANYKPVTTRAELDTVVKQAKAEHREAILLRIQ 478


>gi|193215756|ref|YP_001996955.1| protease Do [Chloroherpeton thalassium ATCC 35110]
 gi|193089233|gb|ACF14508.1| protease Do [Chloroherpeton thalassium ATCC 35110]
          Length = 510

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 145/440 (32%), Positives = 237/440 (53%), Gaps = 40/440 (9%)

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERL 108
           PS+V+V  E      V   F  +GFG+     P   +F+    +   G+ P   +   R 
Sbjct: 78  PSVVTVFTEQTISRKVVNPFQFFGFGS-----PFDQFFQNPNGQ---GQSPTQKEL--RK 127

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSG  ++ DGYILT+NH+V+   +  +   D+  LPAK++GTD   D+AV+KV+ D+ 
Sbjct: 128 GLGSGVVVSHDGYILTNNHVVDKADTIYIRTYDERTLPAKIIGTDPKTDIAVIKVE-DKD 186

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPF--RLRGTVSAGIVSALDR------DIPDRPGTFTQ 220
             P++  D++N+RVGE V  +G+P    L  TV+ GIVSA  R      D  D    + Q
Sbjct: 187 LKPIKIGDSDNLRVGEWVIAVGSPLGENLAETVTQGIVSAKGRANVGLADYED----YIQ 242

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
            DA IN GNSGGP  N  G +IG+N+ I +      G+G  +P ++ +K + SLI  G+V
Sbjct: 243 TDAAINPGNSGGPLVNINGELIGINSAIASQTGGFQGIGFAVPSNMAQKVMESLIRYGKV 302

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             GW G+  Q++ + +A  L L    G L+ +V+ + PA+KAG+K GDVI  +DG+ +K+
Sbjct: 303 TRGWLGVTIQDINENIAKGLDLDEKSGVLVGSVLDDGPAEKAGLKTGDVIIEIDGQKVKN 362

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE----LLGM 396
             +   ++AS +P E +K+++ ++G + +++V LG  P+ +   ++  G  E    LLG+
Sbjct: 363 SVELRNKVASTAPGESIKLTILRDGKEKTISVKLGELPSDEALANVASGGSESVKSLLGL 422

Query: 397 VLQDIN---------DGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
            L   +         D ++K V I  + P      E  G+++G  I++VN   V  + + 
Sbjct: 423 TLSPASRELASKYGFDSDEKGVVITQIEPASVAFRE--GLREGDLILAVNKVRVKNLSEF 480

Query: 448 ERLIGKAKEKKRDSVLLQIK 467
           E+ + K    K D+ L  I+
Sbjct: 481 EKQVKKI--SKGDTALFLIE 498


>gi|30250256|ref|NP_842326.1| mucD; serine protease MucD precursor [Nitrosomonas europaea ATCC
           19718]
 gi|30181051|emb|CAD86241.1| mucD; serine protease MucD precursor [Nitrosomonas europaea ATCC
           19718]
          Length = 496

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 247/488 (50%), Gaps = 37/488 (7%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA 70
           +IC +    ++ +S    L AK  P   DL   + +   ++V++     +++     F  
Sbjct: 35  AICLLVAAFMLSAS----LHAKDLPDFTDL---VEKHGQAVVNISTVQTQQIDANHFFP- 86

Query: 71  YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
            G  N+PED P   +FR+    F SG         E    GSGF I+ DGYILT+ H+VE
Sbjct: 87  -GIPNIPEDSPFYEFFRRHMQPF-SGPR-----KYESRSLGSGFIISKDGYILTNAHVVE 139

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA-NNIRVGEAVFTI 189
                +V L+D  E  AK++GTD   D+A+LK+ +D   +PV  + + + ++VGE V  I
Sbjct: 140 SANEITVRLTDKREFGAKVIGTDRKTDIALLKIDADD--LPVVTQGSPDQLKVGEWVIAI 197

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G PF    TV+AGIVSA  R +       F Q D  IN GNSGGP FN  G V+G+N+ I
Sbjct: 198 GAPFGFENTVTAGIVSAKGRSLAQENYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQI 257

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     MG+   IP+ +  +    L + G+V  G  G+M Q +T ELA    L  ++G+
Sbjct: 258 YSRTGGFMGLSFAIPIDVAMEITSQLKAYGKVSRGKIGVMIQEMTDELAESFNLDKSRGA 317

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+ +V K+ PADKAG+K+ DVI   DG+ I +  D    + +  P  +V + + + GS  
Sbjct: 318 LVVSVEKDGPADKAGIKIRDVILRFDGKGIDTSSDLPRIVGNTKPDARVSVEVWRNGSVK 377

Query: 369 SVAVVLGSSPTAKNDMHLEVGDK-----ELLGMVLQDINDGNKKLVRI---VALNPNRER 420
            + V +G  P   +   ++   K       LG+ L++++   K  + I   + +    + 
Sbjct: 378 KLTVTVGEMPGDDSSTTVQKQSKSGDATSRLGLALRELSASQKNELGIDSGLLVEEVYDG 437

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
              + GI+ G  I+  N  ++  I+   +L+  AK+ +  ++L++            +++
Sbjct: 438 IASSAGIRPGDVILGFNNQDIKSIQQFNKLLDDAKKGRNIALLIK----------RGDIT 487

Query: 481 RFVSLKID 488
            F+++KI+
Sbjct: 488 TFITIKIN 495


>gi|163854088|ref|YP_001642131.1| protease Do [Methylobacterium extorquens PA1]
 gi|254564059|ref|YP_003071154.1| periplasmic serine protease [Methylobacterium extorquens DM4]
 gi|163665693|gb|ABY33060.1| protease Do [Methylobacterium extorquens PA1]
 gi|254271337|emb|CAX27349.1| periplasmic serine protease (DegP) [Methylobacterium extorquens
           DM4]
          Length = 503

 Score =  219 bits (559), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 163/484 (33%), Positives = 250/484 (51%), Gaps = 31/484 (6%)

Query: 22  FSSTYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
            +  Y     K P  + + PP     V+ +V P +V+V V  K   S +   ++ G  NL
Sbjct: 32  MTPAYAQALPKTPIEAPEHPPGSFANVVDKVKPGVVAVKV--KLDNSADDDDDSAGGPNL 89

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTV--ERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            +  P    F K F +   G +         ER   GSGF I+ DGY++T+NH+V+   +
Sbjct: 90  QQVPPQLREFFKRFGQGGPGGQGGRGMPQRGERGAVGSGFIISADGYVVTNNHVVDKAKT 149

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D+  L AK++G D   D+A+LK+     +  V+F  +   RVG+ V  IGNPF 
Sbjct: 150 VQVTLDDNRTLDAKVIGKDPKTDIALLKITESGSYPYVQFGKSAP-RVGDWVVAIGNPFG 208

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+GVN  I +   
Sbjct: 209 LGGTVTAGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGVNTAIASPSG 268

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +G+   IP   ++  +  L + G+V  G+ G+  Q +T+++A  LGL   KG+L+   
Sbjct: 269 GSVGLAFAIPAETVQTVVDQLRTDGKVVRGYLGVQVQPVTKDIADGLGLDKAKGALVDHA 328

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
              +PA KAG+K GDVI  ++G  +   +D   +IA   P  +VK++  + G      V 
Sbjct: 329 ENGTPAAKAGLKSGDVIESVNGAPVNDARDLSRRIAGLKPGTEVKLAYLRGGKSDVATVE 388

Query: 374 LGSSPT-----AKNDMHLEVGDKELLGMVL---QDINDGNKKLVRIVALNPNREREVEAK 425
           LG+ PT     +++D     G +  LG+ L    +I  G++  V ++ ++P  +    AK
Sbjct: 389 LGTQPTDAKVASRSDSS--SGGQARLGLSLAPASEIGLGDEG-VAVMDVDP--DGPAAAK 443

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           GI +G  I+ V    VS   +V+  I  A+   R +VL+++K            +RFV++
Sbjct: 444 GIAQGDVILDVAGTSVSKPSEVQAQIRAAESNGRKAVLMRVKS-------AKGQTRFVAV 496

Query: 486 KIDK 489
            + K
Sbjct: 497 ALGK 500


>gi|258593847|emb|CBE70188.1| Putative Serine protease do-like precursor [NC10 bacterium 'Dutch
           sediment']
          Length = 494

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 136/406 (33%), Positives = 217/406 (53%), Gaps = 24/406 (5%)

Query: 74  GNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
           G   ED P   +F++     F G++P      +    GSGF +  DGYILT+NH+VE+  
Sbjct: 91  GPYSEDDPFNEFFKR-----FFGDQP---RQFKATSLGSGFIVNKDGYILTNNHVVENAT 142

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNP 192
             +V L D  E  AK++G D   D+A++K+++    +PV  F +++ + VGE V  IGNP
Sbjct: 143 DITVKLGDSREFKAKVIGRDPKTDIAIIKIEASG--LPVIPFGNSDRLEVGEPVMAIGNP 200

Query: 193 FRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L  TV+ GIVSA  R I + P   F Q DA IN+GNSGGP  N  G  +G+N  I + 
Sbjct: 201 FGLNQTVTTGIVSAKGRFIGEGPYDNFIQTDASINRGNSGGPLINTNGEAVGINTAIFSP 260

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+G  IP+ + K+ +P L  +G+V  GW G+  Q +T +L     L+   G+L++
Sbjct: 261 TGGSIGIGFAIPIEMAKEVLPQLKERGQVTRGWLGVAIQPITPDLGKKFSLKQANGALVS 320

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V++ SPA++AG+K GDVI   DG+ IKS  D    +AS    ++V + + ++G+  ++ 
Sbjct: 321 DVMEGSPAEQAGVKQGDVIVEFDGKTIKSSTDLPHMVASTPVGKEVPMKVVRDGADVTLQ 380

Query: 372 VVLGSSPTAKNDMHLEVGDKELLGMVLQDINDG--------NKKLVRIVALNPNREREVE 423
           V +G     +         K  LG+ +Q++            +K V I  + P+     +
Sbjct: 381 VKVGELKEEQVAAMAATSPKTKLGIDIQELTPALARKFGLKGEKGVVITEVEPDSPG--D 438

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           + G+Q G  I+ +N   V+ +  V R++   K K  +  LL +K D
Sbjct: 439 SVGLQPGDLILEINRVRVTTVNQVRRVL--EKTKPDEPTLLLVKRD 482


>gi|218533033|ref|YP_002423849.1| protease Do [Methylobacterium chloromethanicum CM4]
 gi|218525336|gb|ACK85921.1| protease Do [Methylobacterium chloromethanicum CM4]
          Length = 503

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 163/484 (33%), Positives = 250/484 (51%), Gaps = 31/484 (6%)

Query: 22  FSSTYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
            +  Y     K P  + + PP     V+ +V P +V+V V  K   S +   ++ G  NL
Sbjct: 32  MTPAYAQALPKTPIEAPEHPPGSFANVVDKVKPGVVAVKV--KLDNSADDDDDSAGGPNL 89

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTV--ERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            +  P    F K F +   G +         ER   GSGF I+ DGY++T+NH+V+   +
Sbjct: 90  QQVPPQLREFFKRFGQGGPGGQGGRGMPQRGERGAVGSGFIISADGYVVTNNHVVDKAKT 149

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D+  L AK++G D   D+A+LK+     +  V+F  +   RVG+ V  IGNPF 
Sbjct: 150 VQVTLDDNRTLDAKVIGKDPKTDIALLKITESGSYPYVQFGKSAP-RVGDWVVAIGNPFG 208

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+GVN  I +   
Sbjct: 209 LGGTVTAGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGVNTAIASPSG 268

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +G+   IP   ++  +  L + G+V  G+ G+  Q +T+++A  LGL   KG+L+   
Sbjct: 269 GSVGLAFAIPAETVQTVVDQLRTDGKVVRGYLGVQVQPVTKDIADGLGLDKAKGALVDHA 328

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
              +PA KAG+K GDVI  ++G  +   +D   +IA   P  +VK++  + G      V 
Sbjct: 329 ENGTPAAKAGLKSGDVIESVNGAPVNDARDLSRRIAGLKPGTEVKLAYLRGGKSDVATVE 388

Query: 374 LGSSPT-----AKNDMHLEVGDKELLGMVL---QDINDGNKKLVRIVALNPNREREVEAK 425
           LG+ PT     +++D     G +  LG+ L    +I  G++  V ++ ++P  +    AK
Sbjct: 389 LGTQPTDAKVASRSDS--TSGGQARLGLSLAPASEIGLGDEG-VAVMDVDP--DGPAAAK 443

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           GI +G  I+ V    VS   +V+  I  A+   R +VL+++K            +RFV++
Sbjct: 444 GIAQGDVILDVAGTSVSKPSEVQAQIRAAESNGRKAVLMRVKS-------AKGQTRFVAV 496

Query: 486 KIDK 489
            + K
Sbjct: 497 ALGK 500


>gi|110833676|ref|YP_692535.1| trypsin-like serine protease [Alcanivorax borkumensis SK2]
 gi|110646787|emb|CAL16263.1| Trypsin-like serine protease [Alcanivorax borkumensis SK2]
          Length = 467

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 154/483 (31%), Positives = 250/483 (51%), Gaps = 39/483 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLV---LEAKLPPSSVD------LPPVIARVSPSI 51
           MF++  LS+K+  +++L CV+    YL    + A LP  + +      L P++ + SP++
Sbjct: 1   MFEKT-LSMKNKPSLSLVCVLML-LYLAFSPVHAALPAVTAEGDALPSLAPMLEKTSPAV 58

Query: 52  VSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFG 111
           V++ +E + + +   +           D P        F +FF+  E         +  G
Sbjct: 59  VNIAIETRVRAARNPLM----------DDPF-------FRRFFNIPEQQRPAERRAVSAG 101

Query: 112 SGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           SG  +   +GY+LT+ H+V++  +  V L+D  EL A+LVG D   DLAVLK++   +  
Sbjct: 102 SGVIVDAREGYVLTNAHVVKNADNIEVTLTDGRELSAELVGVDDEVDLAVLKLEDAERLT 161

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG--TFTQIDAPINQG 228
            +   D+  +RVG+ V  IGNPF L  TV++GIVSAL R      G  +F Q DA IN G
Sbjct: 162 QIAIADSTGLRVGDFVVAIGNPFGLGQTVTSGIVSALGRTGLGIEGYESFIQTDASINPG 221

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGG   N  G ++G+N  I+     ++G+G  IP  + +  +  LI  G V  G  G+ 
Sbjct: 222 NSGGALVNLNGELVGINTAILAPAGGNVGIGFAIPTEMAENVMQQLIEHGEVRRGMLGVT 281

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q+LT ELA   G+   +G +IT VV++S A+KAG+K GDV+  +DGR +    D   ++
Sbjct: 282 IQDLTAELAEAFGVERQRGVVITQVVEDSAAEKAGLKSGDVVTAVDGRPVNRAADLRNKV 341

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKL 408
                 E+V +S+ +EG+K ++  V+  S  ++     EV  K L G  L+D+  G  + 
Sbjct: 342 GMAPVGEKVTLSILREGNKRNITAVI--SELSRETAGGEVVSKFLEGANLRDLRKGELQH 399

Query: 409 VRIVALNPNREREVEA--KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
                L    ER   A   G++KG  I++VN  +V  +  +     KA + K  ++LL++
Sbjct: 400 ADTGVLVDEVERGSPAWRAGLRKGDVIINVNRQDVETMDGLR----KAVDDKEAALLLRV 455

Query: 467 KYD 469
             +
Sbjct: 456 NRN 458


>gi|167647849|ref|YP_001685512.1| protease Do [Caulobacter sp. K31]
 gi|167350279|gb|ABZ73014.1| protease Do [Caulobacter sp. K31]
          Length = 524

 Score =  219 bits (558), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 145/390 (37%), Positives = 205/390 (52%), Gaps = 37/390 (9%)

Query: 111 GSGFFITDDGYILTSNHIVEDGAS--FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
           GSGFFI+ DGY++T+NH+V D  +   +V+L D  EL A +VG D   DLAVLKV   + 
Sbjct: 123 GSGFFISADGYLVTNNHVVADADADGINVVLKDGRELKATIVGRDEGTDLAVLKVVDPKA 182

Query: 169 ----FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QI 221
               F  V FE+    RVG+ V TIGNPF L GT +AGI+SA +RD+ D   TF    QI
Sbjct: 183 KGAAFPYVNFENQAKPRVGDWVITIGNPFGLGGTATAGIISAYNRDLGDSSSTFVDYIQI 242

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DAPIN+GNSGGP F+  G VIGVN  I +     +G+G  IP  + +     LI+ G+V 
Sbjct: 243 DAPINRGNSGGPSFDIYGRVIGVNTAIFSPTGGSVGIGFAIPADVAEATAKQLIAGGKVV 302

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            G+ G   Q  T E+A   GL   KG+++  +V   PA K G+   DVI  ++G  IKS 
Sbjct: 303 RGYIGAQIQPFTSEMAEAQGLADVKGAIVADLVPGGPAQKGGLMPEDVITAVNGVNIKSG 362

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK----NDMHLEVG-------- 389
            +   ++A   P + +K+S+ + G    V +  G  PT K    ND   + G        
Sbjct: 363 SELTREVAKGRPGDTLKLSVLRGGKPRMVEIKSGVRPTEKELALNDDDSDEGGADAPAKP 422

Query: 390 ---DKELLGMVLQDINDGNKKLVRIVALNP----------NREREVEAKGIQKGMTIVSV 436
                E LGM L  I++  +   R  +++P              +   KG++KG  + SV
Sbjct: 423 QTQKSEALGMTLVPIDEAAR---RTYSIDPAVKGVLIDSVKANSDAGEKGLRKGDVLTSV 479

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           N+  V+    V   +  AK+ +R SV L+I
Sbjct: 480 NSEPVANAAQVNSAVEAAKKLQRPSVNLRI 509


>gi|332558800|ref|ZP_08413122.1| protease Do [Rhodobacter sphaeroides WS8N]
 gi|332276512|gb|EGJ21827.1| protease Do [Rhodobacter sphaeroides WS8N]
          Length = 493

 Score =  219 bits (558), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 141/431 (32%), Positives = 224/431 (51%), Gaps = 33/431 (7%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE  P +++FR        G+ P  S+       GSGF I++DGYI+T+NH++E     
Sbjct: 79  VPEGSPFEDFFRDFMDPQNRGDGPRRSEA-----LGSGFVISEDGYIVTNNHVIEGADDI 133

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            +      +L AKLVGTD   D+A+LKV  ++    V F +++  RVG+ V  +GNP   
Sbjct: 134 QIEFFSGKKLEAKLVGTDPKTDIALLKVDGNQPLPFVSFGNSDLARVGDWVVAMGNPLGQ 193

Query: 196 RGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
             +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     
Sbjct: 194 GFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAILSPNGGS 253

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +  +++ K +  L   G    GW G+  Q++T ++A  +GL   KG+L+T  V 
Sbjct: 254 IGIGFSMASNVVVKVVQQLREFGETRRGWLGVRIQDVTPDVAEAMGLAEAKGALVTD-VP 312

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           E PA +AGM+ GDVI   D   +   +D V ++A     E V++ + +EG   +++V LG
Sbjct: 313 EGPAKEAGMQSGDVIVTFDSAPVADTRDLVRRVADAPIGEAVRVIVMREGKTRTLSVTLG 372

Query: 376 SSPTAKNDMHLEVGDKE--------LLGMVLQDIN---------DGNKKLVRIVALNPNR 418
               A+N+     G  E        LLG+ +  +           G  + + +  ++P  
Sbjct: 373 RREEAENEGPEAPGAAEPTEPSTADLLGLTVAPLTAEQAGELGLPGGTEGLAVTDVDP-- 430

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
             E  +KG+++G  I      +V  IKD++  + +A+E  R S+LL I+   D       
Sbjct: 431 ASEAYSKGLREGDVITEAGQQKVVSIKDLQDRVTEAREAGRKSLLLLIRRGGD------- 483

Query: 479 MSRFVSLKIDK 489
             RFV+L + +
Sbjct: 484 -PRFVALTVSE 493


>gi|319782924|ref|YP_004142400.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168812|gb|ADV12350.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 504

 Score =  219 bits (558), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 158/481 (32%), Positives = 239/481 (49%), Gaps = 36/481 (7%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE--QMFNAYGFGNLPEDHPLKNYFRKDFH 91
           P  + D P  +A ++  ++  +V      +V+  +   A     LPE  P +++F   F 
Sbjct: 34  PTFAADGPASVADLAQGLLGAVVNISTSQTVKGTEGPGAVPMPQLPEGSPFQDFFDD-FF 92

Query: 92  KFFSGEEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLV 150
           K   G++   S  V+ L  GSGF I  + G ++T+NH++ D     V  SD   L A LV
Sbjct: 93  KNRGGDKDNGSQKVQSL--GSGFVIDAEQGIVVTNNHVIADADDIEVNFSDGVTLKATLV 150

Query: 151 GTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           GTD   D+AVLKV     K   V+F D+  +RVG+ V  IGNPF L GTV+ GIVSA +R
Sbjct: 151 GTDTKTDVAVLKVDPKGHKLTAVKFGDSTKMRVGDWVMAIGNPFGLGGTVTVGIVSARNR 210

Query: 210 DIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIK 268
           DI   P   F Q DA IN+GNSGGP FN+ G VIG+N  I++     +G+G  IP  +  
Sbjct: 211 DINSGPYDDFIQTDAAINRGNSGGPLFNSAGEVIGINTAIISPSGGSIGIGFSIPSQLAS 270

Query: 269 KAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGD 328
             +  L   G    GW G+  Q +T ++A  LG+   KG+L+  V+K  P D   ++ GD
Sbjct: 271 GVVDQLRQFGETRRGWLGVRIQPVTDDIAESLGMATAKGALVAGVIKGGPVDNGTIQAGD 330

Query: 329 VICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-------SSPTAK 381
           VI   DG+ I   +D    +A     + V + + ++G + +V V LG       ++   +
Sbjct: 331 VIIKFDGKDIHEMRDLPRVVAESPVGKAVDVLIVRKGVEQTVKVTLGRLEDGEKAANAEE 390

Query: 382 NDMHLEVGDK-------ELLGMVLQDINDGNKKLVRIVA-------LNPNREREVEAKGI 427
            +   + GDK        +LGM + ++ND  +K   I A        +  ++     +GI
Sbjct: 391 GNTDQDKGDKAPAVSTASVLGMTVGELNDETRKKFSIAADVSGVVITDVTKDSAAAERGI 450

Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           Q G  I  +    V+  KDV   IG  KE+ R + LL       M +      RFV++++
Sbjct: 451 QPGEVITEIAQESVATPKDVMDRIGALKEQGRKNALL-------MLASKTGELRFVTIRM 503

Query: 488 D 488
           D
Sbjct: 504 D 504


>gi|188582023|ref|YP_001925468.1| protease Do [Methylobacterium populi BJ001]
 gi|179345521|gb|ACB80933.1| protease Do [Methylobacterium populi BJ001]
          Length = 511

 Score =  219 bits (558), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 148/439 (33%), Positives = 231/439 (52%), Gaps = 35/439 (7%)

Query: 76  LPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
           LP+  P ++ F + F +   G     E+     T +    GSGF I   G ++T+NH++ 
Sbjct: 82  LPQGTPFEDLFEEFFKRRGQGAPKGDEDSPRGPTRKSNSLGSGFIIDASGIVVTNNHVIG 141

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ--SDRKFIPVEFEDANNIRVGEAVFT 188
           D     VIL D T+L A+++G D+  DLA+L+V+  +DR    V F D++ +R G+ V  
Sbjct: 142 DANDIQVILHDGTKLKAEIIGKDSKIDLALLRVKPTADRPLKAVPFGDSDKMRPGDWVMA 201

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  
Sbjct: 202 IGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINTA 261

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTK 306
           I++     +G+G  +P     + +  L   G V  GW G+  QN+ +  A  LGL+ G K
Sbjct: 262 ILSPSGGSVGIGFAVPSGTASQVVDQLRQFGEVRRGWLGVRIQNVDEATAEALGLKGGAK 321

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G 
Sbjct: 322 GALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKTVDVQIVRKGE 381

Query: 367 KHSVAVVLGSSPTAKNDM-------HLEVGDKELLGMVLQDIND------GNKKLVR--- 410
           + + +V+LG     +            E  ++++LG+ L  +ND      G K+ V+   
Sbjct: 382 EQTKSVLLGRLEDGEKTQVANVKQPEAESVNRQILGLNLSGLNDEARRRFGIKESVKSGV 441

Query: 411 -IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +  ++PN       K IQ G  IV V    V+   DV + +   K++ R SVLL +   
Sbjct: 442 VVTKVDPN--STAADKRIQPGEVIVEVGQEAVANPADVTKRVEALKKQGRKSVLLLVAS- 498

Query: 470 PDMQSGNDNMSRFVSLKID 488
               SG+    RFV++ +D
Sbjct: 499 ---ASGD---VRFVAIGLD 511


>gi|294101698|ref|YP_003553556.1| protease Do [Aminobacterium colombiense DSM 12261]
 gi|293616678|gb|ADE56832.1| protease Do [Aminobacterium colombiense DSM 12261]
          Length = 464

 Score =  219 bits (557), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 148/428 (34%), Positives = 230/428 (53%), Gaps = 42/428 (9%)

Query: 43  VIAR-VSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL 101
           VIA+  SP++V++ VE     SV            P D   K +F ++F +F        
Sbjct: 38  VIAKDASPAVVNIDVEATVTRSVSP---------FPNDPIFKRFFGEEFQRF-------- 80

Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
           S T+     GSGF +TD+G ILT++H+VE     +V LSD    PA+++GTD  FDLAV+
Sbjct: 81  SRTIPMKGRGSGFIVTDNGQILTNSHVVEGADKITVTLSDGRTFPAEVLGTDPTFDLAVI 140

Query: 162 KVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT--- 217
           ++  D + +PV +  D++ I VGE V  IGNPF L  TV+ G++SA +R I    G    
Sbjct: 141 RI--DARNLPVLKLGDSDRIDVGEWVVAIGNPFGLEHTVTVGVISAKNRSI--HAGDVNF 196

Query: 218 --FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q DA IN GNSGGP  N  G V+G+N+ IV   Q   G+G  IP+++ K+ +  L+
Sbjct: 197 DGFLQTDAAINPGNSGGPLINLSGEVVGINSAIVPYAQ---GIGFAIPVNMAKQIMDDLV 253

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
             G+V  GW G+  Q +T+E     GL+  KG++I+ VV +SPADKAG++ GDVI  ++G
Sbjct: 254 KYGKVKRGWLGVYVQPVTKEFITAYGLKEEKGAVISDVVSDSPADKAGLQRGDVIIAVNG 313

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK--EL 393
             I +HQD V++I      + V + + ++  K +++V L     A  +   +   K  EL
Sbjct: 314 NKIDNHQDLVFRIRQFMAGDTVNLEIVRKAEKKNISVKLTEVAPAGEESQEKGSPKTSEL 373

Query: 394 LGMVLQDINDGNKKLVRIVALNPN--------REREVEAK-GIQKGMTIVSVNTHEVSCI 444
              V  + ++   +L     L            +    A+ GI++G  ++ VN  +VS +
Sbjct: 374 FKKVGVEASNVTTQLRSQYGLRSKDGVVITFVEQGSFAARAGIREGDLVLEVNGTKVSDV 433

Query: 445 KDVERLIG 452
            D+ + +G
Sbjct: 434 SDLNKAVG 441


>gi|260433980|ref|ZP_05787951.1| protease Do subfamily [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417808|gb|EEX11067.1| protease Do subfamily [Silicibacter lacuscaerulensis ITI-1157]
          Length = 477

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 151/475 (31%), Positives = 243/475 (51%), Gaps = 36/475 (7%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD--LPPVIARVSPSIVSVMVEPKKKVSV 64
           LS K I   AL+  + + T +       PS  D  L  ++  VSPS+V+++   +    V
Sbjct: 12  LSTKMIGVTALSTALLAGTAI-------PSQADEALADLVESVSPSVVTIIAS-QDAAPV 63

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
                 + F    E HP   +F++    F + E   +     R   GSGF + +DGYI+T
Sbjct: 64  PAGAPEFDF----EGHPFGEFFKR----FGAPEGFDVPQGGPRQGLGSGFVLDEDGYIIT 115

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           ++H+V++  + +V LSDD    A++VGTD L D+A+LK+++D     V   D++ IRVGE
Sbjct: 116 NHHVVDNADTVTVRLSDDRSYEAEVVGTDPLTDIALLKIEADVPLKAVPLGDSDEIRVGE 175

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IGNPF L  TV+ GIVSA  R+I D P   F Q DA IN+GNSGGP FN  G V+G
Sbjct: 176 DVVAIGNPFGLSSTVTTGIVSAKGRNISDGPYAEFIQTDAAINKGNSGGPLFNMDGEVVG 235

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           VN+ I +     +G+G  +  +I++     L   G+V  GW G+  QN++ ELA  +G+ 
Sbjct: 236 VNSAIYSPSGGSVGLGFAVTSNIVEHIAEDLRDDGQVSRGWLGVSIQNVSPELAAAMGIE 295

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
           GT G+L++ VV  SPAD   +K GDVI   +G  + S  +    + + +     K+++ +
Sbjct: 296 GTTGALVSDVVPGSPADGV-LKQGDVIVEFNGEKVDSSSELPVLVGTTAIGTDSKLTVLR 354

Query: 364 EGSKHSVAVVLG--SSPTAKNDMHLEVGDKELLGMVLQDINDG---------NKKLVRIV 412
            G   ++ V +G   + TA      +    + LG+ +  +++          N   V I 
Sbjct: 355 NGKTETLKVTIGQRQTETAAAAPAQDKAAGKTLGVTVAPLSETTRAEMGVPENVHGVVIT 414

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            L P  +      G+ +G  IV +    +   +D+++ +   + +K D  L+ I 
Sbjct: 415 GLRP--DSPAAKAGLHRGDVIVRLGNEPIDSPEDLKKAL---ENQKTDPALVLIN 464


>gi|108761691|ref|YP_629195.1| protease DO family protein [Myxococcus xanthus DK 1622]
 gi|9478261|gb|AAF87931.1|AF163841_10 putative serine protease DO-like precursor [Myxococcus xanthus]
 gi|108465571|gb|ABF90756.1| protease DO family protein [Myxococcus xanthus DK 1622]
          Length = 500

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 143/438 (32%), Positives = 223/438 (50%), Gaps = 36/438 (8%)

Query: 40  LPPVIARVSPSIVSVMVE--PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
           L P++  V  ++V+V V   P++  +++++             P     R      F GE
Sbjct: 74  LAPLVDAVKGAVVNVEVRARPRRSAAMQRL-------------PPGMAERFGLPPGFGGE 120

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                +   R   GSGF I   G +LT+NH+VED     V L D     A+++G D L D
Sbjct: 121 ----GNGPARQGAGSGFIIDASGIVLTNNHVVEDADQVRVKLDDGRAFDAEVMGRDPLTD 176

Query: 158 LAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP- 215
           +A+LK++     +P V   D++ +RVG+AV  IGNPF L  +VSAGI+SA  RDI   P 
Sbjct: 177 VALLKLKGAPGNLPAVPLGDSDALRVGDAVMAIGNPFGLASSVSAGILSARARDIQAGPY 236

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q DA IN GNSGGP FN  G V+G+N  IV       G+G  +P  +I+  +P L 
Sbjct: 237 DEFLQTDAAINPGNSGGPLFNMQGEVVGMNTAIVGG---ATGIGFAVPSKLIQALLPQLK 293

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
             G V  GW G+  Q+LT +LA  LGL   KG+++  V + SP ++AG++  DVI  ++G
Sbjct: 294 ETGVVRRGWLGLAVQDLTPDLARALGLEAMKGAVVAGVNRGSPGERAGLREEDVITSVNG 353

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-----EVGD 390
           + ++S       +A   P  +VK++L + G   S+ V LG+ P    +  +         
Sbjct: 354 KPVESAGGLTRAVALLQPDSRVKVNLLRGGKAQSLDVTLGTRPAQNGEQEVLPRNASASA 413

Query: 391 KELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
              LG+ L D  DG  ++V +   +P      E  G+  GM +V V   +++ + D  + 
Sbjct: 414 PRRLGVQLSDARDGGAQVVAVEPGSP-----AERGGLVPGMVLVQVGDQKIASVSDAAQA 468

Query: 451 IGKAKEKKRDSVLLQIKY 468
           +  AK     ++LL+++ 
Sbjct: 469 LTAAKPGA--ALLLRVRM 484


>gi|312879866|ref|ZP_07739666.1| protease Do [Aminomonas paucivorans DSM 12260]
 gi|310783157|gb|EFQ23555.1| protease Do [Aminomonas paucivorans DSM 12260]
          Length = 496

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 130/339 (38%), Positives = 188/339 (55%), Gaps = 24/339 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           +  R SP++V++  E      V Q    +     P+D   + +F ++  +F        S
Sbjct: 68  IAKRSSPAVVNIDTE----TLVRQSMAPF-----PDDPFFRQFFGQELERF--------S 110

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
            TV     GSGF ++ DGYILT+NH+VE     +V L D    PAKLVG D  FDLAV+K
Sbjct: 111 RTVPMKGKGSGFLVSKDGYILTNNHVVEGADKITVTLLDGRHFPAKLVGRDPTFDLAVVK 170

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP---GTFT 219
           +Q+D K   +   D+  + VGE V  IGNPF L  TV+ G++SA +R I  +      F 
Sbjct: 171 IQAD-KLPALPLGDSERVEVGEWVVAIGNPFGLENTVTVGVLSAKNRTIQAQNLNFQGFL 229

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q DA IN GNSGGP  N  G V+G+N  IV   Q   G+G  +P+++ K+ +  LI  G 
Sbjct: 230 QTDAAINPGNSGGPLLNLRGEVVGINTAIVPYAQ---GIGFAVPVNMAKQVMDDLIRHGE 286

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  GW G+  Q+LT   A   G+   +G+++  VV  SPAD+AG+  GDVI  L G+ +K
Sbjct: 287 VKRGWMGVSVQSLTPAFAEAYGIPTAEGAVVGDVVPGSPADRAGLARGDVIVSLGGKTVK 346

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           + QD V+ + +    ++VK+   ++ +K SV VVLG  P
Sbjct: 347 NSQDVVFAVRNFLAGDKVKLEFYRQKTKRSVEVVLGDLP 385


>gi|301064760|ref|ZP_07205140.1| peptidase Do [delta proteobacterium NaphS2]
 gi|300441135|gb|EFK05520.1| peptidase Do [delta proteobacterium NaphS2]
          Length = 492

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 221/422 (52%), Gaps = 24/422 (5%)

Query: 46  RVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV 105
           + SP++V++  E   K  +E M   +  G    + P +++F     KFF G         
Sbjct: 62  KYSPAVVNIRSEKNGKRHLE-MDPHFKGGPFQNNDPFRDFF----EKFFGGRP---GQGF 113

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           ++   GSGF I  DG+I+T+NH+VE      VIL D+ E  A + G D   DLA++K++S
Sbjct: 114 KQRSLGSGFIIDHDGFIVTNNHVVEGADKIKVILKDEREFDAVVKGRDPNTDLALIKIES 173

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAP 224
           D     +EF +++N+++GE V  IGNPF L  TV+ GI+SA  R I   P   F Q DA 
Sbjct: 174 DGNLPVIEFGNSDNVKIGEWVMAIGNPFGLEHTVTVGIISAKGRVIGSGPYDDFIQTDAS 233

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           IN GNSGGP  +  G V+G+N  I+  GQ   G+G  IP+++ K  I  L SKG V  GW
Sbjct: 234 INPGNSGGPLIDMSGKVVGINTAIIAGGQ---GIGFAIPVNMAKGIIEQLQSKGEVTRGW 290

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  Q+LT+EL    G++G  G L+T V    PA+KAG++  D+I  ++G+ + S ++ 
Sbjct: 291 LGVAIQDLTKELKAYYGVKGNAGVLVTKVFPGDPAEKAGIEAKDIILSVNGKEVDSSREL 350

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN--DMHLEVGDKELLGM------ 396
              IA     ++ K+ + + G +    + LG  P          EV  K   G+      
Sbjct: 351 SRTIAESPVGQKAKLLVLRGGDEKGFTIELGKRPETMEAAAQSPEVQQKNPFGIAVSNLT 410

Query: 397 --VLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
             ++Q      +  V +V + P+ + + EA G+  G  I  +N H+V+ +    + IGK 
Sbjct: 411 PEIIQQFQLQAENGVMVVGVEPDSKGD-EA-GVLPGDLIKEINHHDVTDVNQYMKEIGKY 468

Query: 455 KE 456
           K+
Sbjct: 469 KK 470


>gi|85704110|ref|ZP_01035213.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. 217]
 gi|85671430|gb|EAQ26288.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. 217]
          Length = 490

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 134/429 (31%), Positives = 225/429 (52%), Gaps = 30/429 (6%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE  P +++F +   +   G+ P  S        GSGF I++DG+++T+NH++E     
Sbjct: 73  VPEGSPFEDFFEQFRDRLGEGDRPQRSSA-----LGSGFVISEDGFVVTNNHVIESADEI 127

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            +       LPA+++GTD   D+A+LKV++D+    V F D++  RVG+ V  +GNP   
Sbjct: 128 IIEFFSGETLPAEVIGTDPKTDIALLKVKADKPLPFVSFGDSDTARVGDWVLAMGNPLGQ 187

Query: 196 RGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
             ++SAGIVSA +R +      + Q DA IN+GNSGGP FN  G V+GVN  I++     
Sbjct: 188 GFSLSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNLDGQVVGVNTAILSPTGGS 247

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +  +++K+ +  L   G    GW G+  Q++T+++A  +GL    G+L+T  V 
Sbjct: 248 IGIGFSMASNVVKRVVDQLQQFGETRRGWLGVRIQDVTEDVAEAMGLEKAAGALVTD-VP 306

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           E PA ++GM  GDVI   DG+ +   +  V  + +    + V++ + +EG   ++ + LG
Sbjct: 307 EGPAAESGMLAGDVIVSFDGQDVTDTRSLVRTVGNTEVGKTVRVVVFREGKTVTLKITLG 366

Query: 376 SSPTAK---------NDMHLEVGDKELLGMVLQDIND---GNKKL----VRIVALNPNRE 419
               A+          D      +K +LG+ +  +ND   G  +L      +V +N +  
Sbjct: 367 RREEAEGAIPVAQPGEDAPEAQVEKTILGLTVTPLNDELRGQLELDSSATGLVVVNIDEL 426

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNM 479
            E   KG++ G  I      +V+ I D++  I +AKE  R S+LL ++   D        
Sbjct: 427 SEAFEKGMRAGDVITEAGQQKVASIADLDDRIAEAKEAGRKSLLLLVRSSGD-------- 478

Query: 480 SRFVSLKID 488
            RFV+L I+
Sbjct: 479 PRFVALSIE 487


>gi|260462168|ref|ZP_05810412.1| protease Do [Mesorhizobium opportunistum WSM2075]
 gi|259032028|gb|EEW33295.1| protease Do [Mesorhizobium opportunistum WSM2075]
          Length = 505

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 157/482 (32%), Positives = 236/482 (48%), Gaps = 37/482 (7%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE--QMFNAYGFGNLPEDHPLKNYFRKDFH 91
           P  + D P  +A ++  ++  +V      +V+  +   A     LPE  P +++F   F 
Sbjct: 34  PTLAADGPASVADLAQGLLGAVVNISTSQTVKGTEGPGAVPMPQLPEGSPFQDFFDD-FF 92

Query: 92  KFFSGEEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLV 150
           K   G++   +  V+ L  GSGF I  + G ++T+NH++ D     V  SD   L A LV
Sbjct: 93  KNRGGDKDNGAQKVQSL--GSGFVIDAEQGIVVTNNHVIADADDIEVNFSDGITLKATLV 150

Query: 151 GTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           GTD   D+AVLKV     K   V+F D+  +RVG+ V  IGNPF L GTV+ GIVSA +R
Sbjct: 151 GTDTKTDVAVLKVDPKGHKLTAVKFGDSTKMRVGDWVMAIGNPFGLGGTVTVGIVSARNR 210

Query: 210 DIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIK 268
           DI   P   F Q DA IN+GNSGGP FN+ G VIG+N  I++     +G+G  IP  +  
Sbjct: 211 DINSGPYDDFIQTDAAINRGNSGGPLFNSAGEVIGINTAIISPSGGSIGIGFSIPSQLAS 270

Query: 269 KAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGD 328
             +  L   G    GW G+  Q +T ++A  LG+   KG+L+  V+K  P D   ++ GD
Sbjct: 271 GVVEQLRQYGETRRGWLGVRIQPVTDDIAESLGMATAKGALVAGVIKGGPVDNGTIQAGD 330

Query: 329 VICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL-------------- 374
           VI   DG+ I   +D    +A     + V + + ++G + +V V L              
Sbjct: 331 VILKFDGKDIHEMRDLPRVVAESPVGKAVDVLIVRKGVEQTVKVTLGRLEDGEKAANAEE 390

Query: 375 -GSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVA-------LNPNREREVEAKG 426
            G++   K D    V    +LGM + ++ND  +K   I A        +  ++     +G
Sbjct: 391 GGNTDQDKGDKAPAVSTASVLGMTVGELNDETRKKFSIAADVSGVVITDVAKDSAASERG 450

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           IQ G  I  +    V+  KDV   IG  KE+ R + LL       M +      RFV+++
Sbjct: 451 IQPGEVITEIAQESVATPKDVMDRIGALKEQGRKNALL-------MLASKTGELRFVTIR 503

Query: 487 ID 488
           +D
Sbjct: 504 MD 505


>gi|163758997|ref|ZP_02166083.1| putative protease precursor signal peptide protein [Hoeflea
           phototrophica DFL-43]
 gi|162283401|gb|EDQ33686.1| putative protease precursor signal peptide protein [Hoeflea
           phototrophica DFL-43]
          Length = 480

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 147/469 (31%), Positives = 230/469 (49%), Gaps = 34/469 (7%)

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
           P  +A ++  ++  +V      SV     +      P+  P +++F     +FF+  E  
Sbjct: 25  PASVADLAEGLLDAVVNISTSQSVGGGGGSQPRMRAPDGSPFQDFF----DEFFNDRENQ 80

Query: 101 LSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
                     GSGF I  D+G I+T+NH++E      V  +D ++L A+LVG D   DLA
Sbjct: 81  GPRNRRVSSLGSGFVIDADEGIIITNNHVIEGADDIEVNFADGSKLKAELVGADPKTDLA 140

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTF 218
           VLKV+ D+    V F D++ +R+G+ V  IGNPF L GTV+ GI+SA  RDI   P   F
Sbjct: 141 VLKVEPDKPLTEVPFGDSDRMRIGDWVMAIGNPFGLGGTVTVGIISARGRDINSGPYDNF 200

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            Q DA IN+GNSGGP FN  G VIG+N  I++     +G+G  +P  +    I  L   G
Sbjct: 201 IQTDAAINRGNSGGPLFNMNGEVIGINTAIISPSGGSIGIGFAVPTELAVNVIDQLREFG 260

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
               GW G+  Q +T ++   LG+    G+L+  +++  P D   ++VGDVI   DG+ +
Sbjct: 261 ETRRGWLGVRIQPVTDDIGESLGMDEAMGALVAGIIRGGPVDDGSIEVGDVIVRFDGKTV 320

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN--DMHLEVGDK----- 391
           ++ +D    +A     + V + + + G + +V V LG    ++       E GD      
Sbjct: 321 ETMRDLPRVVAESPVGKAVDVVVIRGGEEVTVKVTLGRLEDSEQVASAETEGGDSTADMP 380

Query: 392 ---ELLGMVLQDINDGNKKL---------VRIVALNPNREREVEAKGIQKGMTIVSVNTH 439
              E+LGM L +++D  ++          V I  ++P+       K I+ G  IV +   
Sbjct: 381 ATLEILGMTLAELDDEGREEFAIADTVEGVVITEVDPD--SAAAEKRIEPGDVIVEIAQE 438

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            V+  +DV   I   KE  R + LL       M SG     RFV++++D
Sbjct: 439 TVTTPEDVRTRIEALKEDGRRNALL-------MLSGKTGELRFVTVRMD 480


>gi|86136612|ref|ZP_01055191.1| periplasmic serine protease, DO/DeqQ family protein [Roseobacter
           sp. MED193]
 gi|85827486|gb|EAQ47682.1| periplasmic serine protease, DO/DeqQ family protein [Roseobacter
           sp. MED193]
          Length = 511

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 154/496 (31%), Positives = 255/496 (51%), Gaps = 47/496 (9%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           L+ V+  +  L  +A+  P S  L P+   VSP++V++         +E      G   +
Sbjct: 40  LSLVMLMAQMLSAQAR--PES--LAPLADEVSPAVVNITT----TTVIEGRTGPQGI--V 89

Query: 77  PEDHPLKNYFR--KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           PE  P +++FR  +D +   +G  P  S        GSGF I++DGYI+T+NH++ D   
Sbjct: 90  PEGSPFEDFFREFQDRNGGNNGNRPQRSSA-----LGSGFVISEDGYIVTNNHVIADADE 144

Query: 135 FSV-ILSDDTE----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
             +     D +    LPAK++GTD   D+A+LKV++      V F D++  RVG+ V  +
Sbjct: 145 IEIEFFPGDGQPKELLPAKVIGTDPNTDIALLKVEAPAPLKFVSFGDSDTARVGDWVVAM 204

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           GNP     ++SAGIVSA +R++      + Q DA IN+GNSGGP FN  G V+GVN  I+
Sbjct: 205 GNPLGQGFSLSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMDGDVVGVNTAIL 264

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +     +G+G  +  +++ K +  L   G    GW G+  Q+++ ++A  +GL   KG+L
Sbjct: 265 SPNGGSIGIGFSMASNVVSKVVLQLKEFGETRRGWLGVRIQDVSDDVAEAMGLDDAKGAL 324

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +T  V + P+  AG++ GDVI   DG  +++ +  V  + +    + V++ + +EG   +
Sbjct: 325 VTD-VPDGPSKDAGLQAGDVILSFDGEEVENTRSLVRTVGNTEVGKTVRVVVYREGKTET 383

Query: 370 VAVVLGSSPTAKNDM---------HLEVGDKELLGM---VLQDINDGNKKLVR----IVA 413
           + V LG    A+ +            +V +KELLG+   +L D   G   L      +V 
Sbjct: 384 LKVTLGRREDAEREATGSTEGETEDPKVTEKELLGLSIGILTDKIRGELNLPTGTDGLVI 443

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           L+ N   E   KG++ G  I      +V+ I ++E  I +AKE  R S+LL ++ + +  
Sbjct: 444 LSVNEVSEAWEKGLRAGDVITEAGQQKVATIGELETRISEAKEAGRKSLLLLVRRNGE-- 501

Query: 474 SGNDNMSRFVSLKIDK 489
                  RFV+L + K
Sbjct: 502 ------PRFVALNLVK 511


>gi|84687721|ref|ZP_01015594.1| possible serine protease [Maritimibacter alkaliphilus HTCC2654]
 gi|84664304|gb|EAQ10795.1| possible serine protease [Rhodobacterales bacterium HTCC2654]
          Length = 505

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 155/487 (31%), Positives = 244/487 (50%), Gaps = 51/487 (10%)

Query: 25  TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEP--KKKVSVEQMFNAYGFGNLPEDHPL 82
           T L      P S  DL     +VSPS+V++       +    + M        +PE  P 
Sbjct: 44  TSLAHAQTRPASFADL---AEKVSPSVVNITTATVVSQDTGPQPM--------VPEGSPF 92

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI--LS 140
           +++FR    +   G+ P    T      GSGF I++DGYI+T+NH++E GA   VI    
Sbjct: 93  EDFFRDFLDREGEGQPP---RTRRSSALGSGFVISEDGYIVTNNHVIE-GADEIVIEFFG 148

Query: 141 DDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVS 200
           +  EL A ++GTD   D+A+LKV++D     V F D+  IRVG+ V  +GNP     ++S
Sbjct: 149 NRGELDATVIGTDPNTDIALLKVETDEPLPFVPFGDSEAIRVGDWVMAMGNPLGQGFSIS 208

Query: 201 AGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           AGI+SA  R++      F Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G 
Sbjct: 209 AGIISARGRELQGTYDDFLQTDAAINRGNSGGPLFNMDGQVIGVNTAILSPNGGSIGIGF 268

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            +  +++ K +  L   G    GW G+  Q+++ ++A  +GL  T G+L+T  V + PA 
Sbjct: 269 AMASNVVTKVVDQLKEFGETRRGWLGVRIQDVSDDVAEAMGLSSTNGALVTD-VPDGPAK 327

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
            AGM+ GD+I    G  + + ++ V  + +    E V++ + ++G   ++ VVLG    A
Sbjct: 328 DAGMEAGDLILSFAGEEVANTRELVRIVGNSGVGETVRVVVLRDGQTQTLKVVLGRREEA 387

Query: 381 -KNDM---------HLEVGDKELLGMVLQDIND----------GNKKLVRIVALNPNRER 420
             ND            EV  + +LGM L ++ D          G + LV + A+  +   
Sbjct: 388 LANDEGGSSTDSTPAPEVQQQTILGMTLSEMTDELREELGLDAGAQGLV-VTAVQAD--S 444

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
           E  AKG+ +G  I      +++ I  +E  I  A++  R S+LL ++   D         
Sbjct: 445 EAAAKGLIEGDVITEAGQQQLTSIAQLEERIASARDGGRQSLLLLVRRGGD--------P 496

Query: 481 RFVSLKI 487
           RFV+L +
Sbjct: 497 RFVALPV 503


>gi|153873476|ref|ZP_02002048.1| periplasmic serine protease, DO/DeqQ family [Beggiatoa sp. PS]
 gi|152070060|gb|EDN67954.1| periplasmic serine protease, DO/DeqQ family [Beggiatoa sp. PS]
          Length = 513

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 155/498 (31%), Positives = 254/498 (51%), Gaps = 43/498 (8%)

Query: 2   FKRQILSVKSICTVALTCVI-----FSSTYLVLEAKL-----PPSSVDLPPVIARVSPSI 51
            KRQ  S + +   AL   +     F++ Y ++   +     P S  DL   + +V PS+
Sbjct: 12  LKRQAWS-QGVFMFALISALSISPFFNNAYAIVPLNVSVQMVPASFADL---VEKVRPSV 67

Query: 52  VSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-- 109
           VS+    K     ++     G     +D P +++FRKD             ++ +     
Sbjct: 68  VSISTTKKSSSFWQEFRRQPG----QKDLPFEDFFRKDSPFEDFFRRFFEKESFQLNQDK 123

Query: 110 --------FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
                    GSGF I  DG I+T++H++E        L+D ++  AK++G DA  DLA+L
Sbjct: 124 PEEHKASGLGSGFLIHADGLIVTNHHVIEGADEIKATLNDGSKYSAKVLGHDAKTDLALL 183

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQ 220
           K+++D+    V F D++  RVG+ V  +GNPF   GT + GI+SA  RDI   P   F Q
Sbjct: 184 KIEADKPLPYVSFGDSDKARVGDWVIAVGNPFGFGGTFTVGIISARGRDIQSGPYDDFIQ 243

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
           IDA IN+GNSGGP  N  G VIG+N  I +    ++G+G  +P S+    I  L   G V
Sbjct: 244 IDASINKGNSGGPLLNMDGEVIGINTAIYSPTGGNVGIGFAVPTSMAVPIIEQLQEHGSV 303

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
           + GW G+  Q++  E+A  LG+   KG+L+  V+ E+PA+K+G+  GDVI  ++G+   S
Sbjct: 304 ERGWLGVQIQSVDDEIAESLGMSEAKGALVVKVLPETPAEKSGILAGDVIFEVNGKSANS 363

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-----SSPTAKNDMHLEVGDKELLG 395
            ++    +A+    +  K+++ + GS  +V+V+LG      + T   D   E  D  +LG
Sbjct: 364 AKELSLIVANTEIGKPAKLNILRHGSLKTVSVILGRMSGEETVTLGADGKEETSD--ILG 421

Query: 396 MVLQDINDGNKKLVR-------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
           + L +I +  ++  +       I+ L+   +   +  G+Q+G  I+ VN  +VS  ++V 
Sbjct: 422 LKLAEITERTRQQYKLSEEVDGILILDIKADSPADKAGLQQGDVIMMVNQKQVSSPEEVV 481

Query: 449 RLIGKAKEKKRDSVLLQI 466
             I +A + +R  VLL I
Sbjct: 482 SRIEQAIKAERKMVLLLI 499


>gi|83945606|ref|ZP_00957952.1| serine protease [Oceanicaulis alexandrii HTCC2633]
 gi|83850972|gb|EAP88831.1| serine protease [Oceanicaulis alexandrii HTCC2633]
          Length = 491

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 153/474 (32%), Positives = 236/474 (49%), Gaps = 37/474 (7%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           LS+ ++ T A+      S Y        P S     +I +VSP++VS+  E +   +   
Sbjct: 16  LSLGAVTTFAVNAQEAPSAYSHAAPNGAPMS--FASLIEQVSPAVVSIEAEGRVDSA--- 70

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSN 126
                   N P+   L   FR+ F +F  G  P      ER   GSGFFI+ DGY++T+N
Sbjct: 71  --------NAPDMSQLPPQFREFFERF--GGMP--DQPRERRAQGSGFFISADGYVVTNN 118

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV-QSDRKFIPVEFEDANNIRVGEA 185
           H++E   +  V+L+D   L A +VGTD   DLA+L+V + D  F  VE E   NIRVG+ 
Sbjct: 119 HVIEGADTIRVVLTDGRSLDATVVGTDVATDLALLRVAEEDEPFAYVELERDLNIRVGDW 178

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRPG--TFTQIDAPINQGNSGGPCFNALGHVIG 243
           V  +GNPF L GT +AGI+SA  R +        F QIDAPIN+GNSGGP F+  G VIG
Sbjct: 179 VVAVGNPFGLGGTATAGIISATGRQMGAAQAYTDFLQIDAPINRGNSGGPAFDLDGKVIG 238

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           VN+ I++    ++G+G  IP  +    I  LI  G V  G+ GI    LT +L   +GL 
Sbjct: 239 VNSAIISPTGGNVGIGFAIPSDLAATVIDQLIENGEVRRGYLGIAPAVLTDDLKDAMGLA 298

Query: 304 GT-KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
              +G LI  V+ ++PA  AG++ GD+I  ++G  +   ++   ++ + +  E+V   + 
Sbjct: 299 DDLEGVLINQVLDDTPAQAAGLENGDIILEINGEPVDDPRELTRRVGAFALGERVAFRIL 358

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHL---EVGDKELLGMVLQ---------DINDGNKKLVR 410
           ++  + ++ V L   P A         E G     G+ L             +G   LV 
Sbjct: 359 RDERERTIRVELTERPDASTPAQTAPSEAGAAAQFGLALSVPDEAEREALELEGRGLLVE 418

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
              + P    E   KG++ G  I+     +++ + D E  +  A+E+ R ++L+
Sbjct: 419 --GVRPG--SEASEKGLRPGDVILEAGGRDLNALSDFEAAVEDARERDRRALLV 468


>gi|83951312|ref|ZP_00960044.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           nubinhibens ISM]
 gi|83836318|gb|EAP75615.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           nubinhibens ISM]
          Length = 474

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 150/493 (30%), Positives = 255/493 (51%), Gaps = 42/493 (8%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
              VAL  V+  +  L  +A+ P S  DL     +VSP++V++        S     N  
Sbjct: 6   FWAVALALVL--AQTLAAQAR-PESFADLA---QKVSPAVVNITT------STVVAANTD 53

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
               +PE  P +++FR +F     GE+     +      GSGF I++DG+I+T+NH++E 
Sbjct: 54  TLPMVPEGSPFEDFFR-EFRDRNGGEDQPRRTSA----LGSGFVISEDGFIVTNNHVIES 108

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                +   +  EL A+++GTD   D+A+LKV +D     V F D++  RVG+ V  +GN
Sbjct: 109 ADEIIIEFYEGGELKAEVIGTDPKTDIALLKVTADGPLPFVSFGDSDTARVGDWVMAMGN 168

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           P     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G V+GVN  I++ 
Sbjct: 169 PLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMSGEVVGVNTAILSP 228

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+G  +  +++ + +  L   G    GW G+  Q++T+++A  +GL   +G+L+T
Sbjct: 229 NGGSIGIGFSMASNVVTRVVEQLKEFGETRRGWLGVRIQDVTEDVAEAIGLEQARGALVT 288

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
             V E PA   GMK GDVI   DG+ ++  +  V ++ +    + V++ + ++G   ++ 
Sbjct: 289 D-VPEGPAMDGGMKSGDVILSFDGKDVEDTRGLVRRVGNAEVGKAVRVVVFRDGKTTTLK 347

Query: 372 VVL-------GSSPTAKNDMHLEVG--DKELLGMVLQDINDGNKKLVR-------IVALN 415
           V L       G+ P A+     +    ++++LG+ L +++D  ++ +        +V  +
Sbjct: 348 VTLGRREEAEGTVPAAQTQDAEDPAPVERDVLGLTLSEMSDELRQQLDLKPEANGLVVRD 407

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
            + E E   KG++ G  I       ++ ++D E  I  AKE  R S+LL ++     +SG
Sbjct: 408 VDPESEAYEKGLRGGDVITEAGQQSLATVEDFETRIEDAKEAGRKSLLLLVR-----RSG 462

Query: 476 NDNMSRFVSLKID 488
                RFV+L +D
Sbjct: 463 E---PRFVALSLD 472


>gi|56696509|ref|YP_166866.1| periplasmic serine protease [Ruegeria pomeroyi DSS-3]
 gi|56678246|gb|AAV94912.1| periplasmic serine protease, DO/DeqQ family [Ruegeria pomeroyi
           DSS-3]
          Length = 478

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 196/352 (55%), Gaps = 20/352 (5%)

Query: 31  AKLPPSSVD-LPPVIARVSPSIVSVMVE----PKKKVSVEQMFNAYGFGNLPEDHPLKNY 85
           A LP S+ + L  ++ +V+PS+V+V+      P+   +    F         E  P + +
Sbjct: 30  AALPVSADEALADLVEQVAPSVVTVLASQNAAPRPTGAQPSPF---------EGTPFEEF 80

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           F    H+F       + D+  R   GSGF +  +GYI+T+NH+V+     +V LSDD E 
Sbjct: 81  F----HQFGGPRGMPMPDSGPRQGLGSGFILDSEGYIVTNNHVVDGADRVTVRLSDDREF 136

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            A++VGTD L DLA+L++++      V   D++ IRVGE V  +GNPF L  TV+ GIVS
Sbjct: 137 TAQVVGTDPLTDLALLRIEAGEALPAVSLGDSDAIRVGEDVVAVGNPFGLSSTVTTGIVS 196

Query: 206 ALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPL 264
           A  R+I D P   F Q DA IN+GNSGGP FN  G V+GVN++I +     +G+G  +  
Sbjct: 197 AKGRNISDGPYAEFIQTDAAINKGNSGGPLFNMAGQVVGVNSVIYSPSGGSVGLGFAVTS 256

Query: 265 SIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGM 324
           +I+   I  L   G+VD GW G+  QNL  ++A  LGL  T G+L++ VV + P+D   +
Sbjct: 257 NIVDHVISDLREDGQVDRGWLGVSIQNLGADIAAALGLDQTTGALVSEVVADGPSDGT-L 315

Query: 325 KVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           + GDVI   +G+ +++  D    + +     +  I + ++G    +AV +G+
Sbjct: 316 RPGDVIVAFEGKPVRTSADLPRLVGATEAGTRASIRVMRDGKAQDIAVTIGT 367


>gi|288574754|ref|ZP_06393111.1| protease Do [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570495|gb|EFC92052.1| protease Do [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 465

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 152/473 (32%), Positives = 243/473 (51%), Gaps = 37/473 (7%)

Query: 4   RQILSVKS-ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           R + ++KS +   AL   + + + +  +A+   +   +  +  + SP++V++  E     
Sbjct: 2   RDVKNIKSRVLFSALMVFVLALSAVSAQAQDVYTGNPVSAIFEQASPAVVNIDTE----A 57

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
            V Q  + +G      D P    F  D  K FS   P+          GSGF +++DG I
Sbjct: 58  MVRQSVSPFG------DDPFFREFFGDRFKEFSRMVPMRGK-------GSGFIVSEDGKI 104

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIR 181
           LT+NH+V D  + +V LSD     AK+VG D  FDLAVLK+++  K +P+ E  D+   +
Sbjct: 105 LTNNHVVADADTITVTLSDGRTFDAKIVGKDPTFDLAVLKIEA--KNLPILELGDSEATK 162

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP---GTFTQIDAPINQGNSGGPCFNAL 238
           VGE    IGNP  L  TV+ G+VSA +R I  R      F Q DA IN GNSGGP  N  
Sbjct: 163 VGEWAVAIGNPLGLEHTVTVGVVSAKNRSIHARNFNFDGFIQTDAAINPGNSGGPLLNMD 222

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I+   Q   G+G  IP+++ K+ +  ++  G+V  GW G+  Q +T++ A 
Sbjct: 223 GKVIGINTAIIPYAQ---GIGFAIPVNMAKQVMDDIVRYGKVRRGWLGVYIQPVTRDFAK 279

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
              L GT G++++ VV +SPA KAG+K GDVI  +DG+ +K HQDFV ++  R   ++V 
Sbjct: 280 AYKLDGTDGAVVSDVVPDSPAAKAGLKRGDVIISIDGKKVKDHQDFVMKVRHRMAGDEVA 339

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLE-VGDKELLGMVLQDINDGNKKLVR------I 411
           + + + G + ++   L     +     +   G+ + LG+ +  I    K          +
Sbjct: 340 LKVVRRGKERTLKAKLSEVDDSAGFGEVSGSGEIDSLGVKVAVITGQLKDKYDLPSEDGL 399

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
           V L+          G+++G  I+  N H +    D+ R +   K +K ++VLL
Sbjct: 400 VILSVEERSSAAMAGLKEGDVILEANGHSLKTPSDLGRAL---KNEKGNAVLL 449


>gi|260427244|ref|ZP_05781223.1| protease Do subfamily [Citreicella sp. SE45]
 gi|260421736|gb|EEX14987.1| protease Do subfamily [Citreicella sp. SE45]
          Length = 492

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 153/494 (30%), Positives = 247/494 (50%), Gaps = 48/494 (9%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIV----SVMVEPKKKVSVEQMFNAYG 72
           L+  +  S  L+  A+  P S  +  +  +VSPS+V    S MV  +             
Sbjct: 24  LSMFMIVSQALMASAQGAPQSFSV--LAEKVSPSVVNITTSTMVAGRTGPQ--------- 72

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
            G +PE  P +++FR +F     G  P           GSGF I++DGYI+T+NH++E  
Sbjct: 73  -GIVPEGSPFEDFFR-EFQDRNGG--PGEDRPRRSSALGSGFVISEDGYIVTNNHVIEGA 128

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
               +   +   LPA LVGTD   D+A+LKV++D     V F +++N +VG+ V  +GNP
Sbjct: 129 DEIEIEFFEGFSLPATLVGTDPNTDIALLKVEADSPLKFVSFGNSDNAKVGDWVMAMGNP 188

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
                +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++  
Sbjct: 189 LGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMNGEVIGVNTAILSPN 248

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              +G+G  +  +++ K +  L   G    GW G+  Q++T ++   LGL   +G+L++ 
Sbjct: 249 GGSIGIGFSMASNVVTKVVDQLREFGETRRGWLGVRIQDVTDDMVEALGLASAEGALVSD 308

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
            V + PA  +GM+ GDVI   DG+ ++  +  V  + +    + V++ + + G+  ++ V
Sbjct: 309 -VPDGPAKDSGMQAGDVITSFDGKEVQDTRQLVRIVGNTDVGKSVRVVVNRNGNSETLLV 367

Query: 373 VLG-------SSPTAKNDMHLEVGDKELLGMVL----QDIN------DGNKKLVRIVALN 415
            LG       + P ++     E    EL+G+ L    QD+       D  K L     +N
Sbjct: 368 TLGRREDAETTFPASQEVTPGEPSQSELMGLTLSPLTQDLREELSLPDSAKGL---AVVN 424

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
            +   E   KG+++G  I      EV  I D+E  + +A++  R S+LL I+   D    
Sbjct: 425 VDESSEAFEKGLRQGDVITEAGQSEVLSISDLETKVDEARDAGRKSLLLLIRRGGD---- 480

Query: 476 NDNMSRFVSLKIDK 489
                RFV+L +++
Sbjct: 481 ----PRFVALSLEE 490


>gi|260433206|ref|ZP_05787177.1| protease Do subfamily protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417034|gb|EEX10293.1| protease Do subfamily protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 496

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 149/497 (29%), Positives = 253/497 (50%), Gaps = 53/497 (10%)

Query: 18  TCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLP 77
           T ++  +  +  +A+L      L P++ ++SP++V++         +E      G   +P
Sbjct: 28  TAILLLAQTVAAQARLE----SLAPLVDKISPAVVNITT----TTLIEGQAGPRGI--VP 77

Query: 78  EDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           E  P +++FR +F     G+E  P  S+       GSGF I++DG+I+T+NH++ +    
Sbjct: 78  EGSPFEDFFR-EFQDRNGGDENRPRRSNA-----LGSGFVISEDGFIVTNNHVIAEADEI 131

Query: 136 SVIL-----SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
            V           ELPAK++GTD   D+A+LKV++      V F D++  RVG+ V  +G
Sbjct: 132 LVEFFPGDGQPKKELPAKVIGTDEKTDIALLKVEAPGPLKYVTFGDSDTARVGDWVIAMG 191

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           NP     +VSAGIVSA +R++      + Q DA IN+GNSGGP FN  G VIGVN  I++
Sbjct: 192 NPLGQGFSVSAGIVSARNRELSGTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAILS 251

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  +GL    G+LI
Sbjct: 252 PNGGSIGIGFSMASNVVVKVVDQLREFGETRRGWLGVRIQDVTEDMAEAMGLDKPGGALI 311

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           +  V + PA +AG+  GDVI   DG  +K  +  V Q+      + V++ + ++G+  +V
Sbjct: 312 SD-VPDGPAKEAGLLPGDVILSFDGVEVKDTRGLVRQVGETPVGKSVRVVVMRDGATKTV 370

Query: 371 AVVLGSSPTAKNDMHLEVGDKE-----------LLGMVLQDINDG-------NKKLVRIV 412
            V LG    A+     E+G+ E           +LG+ +  + D        +     +V
Sbjct: 371 LVTLGRREDAE---RAEIGEPESSEAPVEEDATILGLTISPLTDTLREDLGLDADAAGLV 427

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
            ++ +   E  AKG++ G  I      +V  I D+E  + +A+E  R S+LL ++   D 
Sbjct: 428 VVDVDEASEAYAKGLRAGDLITEAGQQKVGSIADLEARMDEAREAGRKSLLLLVRRGGD- 486

Query: 473 QSGNDNMSRFVSLKIDK 489
                   RFV+L +++
Sbjct: 487 -------PRFVALGLEE 496


>gi|163783666|ref|ZP_02178654.1| periplasmic serine protease [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881071|gb|EDP74587.1| periplasmic serine protease [Hydrogenivirga sp. 128-5-R1-1]
          Length = 468

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 145/442 (32%), Positives = 235/442 (53%), Gaps = 41/442 (9%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           +L  VI +VSPS+V++    + K      FN +   +LP   P++ + R           
Sbjct: 46  ELSRVIDKVSPSVVTIFARQEVK------FNPFEQFDLPFMIPMEPFKR----------- 88

Query: 99  PILSDTVERLMFGSGF---FITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
                  E+   GSG    +     YILT+NH+VE+  + +V     TE PAK+VGTD  
Sbjct: 89  -------EKRSLGSGVITKYKKGKLYILTNNHVVENATTITVRFDKHTEKPAKVVGTDPK 141

Query: 156 FDLAVLKVQS----DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI 211
            DLAV++V +    D +       D++ +RVG+    IGNP+ L  TV+ G+VSAL R I
Sbjct: 142 TDLAVIEVDAKGIDDAESRVARLGDSDRVRVGQLAIAIGNPYGLERTVTVGVVSALKRSI 201

Query: 212 P-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKA 270
              +  ++ Q DA IN GNSGGP  N  G VIG+N  IV SGQ   G+G  IP+++ K  
Sbjct: 202 GITQYESYIQTDAAINPGNSGGPLINIYGEVIGINTAIVASGQ---GLGFAIPINLAKWV 258

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
           +  ++  GRV  GW G++ Q +T ++A  +G+R  +G L+  V+K SPADKAG+KVGD+I
Sbjct: 259 MEQILEHGRVVRGWLGVVIQEITPDIAEAIGVR--EGILVAQVLKNSPADKAGLKVGDII 316

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD 390
             L+G+ + S +D  + +    P   V++++ ++G K ++ V +G  P     +  +VG+
Sbjct: 317 VALNGKKLDSVRDLQFTVMKTKPGTVVELTVIRDGKKKTIKVKIGELPEKGKKLGGDVGE 376

Query: 391 KELLGMVLQDINDGNKKLVRIVALNPNRERE---VEAKGIQKGMTIVSVNTHEVSCIKDV 447
           ++ LG+ L+D+    K  + I  +              G++ G  I+ VN  EV  +++ 
Sbjct: 377 ED-LGLNLRDLTPQEKARLGIEGVVVVGVVPGSLANRSGLKPGDIIMRVNYREVKNVREF 435

Query: 448 ERLIGKAKEKKRDSVLLQIKYD 469
             +I   +E  +   LL ++ +
Sbjct: 436 YSVIENLREVGKAKALLLVRRN 457


>gi|158424196|ref|YP_001525488.1| serine protease DO-like protein [Azorhizobium caulinodans ORS 571]
 gi|158331085|dbj|BAF88570.1| serine protease DO-like protein [Azorhizobium caulinodans ORS 571]
          Length = 523

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 205/376 (54%), Gaps = 19/376 (5%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I   GYI+T+NH++ D        +D T+L A+LVG D   DLA+LKV+ ++  
Sbjct: 133 LGSGFVIDPTGYIVTNNHVIADADEIYANFNDGTKLKAELVGRDTKTDLALLKVKPEKPL 192

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
           + V+F D++ +RVG+ V  IGNPF L GT++ G++SA +RDI   P   F Q DA IN+G
Sbjct: 193 VSVKFGDSDKMRVGDWVMAIGNPFGLGGTLTVGVISARNRDINSGPYDNFLQTDAAINRG 252

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G VIGVN  I++     +G+G  +P S     I  L     V  GW G+ 
Sbjct: 253 NSGGPLFNMEGDVIGVNTAIISPSGGSIGIGFAVPSSTAGPVIAQLQQFKEVRRGWIGVR 312

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKE-SPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
            QN++ E+A  LG+   +G+L+  +  + SPA KAG+K GDVI   DG+ +K  +D    
Sbjct: 313 IQNVSDEIAESLGIGKARGALVGGLNDDNSPAAKAGVKAGDVIVKFDGKDVKDVRDLPRI 372

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSP----TAKNDMHLEVGD------KELLGMV 397
           +A     ++V I + ++G + ++ + +  +P    TA +    +  D      K++LG+ 
Sbjct: 373 VADTPVGKEVDIVVLRKGKEETLKITVARAPEEEKTAADKSKPQSADADKPVVKKVLGLE 432

Query: 398 LQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
           +  I D  ++  +I       V  + +R      KG++ G  IV V    VS   D+++ 
Sbjct: 433 VASITDDLRRRFKIKDTVKGVVITSVDRNSAAADKGLKAGQVIVEVGQEPVSAPADLQKR 492

Query: 451 IGKAKEKKRDSVLLQI 466
           +   K+  + S LL I
Sbjct: 493 VDALKKDNKKSALLLI 508


>gi|153004908|ref|YP_001379233.1| protease Do [Anaeromyxobacter sp. Fw109-5]
 gi|152028481|gb|ABS26249.1| protease Do [Anaeromyxobacter sp. Fw109-5]
          Length = 525

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 163/468 (34%), Positives = 238/468 (50%), Gaps = 33/468 (7%)

Query: 30  EAKLPPSSVDLPPVIARVSPSIVSVMVEPK-KKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
           EA +PP    L P+I +V  ++V++      K      M N +G        P    F+ 
Sbjct: 55  EAAVPPQG-SLAPLIEKVKGAVVNISTTTVIKHPQTRGMPNPHGQAPGGRGGPGDEEFQD 113

Query: 89  DFHKFFSGE-EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
            F +FF G   P + +       GSGF I+ DG+ILT+NH+V+D     V L+D  EL A
Sbjct: 114 FFERFFGGRPAPRMPEEFRGSSLGSGFVISPDGFILTNNHVVQDATDILVRLTDGRELKA 173

Query: 148 KLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           + VG D   D+A++++ +  K +P V   D++ +R G+ V  +G+PF LR T + GIVSA
Sbjct: 174 ETVGRDPATDVALIRLVNPPKDLPNVVLGDSDALRQGDFVLALGSPFGLRDTATLGIVSA 233

Query: 207 LDRDIPDRPGT---FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
             R   +  GT   F Q DA IN GNSGGP FN  G VIG+N  IV S Q   GVG  +P
Sbjct: 234 KHRREVNPTGTYDDFIQTDAAINSGNSGGPLFNLRGEVIGINTAIV-SPQLGSGVGFAVP 292

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL-RGTKGSLITAVVKESPADKA 322
           +++ K  +P L  KG+V  G+ G+   +L ++LA   GL    KG+LI AVV   PA KA
Sbjct: 293 INLAKSILPQLREKGKVTRGYVGVSITDLNRDLAQGFGLPPDQKGALIQAVVPRGPAAKA 352

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN 382
           G++ GDV+  ++G+ + S  D    +A   P  +V +++ + G K   +  +   P  + 
Sbjct: 353 GVQPGDVVVAVNGKPVTSGGDLTRAVALVQPGSKVDLTVVRSGQKKQFSFAVAQRPDDEE 412

Query: 383 DMH-------LEVGDKEL-LGMVLQD----------INDGNKKLVRIVALNPNREREVEA 424
            +         E GDK   LG+ L D          I  G   LVR VA      R    
Sbjct: 413 AIARGQGGEQEEGGDKAPKLGVTLGDLTPQIARQLGIEPGEGVLVRDVAPAGPAGR---- 468

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
            GI+ GM IV +N   V  ++DV + I  AK K  +  LL+++   D+
Sbjct: 469 AGIEPGMVIVELNRKPVKTVQDVAQAI--AKMKDGEVALLRVRRGQDL 514


>gi|197116644|ref|YP_002137071.1| periplasmic trypsin-like serine protease [Geobacter bemidjiensis
           Bem]
 gi|197086004|gb|ACH37275.1| periplasmic trypsin-like serine protease [Geobacter bemidjiensis
           Bem]
          Length = 458

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 161/485 (33%), Positives = 238/485 (49%), Gaps = 37/485 (7%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA 70
           +I    L   +F S+     A     + D   +  ++ P++V++       V   Q+   
Sbjct: 4   AIVARFLVLSVFLSSIFSTVAGASVLTPDFAKLAKKLKPAVVNISTSKTLAVKKRQI--- 60

Query: 71  YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
                 P   P + YF     KFF G  P      +R + G+GF I+DDGYI+T+NH+V+
Sbjct: 61  -----APGQDPFQEYF----DKFFEG--PHQRPQKQRNL-GTGFIISDDGYIITNNHVVK 108

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
           D     V LSD  E    + G D   DLA++K+ +          D++ + VG+ V  IG
Sbjct: 109 DADEIKVKLSDGREFAGDVKGRDEKLDLALVKIDAKDHLPVAPLGDSDKMEVGDWVMAIG 168

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           NPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FN  G VIG+N  IV
Sbjct: 169 NPFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNTEGEVIGINTAIV 228

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
             GQ   G+G  IP+++ K+ +P L S G+V  GW G+  Q +T +LA   GL   KG+L
Sbjct: 229 AGGQ---GIGFAIPVNMAKEILPQLKSAGKVTRGWLGVSVQLVTPDLAKSFGLDTEKGAL 285

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +  VVK SPA+KAG+K GD+I   DG  IK   +   ++A+    ++VK+ + +EG +  
Sbjct: 286 VADVVKGSPAEKAGLKGGDIILEYDGHPIKEMGELPRRVAATPVGKKVKVVVLREGRQEP 345

Query: 370 VAVVL------GSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVE 423
           + V +      G   +A     L V   EL     Q +     K V +  + P+     +
Sbjct: 346 LQVTVEQLKEGGEEDSAVTSDRLGVKVTELTPERAQQLRLQGDKGVVVTDVEPD--SLAD 403

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
             GI +G  I  +N   VS + D  +LI  AK+     +LL+              S FV
Sbjct: 404 RAGILEGDLIREINGVRVSGVSDYSKLIAAAKKGGYLKMLLR----------RGEASLFV 453

Query: 484 SLKID 488
           +L+++
Sbjct: 454 ALRLE 458


>gi|332702073|ref|ZP_08422161.1| protease Do [Desulfovibrio africanus str. Walvis Bay]
 gi|332552222|gb|EGJ49266.1| protease Do [Desulfovibrio africanus str. Walvis Bay]
          Length = 480

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 136/403 (33%), Positives = 211/403 (52%), Gaps = 32/403 (7%)

Query: 80  HPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
           +PL+ +FR  F +      P  S        GSGF I+ DG+I+T+NH+V+D AS  V+L
Sbjct: 76  NPLEEFFRDFFGEGMPMPRPQAS-------LGSGFIISQDGFIVTNNHVVQDAASIEVLL 128

Query: 140 SDDTE-LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGT 198
            D  +  PAK++GTD   DLA++K++   + +P+EF ++   +VGE V  +GNPF L  +
Sbjct: 129 DDGKDTYPAKVIGTDPETDLALIKIEPKTRLVPLEFGNSEQAKVGEWVLAVGNPFGLDHS 188

Query: 199 VSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           V+AGI+SA  R I   P   F Q DA IN GNSGGP  N  G VIG+N  IV +GQ   G
Sbjct: 189 VTAGIISAKGRVIGAGPYDNFIQTDASINPGNSGGPLINMAGKVIGINTAIVATGQ---G 245

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +G  +P  I +  I  L   G V  G  G+  Q++    A  LGL+  +G+L+ +V   S
Sbjct: 246 IGFAVPSDIARGVIQQLREHGEVRRGLLGVAIQDMDANTAKALGLKEAQGALVASVSPGS 305

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           PA +AG++ GDVI  ++G+ ++  +    +I +  P E+VK+++ + G +    V L   
Sbjct: 306 PAAEAGIRQGDVITRVNGQPVEDSRTLTMRIGAMPPGERVKLTVWRGGKQKEYTVKLAKR 365

Query: 378 PT------AKNDMHLEVGDKELLGMVLQDIND----------GNKKLVRIVALNPNRERE 421
                          +    ELLGM ++ + D          G   LV+ VA        
Sbjct: 366 SAEALGQMQPGQPGPQQPGGELLGMSMRKLTDQEASALGVEPGRGVLVQAVAPG----SP 421

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
            E  G+  G  I+ +N   V+   + +R+I +  ++K  ++LL
Sbjct: 422 AEENGVAPGDVILEINQQPVNNPAEAQRIINEDAKRKGVALLL 464


>gi|260459275|ref|ZP_05807530.1| protease Do [Mesorhizobium opportunistum WSM2075]
 gi|259034829|gb|EEW36085.1| protease Do [Mesorhizobium opportunistum WSM2075]
          Length = 464

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 138/396 (34%), Positives = 204/396 (51%), Gaps = 26/396 (6%)

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAK 148
           DF   F G  PI     E L  GSGF I+ +GYI+T+NH+V D     V+ SD    PA+
Sbjct: 65  DFLNPFDGRGPIQPQVREAL--GSGFVISPEGYIVTNNHVVADSTEIHVVFSDKETSPAR 122

Query: 149 LVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALD 208
           LVG D   D+AVLKV          + D++ ++ G     IG+PF L GTV+ G++SA  
Sbjct: 123 LVGRDPATDIAVLKVDPRPNMTIAVWGDSDAMQPGAWTIAIGSPFGLGGTVTVGVLSARS 182

Query: 209 RDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSII 267
           RDI   P   F Q DA IN+GNSGGP FNA G VIGVN  IV+     +G+G  +P    
Sbjct: 183 RDIQAGPYDDFLQTDASINRGNSGGPLFNARGEVIGVNTAIVSPSGGSIGIGFAVPSRTA 242

Query: 268 KKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVG 327
           +     LI  GR++ G+ G+  Q +T  LA  LG+ GTKG+L+ +V   SPA+KAG++ G
Sbjct: 243 RSIADQLIRTGRIERGFIGVRLQEVTPSLAEALGMSGTKGALVASVEPGSPAEKAGLRSG 302

Query: 328 DVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE 387
           DVI   +G+ I+   D     A+  P  +  ++  + GS+  V + +G     + D  + 
Sbjct: 303 DVITRFNGKDIQGVHDLTLAAANEKPGSRATLTRNRGGSQQEVELTVGQ----RKDEEMR 358

Query: 388 VG-------DKELLGMVLQDINDGNKKL---------VRIVALNPNREREVEAKGIQKGM 431
            G         + LG+ L  I D  ++          V +  + PN        G++ G 
Sbjct: 359 TGAVPNPEAADQGLGLSLSPIPDEARQQLGLQPGTTGVFVQEVAPN--SLAAESGLKPGD 416

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            IVS N   V+   DV +   K++++ +  +L +I+
Sbjct: 417 VIVSANNQNVTQPSDVRQEWAKSRQQNK-PILFRIE 451


>gi|951170|gb|AAC43669.1| RmDEGP [Sinorhizobium meliloti]
 gi|1586653|prf||2204296A periplasmic endopeptidase
          Length = 484

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 185/322 (57%), Gaps = 17/322 (5%)

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
           +F+VI++D TEL AKLVG D+  DLAVLKV   RKF  V F D   +RVG+ V  +GNPF
Sbjct: 160 TFTVIMNDGTELDAKLVGKDSRTDLAVLKVDDKRKFTYVSFADDEKVRVGDWVVAVGNPF 219

Query: 194 RLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
            L GTV+AGI+SA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I +  
Sbjct: 220 GLGGTVTAGIISARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPS 279

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
             ++G+   IP S+ K  + SLI  G V  GW G+  Q +T+++A  LGL    G+L+  
Sbjct: 280 GGNVGIAFAIPASVAKDVVDSLIKDGTVSRGWLGVQIQPVTKDIAESLGLSEANGALVVE 339

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
               SP +KAG+K GDV+  L+G  +K  +D   ++A+  P    +++L + G   +V +
Sbjct: 340 PQAGSPGEKAGIKNGDVVTALNGEPVKDPRDLARRVAALRPGSTAEVTLWRSGKSETVNL 399

Query: 373 VLGSSPTAKNDMHLEVGDKEL------------LGMVLQDINDGNKKLVRIVALNPNRER 420
            +G+ P+   +     G+ +             LG+ +    DG  K V I +++P  + 
Sbjct: 400 EIGTLPSDAKEPAPATGEAQPDEGQAGEEALADLGLTVTPSEDG--KGVTIASVDP--DS 455

Query: 421 EVEAKGIQKGMTIVSVNTHEVS 442
           +   +G+++G  IVSVN  EV+
Sbjct: 456 DAGDRGLKEGEKIVSVNNQEVN 477


>gi|292490845|ref|YP_003526284.1| protease Do [Nitrosococcus halophilus Nc4]
 gi|291579440|gb|ADE13897.1| protease Do [Nitrosococcus halophilus Nc4]
          Length = 471

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 141/459 (30%), Positives = 233/459 (50%), Gaps = 30/459 (6%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   ++   SP++V++     +KV+       +G    PE  P +++FR+     F GE 
Sbjct: 29  DFTELVKNSSPAVVNIST--TQKVTQRGPRLPHGLHQFPEGSPFEDFFRR-----FFGEG 81

Query: 99  PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
                + E    GSGF I+ DGY++T+ H++ D     V  SD +EL A++VG D   DL
Sbjct: 82  EGEPRSFETHSLGSGFIISSDGYVITNYHVIRDADEIIVRFSDRSELEAEVVGGDERSDL 141

Query: 159 AVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           A+LKV    K +P ++  D++ ++VGE V  IG+PF    + +AGIVSAL R +P     
Sbjct: 142 ALLKVNG--KGLPTLKQGDSSQLKVGEWVLAIGSPFGFEHSATAGIVSALGRSLPRESYV 199

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D  IN GNSGGP FN  G V+G+N+ I +     MG+   IP+ +  + +  L  
Sbjct: 200 PFIQTDVAINPGNSGGPLFNLAGEVVGINSQIYSRTGGFMGLSFAIPIDVAMEVVEQLKE 259

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
           KG+V  GW G++ Q++T+ELA   GL   +G+L+  V+ +SPA K G++ GD+I   +G 
Sbjct: 260 KGQVSRGWLGVVIQDVTRELAESFGLEKPQGALVARVLADSPAAKGGIQAGDIITRFNGN 319

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD-----K 391
           ++    D    +       +V + + +  ++ ++ V +G  P  + ++   VG      +
Sbjct: 320 LVPQSSDLPPLVGRTEIGHKVDVQILRASAQKTLKVKIGELPE-EEELRKAVGRPGQTFE 378

Query: 392 ELLGMVLQDINDGNKK---LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
           + L + + D+ D  +    L   V +    E      G+++G  I+ +N  EV  I   +
Sbjct: 379 KRLAIEVTDLGDEERAQLDLTSGVQITRVEEGPAAEAGLRRGDIILGINNTEVKDISQFK 438

Query: 449 RLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            L+GK    K   +LLQ              + FV++KI
Sbjct: 439 ELVGKLPAGKSVPLLLQ----------RGQTTSFVAIKI 467


>gi|126740009|ref|ZP_01755699.1| periplasmic serine protease, DO/DeqQ family protein [Roseobacter
           sp. SK209-2-6]
 gi|126718828|gb|EBA15540.1| periplasmic serine protease, DO/DeqQ family protein [Roseobacter
           sp. SK209-2-6]
          Length = 479

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 146/482 (30%), Positives = 246/482 (51%), Gaps = 39/482 (8%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           + +    L+ V+  +  ++ +A+  P S  L P+  +VSP++V++         +E    
Sbjct: 3   RMLWLAMLSFVLIVAQAMIAQAR--PES--LAPLADKVSPAVVNITT----STVIEGRTG 54

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGE-EPILSDTVERLMFGSGFFITDDGYILTSNHI 128
             G   +PE  P + +FR +F     GE  P  S        GSGF I++DGYI+T+NH+
Sbjct: 55  PQGI--VPEGSPFEEFFR-EFQDRNRGEGRPQRSSA-----LGSGFVISEDGYIVTNNHV 106

Query: 129 VEDGASFSVIL-----SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           ++      +            LPAK++GTD   D+A+LKV++      V F D++ +RVG
Sbjct: 107 IDKADEIQIEFFPGEGQPGELLPAKVIGTDPNTDIALLKVEAPMPLKFVNFGDSDVMRVG 166

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIG 243
           + V  +GNP     +VSAGIVS  +R++      + Q DA IN+GNSGGP FN  G VIG
Sbjct: 167 DWVMAVGNPLGQGFSVSAGIVSQRNRELQGAYDDYIQTDAAINRGNSGGPLFNMDGDVIG 226

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           VN  I++     +G+G  +  +++ K +  L   G    GW G+  Q++ +++A  +GL 
Sbjct: 227 VNTAILSPNGGSIGIGFSMASNVVTKVVNQLKEFGETRRGWLGVRIQDVDEDVAEAIGLE 286

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
           GT+G L+   V + PA  AGM+ GDVI   DG+ +   +  V  + +    + V++ + +
Sbjct: 287 GTEGVLVND-VPDGPAKDAGMQAGDVILSFDGKDVPDTRSLVRTVGNTEVGKTVRVVVYR 345

Query: 364 EGSKHSVAVVLGSSPTA---------KNDMHLEVGDKELLGMVLQDINDG-------NKK 407
           EG   ++ V LG    A         K++    V +KE+LG+ +  + D          K
Sbjct: 346 EGKTETLKVTLGRREEAERQASDEPEKSETEPTVTEKEILGLTVGVLTDSVRTELNLTDK 405

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
           +  ++ L+ +   E   KG++ G  I   +  +VS I  +E  + +AKE  R S+LL ++
Sbjct: 406 IEGLIILSVDETTEAWEKGLRAGDVITEADQQKVSTISALETRVTEAKEAGRKSLLLLVR 465

Query: 468 YD 469
            +
Sbjct: 466 RN 467


>gi|222099068|ref|YP_002533636.1| Heat shock serine protease, periplasmic [Thermotoga neapolitana DSM
           4359]
 gi|221571458|gb|ACM22270.1| Heat shock serine protease, periplasmic [Thermotoga neapolitana DSM
           4359]
          Length = 460

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 152/474 (32%), Positives = 249/474 (52%), Gaps = 45/474 (9%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           +K    + LT V+ SS +  +    P     +  V+   +P++V + V    + S    F
Sbjct: 1   MKKFLALILTVVVLSSVFPYVN---PDYESPIVKVVEACAPAVVKIDVTKTVRTS---FF 54

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
           + Y           +++FRK F +   G E  +S        GSGF    +GYILT+ H+
Sbjct: 55  DPY----------FEDFFRKWFGELPPGFERQVSS------LGSGFIFDPEGYILTNYHV 98

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVF 187
           V    + +V L D ++  A+ +G D   D+AV+K++ +D+KF  + F D++ +++GE   
Sbjct: 99  VGGADNITVTLLDGSKYDAEYIGGDEELDIAVIKIKATDKKFPYLGFGDSDKVKIGEWAI 158

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGT-----FTQIDAPINQGNSGGPCFNALGHVI 242
            IGNP   + TV+ G+VSA +R IP   G+       Q DA IN GNSGGP  N  G VI
Sbjct: 159 AIGNPLGFQHTVTVGVVSATNRKIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVI 218

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N  IV   Q  + +G  IP++ +KK + ++++K +V+  + G+    LT+E A  LGL
Sbjct: 219 GINTAIVNP-QEAVNLGFAIPINTVKKFLDTILTKKKVEKAYLGVTVMTLTEETAKALGL 277

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
             T G+LIT+V K SPA+KAG+K GDVI  +D + ++SH++ V  I +  P +   +++ 
Sbjct: 278 ETTSGALITSVQKGSPAEKAGLKEGDVILKVDDQDVRSHEELVSIIHTYKPGDTATLTIE 337

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREV 422
           ++G    V V  GSS   +          ++LG+ + +I   +++   I    P   R V
Sbjct: 338 RKGKIMKVQVTFGSSSEEETAAAEGEKTIDVLGITVANITPADRETYSI----PEEIRGV 393

Query: 423 EAK------GIQKGMTIVSV----NTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
             +      GIQKG  IV+V      ++++ ++D+ER+   +  KK D V L I
Sbjct: 394 IVRESSGKFGIQKGDIIVAVYINGRRYDINSVEDLERV--ASGIKKGDYVALYI 445


>gi|163852076|ref|YP_001640119.1| protease Do [Methylobacterium extorquens PA1]
 gi|163663681|gb|ABY31048.1| protease Do [Methylobacterium extorquens PA1]
          Length = 511

 Score =  216 bits (551), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 141/417 (33%), Positives = 220/417 (52%), Gaps = 28/417 (6%)

Query: 76  LPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
           LP+  P ++ F + F +   G     +E     T +    GSGF I   G ++T+NH++ 
Sbjct: 82  LPQGTPFEDLFEEFFKRRGQGAPKGDDESPRGPTRKSNSLGSGFIIDASGIVVTNNHVIG 141

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ--SDRKFIPVEFEDANNIRVGEAVFT 188
           D     VILSD T+L A+++G D+  DLA+L+V+  ++R    V F D++ +R G+ V  
Sbjct: 142 DANDIQVILSDGTKLKAEIIGKDSKIDLALLRVKPTAERPLKAVPFGDSDKMRPGDWVMA 201

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  
Sbjct: 202 IGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINTA 261

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTK 306
           I++     +G+G  +P +   + +  L   G V  GW G+  QN+ +  A  LGL+ G K
Sbjct: 262 ILSPSGGSVGIGFAVPSATAGQVVDQLRQFGEVRRGWIGVRIQNVDEATAEALGLKGGAK 321

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G 
Sbjct: 322 GALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKSVDVQVVRKGE 381

Query: 367 KHSVAVVLGSSPTAKNDM-------HLEVGDKELLGMVLQDINDGNKKLVRI-------- 411
           + + +VVLG     +            E  ++++LG+ L  +ND  ++   I        
Sbjct: 382 EQTKSVVLGRLEDGEKAQVANLKQPEAESVNRQVLGLNLSGLNDEVRRRYGIKESVKTGV 441

Query: 412 --VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               ++PN       K IQ G  IV V    +S   DV + +   K++ R SVLL +
Sbjct: 442 VVTKVDPN--STAADKRIQPGEVIVEVGQEAISNPADVTKRVEALKKEGRKSVLLLV 496


>gi|82702872|ref|YP_412438.1| peptidase S1C, Do [Nitrosospira multiformis ATCC 25196]
 gi|82410937|gb|ABB75046.1| Peptidase S1C, Do [Nitrosospira multiformis ATCC 25196]
          Length = 473

 Score =  216 bits (551), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 153/479 (31%), Positives = 236/479 (49%), Gaps = 42/479 (8%)

Query: 12  ICTVALTCVIFSSTYLVLEA---KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           I    L  ++  ST +  +A   +LP    D   ++ R  PS+V++        + E+ F
Sbjct: 2   IAKFLLVVLLGLSTSVFAQAPARELP----DFTGLVEREGPSVVNISTVQSGNSTTERAF 57

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
              G  N+PED P   +FR+  H    G  P      E    GSGF I+ DGYILT+ H+
Sbjct: 58  --PGIPNIPEDDPFFEFFRR--HMQPHGGMP---RDFESRSVGSGFIISSDGYILTNTHL 110

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVF 187
           V+     +V L+D  E  AKL+G D   D+A+LK+  D   +P V   D NN++VGE V 
Sbjct: 111 VDGADEINVKLTDKREFRAKLIGADRKTDIALLKI--DATGLPKVTQGDPNNMKVGEWVV 168

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IG+PF    +V+AGIVSA  R +       F Q D  IN GNSGGP FN  G V+GVN+
Sbjct: 169 AIGSPFGFENSVTAGIVSAKGRSLAQENFVPFIQTDVAINPGNSGGPLFNMNGEVVGVNS 228

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
            I +     MG+   IP+ + +     LI+ G+V  G  G++ Q +T+ELA   GL    
Sbjct: 229 QIYSRTGGFMGLSFAIPIDVARDISNQLIASGKVSRGRIGVLIQEITKELAESFGLPKPA 288

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+ +V K  PADKAG++  DVI   DG+ + S  D    + S  P  +V++ + + GS
Sbjct: 289 GALVASVQKGGPADKAGIQARDVILKFDGKTVNSSGDLPRIVGSTKPGTKVQMQVWRNGS 348

Query: 367 KHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAK- 425
                + +   P  +             G   +  +  N+  + ++ L P++++E+E + 
Sbjct: 349 TKEFTITVDELPEDEKPAARS-------GKRGKTPDTANRIGLSLIELTPDQKKELETES 401

Query: 426 ---------------GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
                          G++ G  I+S+N  +V  +    +L+ K  EK R+  LL  + D
Sbjct: 402 GLLVEDMVPGIASRAGVRPGDVILSINNQDVKTVDQFNQLLNKV-EKGRNIALLVKRGD 459


>gi|88607445|ref|YP_505690.1| protease DO family protein [Anaplasma phagocytophilum HZ]
 gi|88598508|gb|ABD43978.1| protease DO family protein [Anaplasma phagocytophilum HZ]
          Length = 490

 Score =  216 bits (551), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 155/481 (32%), Positives = 253/481 (52%), Gaps = 24/481 (4%)

Query: 4   RQILSVKSICTVALTCVIFSS----TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPK 59
           R+ LS    C +      F+S    + L +     PS+     + +++ PS+V++  E  
Sbjct: 2   RRFLSFFFFCALVWGHCAFASEVASSALRVSENNGPSTRGFSDLASKLLPSVVNISTEQT 61

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDT---VERLMFGSGFFI 116
            +          G        P     R  F  FF+  EP+  +     + +  GSGF I
Sbjct: 62  VEGDDLAGDGGGGSIFGFPGIP-----RGFFEGFFNSIEPLFVEPPKPRKVISLGSGFII 116

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
            + G I+T+ H++ +     V  SD T   AK++G D   DLAVLKV   ++ + V+  +
Sbjct: 117 DESGLIVTNYHVIANSQEIQVKFSDGTTAKAKVLGQDPKTDLAVLKVDVAKELVSVKLGN 176

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCF 235
           +++  VGE V  IGNPF L G+VS GI+S   RDI       F Q DA IN+G+SGGP F
Sbjct: 177 SDDALVGEWVLAIGNPFGLGGSVSVGIISGRARDINIGTASEFLQTDAAINRGHSGGPLF 236

Query: 236 NALGHVIGVNAMIVT-SGQFHMGVGLIIPLSIIKKAIPSLISKG-RVDHGWFGIMTQNLT 293
           NA G VIG+N  I++  G  ++GV   IP +   + I S++SKG +V+HGW G++ Q++T
Sbjct: 237 NADGEVIGINTAIISPQGGGNVGVAFAIPSNNAARVI-SILSKGEKVEHGWLGVIVQHVT 295

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
           + +  PLGL    G+L++ VVK SPA+K G++VGDVI   +G+ ++        IA  + 
Sbjct: 296 EGMVEPLGLDSAHGALVSNVVKGSPAEKGGLRVGDVILEYNGKRVEDMSQLTNLIAKTAV 355

Query: 354 KEQVKISLCKEGSKHSVAVVL-----GSSPTAKNDMHLEVGDKELLGMVLQDINDGN-KK 407
            E+V++ + + G + ++ + +     G+   +  +  LE G  E LG+ + D+ +G+ KK
Sbjct: 356 NEKVRLLVLRGGKQVTLKITIGKLEEGADGASGKNGSLETG-TESLGITVGDMPEGDGKK 414

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK-AKEKKRDSVLLQI 466
              +V L  +      A+GI++G  IV ++   V  + D    + K  +  K+DSVLL +
Sbjct: 415 RDGVVVLRVDNRGAAFAEGIRRGDVIVGIDAVLVRNVADFTSELEKILQSTKKDSVLLLV 474

Query: 467 K 467
           +
Sbjct: 475 Q 475


>gi|254561820|ref|YP_003068915.1| serine protease [Methylobacterium extorquens DM4]
 gi|254269098|emb|CAX25061.1| putative serine protease precursor [Methylobacterium extorquens
           DM4]
          Length = 511

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 141/417 (33%), Positives = 220/417 (52%), Gaps = 28/417 (6%)

Query: 76  LPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
           LP+  P ++ F + F +   G     +E     T +    GSGF I   G ++T+NH++ 
Sbjct: 82  LPQGTPFEDLFEEFFKRRGQGVPKGDDESPRGPTRKSNSLGSGFIIDASGIVVTNNHVIG 141

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ--SDRKFIPVEFEDANNIRVGEAVFT 188
           D     VILSD T+L A+++G D+  DLA+L+V+  ++R    V F D++ +R G+ V  
Sbjct: 142 DANDIQVILSDGTKLKAEIIGKDSKIDLALLRVKPTAERPLKAVPFGDSDKMRPGDWVMA 201

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  
Sbjct: 202 IGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINTA 261

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTK 306
           I++     +G+G  +P +   + +  L   G V  GW G+  QN+ +  A  LGL+ G K
Sbjct: 262 ILSPSGGSVGIGFAVPSATAGQVVDQLRQFGEVRRGWIGVRIQNVDEATAEALGLKGGAK 321

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G 
Sbjct: 322 GALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKSVDVQVVRKGE 381

Query: 367 KHSVAVVLGSSPTAKNDM-------HLEVGDKELLGMVLQDINDGNKKLVRI-------- 411
           + + +VVLG     +            E  ++++LG+ L  +ND  ++   I        
Sbjct: 382 EQTKSVVLGRLEDGEKAQVANLKQPEAESVNRQVLGLNLSGLNDEVRRRYGIKESVKTGV 441

Query: 412 --VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               ++PN       K IQ G  IV V    +S   DV + +   K++ R SVLL +
Sbjct: 442 VVTKVDPN--STAADKRIQPGEVIVEVGQEAISNPADVTKRVEALKKEGRKSVLLLV 496


>gi|240139404|ref|YP_002963879.1| putative serine protease precursor [Methylobacterium extorquens
           AM1]
 gi|240009376|gb|ACS40602.1| putative serine protease precursor [Methylobacterium extorquens
           AM1]
          Length = 511

 Score =  216 bits (550), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 141/417 (33%), Positives = 220/417 (52%), Gaps = 28/417 (6%)

Query: 76  LPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
           LP+  P ++ F + F +   G     +E     T +    GSGF I   G ++T+NH++ 
Sbjct: 82  LPQGTPFEDLFEEFFKRRGQGAPKGDDESPRGPTRKSNSLGSGFIIDASGIVVTNNHVIG 141

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ--SDRKFIPVEFEDANNIRVGEAVFT 188
           D     VILSD T+L A+++G D+  DLA+L+V+  ++R    V F D++ +R G+ V  
Sbjct: 142 DANDIQVILSDGTKLKAEIIGKDSKIDLALLRVKPTAERPLKAVPFGDSDKMRPGDWVMA 201

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  
Sbjct: 202 IGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINTA 261

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTK 306
           I++     +G+G  +P +   + +  L   G V  GW G+  QN+ +  A  LGL+ G K
Sbjct: 262 ILSPSGGSVGIGFAVPSATAGQVVDQLRQFGEVRRGWIGVRIQNVDEATAEALGLKGGAK 321

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G 
Sbjct: 322 GALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKSVDVQVVRKGE 381

Query: 367 KHSVAVVLGSSPTAKNDM-------HLEVGDKELLGMVLQDINDGNKKLVRI-------- 411
           + + +VVLG     +            E  ++++LG+ L  +ND  ++   I        
Sbjct: 382 EQTKSVVLGRLEDGEKAQVANLKQPEAESVNRQVLGLNLSGLNDEVRRRYGIKESVKTGV 441

Query: 412 --VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               ++PN       K IQ G  IV V    +S   DV + +   K++ R SVLL +
Sbjct: 442 VVTKVDPN--STAADKRIQPGEVIVEVGQEAISNPADVTKRVEALKKEGRKSVLLLV 496


>gi|254429264|ref|ZP_05042971.1| protease Do subfamily [Alcanivorax sp. DG881]
 gi|196195433|gb|EDX90392.1| protease Do subfamily [Alcanivorax sp. DG881]
          Length = 478

 Score =  216 bits (550), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 152/478 (31%), Positives = 241/478 (50%), Gaps = 40/478 (8%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD------LPPVIARVSPSIVSVMV 56
           K+ IL V  + T  L CV FS     ++A LP  + +      L P++ + SP++V++ +
Sbjct: 21  KKPILPVVWVLT--LLCVAFSP----VQAALPAVTAEGDALPSLAPMLEKTSPAVVNIAI 74

Query: 57  EPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI 116
           E + + +   + N           P        F +FF   E            GSG  +
Sbjct: 75  ETRVRAARNPLMN----------DPF-------FRRFFDMPERQRPSERRAASAGSGVIV 117

Query: 117 -TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
              +GY+LT+ H+V++  +  V L+D  EL A+LVG D   DLAVLK++   +   +   
Sbjct: 118 DAAEGYVLTNAHVVKNADNIEVTLTDGRELSAELVGVDEEVDLAVLKLEESDRLTQIAIA 177

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG--TFTQIDAPINQGNSGGP 233
           D+  +RVG+ V  IGNPF L  TV++GIVSAL R      G  +F Q DA IN GNSGG 
Sbjct: 178 DSTGLRVGDFVVAIGNPFGLGQTVTSGIVSALGRTGLGIEGYESFIQTDASINPGNSGGA 237

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
             N  G ++G+N  I+     ++G+G  IP  + +  +  LI  G V  G  G+  Q+LT
Sbjct: 238 LVNLRGELVGINTAILAPAGGNVGIGFAIPTEMAENVMQQLIEHGEVRRGMLGVTIQDLT 297

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
            ELA   G+   +G +IT VV++S A+KAG+K GDV+  +DGR +    D   ++     
Sbjct: 298 AELAEAFGVERQRGVVITQVVEDSAAEKAGLKSGDVVTAVDGRPVNRAADLRNKVGMAPV 357

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVA 413
            E+V++S+ ++G K  V  V+  S +++     E   K L G  L+D+  G  +      
Sbjct: 358 GEKVELSILRDGKKKDVTAVI--SESSRETAGGEAVSKFLEGANLRDLRKGELQHADAGV 415

Query: 414 LNPNREREVEA--KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           L    ER   A   G++ G  I++VN  +V  + ++     KA   K  ++LL++  +
Sbjct: 416 LVDEVERGSPAWRAGLRNGDVIINVNRQDVDTMDELR----KAVNDKEAALLLRVNRN 469


>gi|13471471|ref|NP_103037.1| serine protease [Mesorhizobium loti MAFF303099]
 gi|14022213|dbj|BAB48823.1| probable serine protease [Mesorhizobium loti MAFF303099]
          Length = 504

 Score =  216 bits (550), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 160/514 (31%), Positives = 243/514 (47%), Gaps = 36/514 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M    +L       +A T  +   T        P  + D P  +A ++  ++  +V    
Sbjct: 1   MTSTPLLRAARRTLIAGTAALLVGTVAAPSFVTPVFAADGPASVADLAQGVLGAVVNIST 60

Query: 61  KVSVE--QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-T 117
             +V+  +   A     LPE  P +++F   F K   G++      V+ L  GSGF I  
Sbjct: 61  SQTVKGTEGPGAVPMPQLPEGSPFQDFFDD-FFKNRGGDKDNSGQKVQSL--GSGFVIDA 117

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFED 176
           + G ++T+NH++ D     V  SD   L A LVGTD   D+AVLKV     K   V+F D
Sbjct: 118 EQGIVVTNNHVIADADDIEVNFSDGVTLKATLVGTDTKTDVAVLKVDPKGHKLTAVKFGD 177

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCF 235
           +  +RVG+ V  +GNPF L GTV+ GIVSA +RDI   P   F Q DA IN+GNSGGP F
Sbjct: 178 STKMRVGDWVMAVGNPFGLGGTVTVGIVSARNRDINSGPYDDFIQTDAAINRGNSGGPLF 237

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N+ G VIG+N  I++     +G+G  IP  +    +  L   G    GW G+  Q +T +
Sbjct: 238 NSAGEVIGINTAIISPSGGSIGIGFSIPSQLASGVVDQLRQFGETRRGWLGVRIQPVTDD 297

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           +A  LG+   KG+L+  V+K  P D   ++ GDVI   DG+ I   +D    +A     +
Sbjct: 298 IAESLGMATAKGALVAGVIKGGPVDNGTIQAGDVIIKFDGKDIHEMRDLPRVVAESPVGK 357

Query: 356 QVKISLCKEGSKHSVAVVL--------------GSSPTAKNDMHLEVGDKELLGMVLQDI 401
            V + + ++G + +V V L              G++   K +    V    +LGM + ++
Sbjct: 358 AVDVLIVRKGVEQTVKVTLGRLEDGEKLASGGNGNTDQDKGNKAPAVSTASVLGMTVGEL 417

Query: 402 NDGNKKLVRIVA-------LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           ND  +K   I A        +  ++     +GIQ G  I  +    V+  KDV   IG  
Sbjct: 418 NDETRKKFSIAADVSGVVITDVAKDSAAAERGIQPGEVITEIAQESVATPKDVMDRIGAL 477

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           KE+ R + LL       M +      RFV++++D
Sbjct: 478 KEQGRKNALL-------MLASKTGELRFVTIRMD 504


>gi|110679212|ref|YP_682219.1| serine protease DO-like precursor, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455328|gb|ABG31533.1| serine protease DO-like precursor, putative [Roseobacter
           denitrificans OCh 114]
          Length = 487

 Score =  216 bits (549), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 143/466 (30%), Positives = 234/466 (50%), Gaps = 43/466 (9%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           L P+  ++SPS+V++                   G +PE  P +++FR           P
Sbjct: 45  LAPLAEKISPSVVNITTSTTVSRRTGPQ------GIVPEGSPFEDFFRD--RNIGPEGAP 96

Query: 100 ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
             S        GSGF I++DGY++T+NH++E      +   D  EL A++VGTD   D+A
Sbjct: 97  RRSSA-----LGSGFVISEDGYVVTNNHVIEGADEILIEFFDGGELVAEVVGTDPNTDIA 151

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT 219
           +LKV++D     V F D+++ RVG+ V  +GNP     +VSAGIVSA +R++  R   + 
Sbjct: 152 LLKVEADAPLPFVSFGDSDSARVGDWVIAMGNPLGQGFSVSAGIVSARNRELSGRYDDYI 211

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++ + +  L   G 
Sbjct: 212 QTDAAINRGNSGGPLFNMDGEVIGVNTAILSPTGGSIGLGFSMAANVVTRVVDQLQEFGE 271

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
              GW G+  Q++T+++A  +GL  T G+ +  V+ E PA +AG+++GDVI   DGR ++
Sbjct: 272 TRRGWLGVQIQDVTEDMAEAMGLASTDGAAVNGVL-EGPAMEAGIEIGDVIISFDGRDVE 330

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEV--------GDK 391
             +  V Q+ +    E V++ + +     ++ V LG    A+  +               
Sbjct: 331 DTRGLVRQVGNTPVGEAVRVVVRRGDETKTLLVTLGRREEAEGAVPAVAQAPEDDAPTSA 390

Query: 392 ELLGMVLQDINDGNKKLVRIVALNPNRE----------REVEAKGIQKGMTIVSVNTHEV 441
           E++G+ L  +ND   +L   +   P  E           E   KG++ G  I      +V
Sbjct: 391 EMMGLTLMVLND---ELREQLGATPETEGLAVMEVDEASEAFEKGLRAGDVITEAGQKKV 447

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           + I D+E  + +A+E  R S+LL ++   D         RFV+L +
Sbjct: 448 TSIADLETRVEEAREAGRKSLLLLVRRAGD--------PRFVALSL 485


>gi|254467631|ref|ZP_05081040.1| periplasmic serine protease, DO/DeqQ family [Rhodobacterales
           bacterium Y4I]
 gi|206684379|gb|EDZ44863.1| periplasmic serine protease, DO/DeqQ family [Rhodobacterales
           bacterium Y4I]
          Length = 371

 Score =  216 bits (549), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 189/335 (56%), Gaps = 15/335 (4%)

Query: 43  VIARVSPSIVSVMVEPKKK-VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL 101
           ++  V+P++V V V  K + VS  Q         +P D  ++ + R+     F G  P  
Sbjct: 43  LVETVAPAVVYVEVTGKAQPVSDHQA--------MPNDPLMEEFMRR-----FGGRMPQQ 89

Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
            D+      GSGF I ++G I+T+NH++E+  + +V L+D ++  A +VGTD L D+A+L
Sbjct: 90  PDSRPMKGAGSGFVIAEEGLIVTNNHVIENAQTVTVTLADGSKHDATVVGTDPLTDIALL 149

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQ 220
           KV +D     VEF  +  +RVG+ V  +G+PF L GTV++GIVSA  R+I   P   F Q
Sbjct: 150 KVAADAPLPVVEFGSSGELRVGDEVIAMGSPFGLSGTVTSGIVSATSRNINSGPFDDFIQ 209

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
            DA IN+GNSGGP FNA G V+GVN  I + G   +G+G  +P  +++K +  L   G +
Sbjct: 210 TDAAINRGNSGGPLFNAEGEVVGVNTAIYSPGGGSVGIGFAVPSDMVQKIVADLEDDGEI 269

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             GW G+  + L+++ A  LG    KG +I  V  +SPA KAG+K GDV+    G  I  
Sbjct: 270 TRGWLGVQIKPLSEDAANVLGREAGKGVVIEGVQADSPAAKAGLKPGDVVLRFGGAAIDE 329

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
            +D    +A  +P E  +I + ++G   ++ V LG
Sbjct: 330 LRDLTAAVAMNAPGESAQIEVLRQGKALTLDVTLG 364


>gi|149200767|ref|ZP_01877742.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. TM1035]
 gi|149145100|gb|EDM33126.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. TM1035]
          Length = 470

 Score =  216 bits (549), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 225/430 (52%), Gaps = 31/430 (7%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE  P +++F +   +   G+ P  S        GSGF I++DG+++T+NH++E     
Sbjct: 52  VPEGSPFEDFFEQFRDRLGEGDRPQRSSA-----LGSGFVISEDGFVVTNNHVIESADEI 106

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            +       L A+++GTD   D+A+LKV++D+    V F D++  RVG+ V  +GNP   
Sbjct: 107 IIEFFSGETLAAEVIGTDPKTDIALLKVKADKPLPFVSFGDSDTARVGDWVLAMGNPLGQ 166

Query: 196 RGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
             ++SAGIVSA +R +      F Q DA IN+GNSGGP FN  G V+GVN  I++     
Sbjct: 167 GFSLSAGIVSARNRALSGTYDDFIQTDAAINRGNSGGPLFNLDGQVVGVNTAILSPTGGS 226

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +  +++K+ +  L   G    GW G+  Q++T ++A  +GL    G+L+T  V 
Sbjct: 227 IGIGFSMASNVVKRVVDQLQEFGETRRGWLGVRIQDVTADVAEAMGLEKAAGALVTD-VP 285

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           E PA  AGM  GDVI   DG+ +   +  V  + +    + V++ + +EG   ++ + LG
Sbjct: 286 EGPAADAGMLAGDVITSFDGQDVSDTRSLVRTVGNTEVGKTVRVVVFREGKTTTLKITLG 345

Query: 376 SSPTAKNDMHL-EVG---------DKELLGMVLQDINDG-------NKKLVRIVALNPNR 418
               A+  + + + G         +K +LG+ L  ++D        +     +V +N + 
Sbjct: 346 RREEAEGAIPVAQPGEEATPEAPVEKTILGLTLTPLSDELRAQLELDNSATGLVVVNIDE 405

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
             E   KG++ G  I      +V+ I D++  I +AKE  R S+L+ ++      SG D 
Sbjct: 406 LSEAYEKGLRAGDVITEAGQQKVASISDLDDRIAEAKEAGRKSLLMLVR------SGGD- 458

Query: 479 MSRFVSLKID 488
             RFV+L I+
Sbjct: 459 -PRFVALSIE 467


>gi|325293411|ref|YP_004279275.1| serine protease DO-like precursor [Agrobacterium sp. H13-3]
 gi|325061264|gb|ADY64955.1| serine protease DO-like precursor [Agrobacterium sp. H13-3]
          Length = 514

 Score =  216 bits (549), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 132/405 (32%), Positives = 209/405 (51%), Gaps = 22/405 (5%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM 67
           S+ ++   AL     S+          P+SV      A ++  ++  +V     +S  Q 
Sbjct: 12  SIAAVAGFALVAGSLSAPVAAWAQSHGPASV------ADLAAPLLDAVV----NISTSQN 61

Query: 68  FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNH 127
               G G +P   P  + F++ F  +F  ++P   D V  L  GSGF I   GYI+T+NH
Sbjct: 62  VKTEGKGPVPPKLPEGSPFQEFFKDYFDNQKPEGGDKVSSL--GSGFVIDPAGYIVTNNH 119

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
           ++E   +  VI  + ++L A LVGTD   DL+VLKV+       V+F D+ ++R+G+ V 
Sbjct: 120 VIEGADAIEVIFPNGSKLKATLVGTDTKTDLSVLKVEPKAPLKAVKFGDSRSMRIGDWVM 179

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            +GNPF L G+++ G+VSA  R+I   P   F Q DA IN+GNSGGP FN  G VIG+N 
Sbjct: 180 AVGNPFGLGGSLTVGVVSARGRNINAGPYDNFIQTDAAINKGNSGGPLFNMKGEVIGINT 239

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
            I++     +G+G  +P  + +  +  LI  G    GW G+  Q +T ++A  LG+   K
Sbjct: 240 AIISPSGGSIGIGFAVPTELAQNIVEQLIQFGETRRGWLGVRVQPVTDDVAASLGMEAAK 299

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+LI+ V K  P +   ++ GD++   DG+ I   +D +  +A     ++V + + ++G 
Sbjct: 300 GALISGVAKGGPVENGPIQAGDIVLKFDGKDIHEMRDLLRIVAESPVGKEVDVVVFRDGK 359

Query: 367 KHSVAVVLGS------SPTAKNDMHLEVGDKELLGMVLQDINDGN 405
           + +V V LG          A +D   E GD    GMV+ D   G+
Sbjct: 360 EETVKVKLGQLQDAPDEKAATDDPQAEDGDG---GMVVPDDKGGS 401


>gi|78357056|ref|YP_388505.1| peptidase S1C [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78219461|gb|ABB38810.1| Peptidase S1C, Do [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
          Length = 480

 Score =  216 bits (549), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 124/346 (35%), Positives = 194/346 (56%), Gaps = 14/346 (4%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   + A+  P++V++  E   +  + + +  + F N P   P  ++F + F +FF+  +
Sbjct: 31  DFTALSAKAGPAVVNINTEKSVENKIPEQWREF-FQNRPHGLPFDDFFNQ-FERFFN--Q 86

Query: 99  PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELP----AKLVGTDA 154
           P      ++   GSGF I+ DGYI+T+NH++      SV +      P    A +VGTD+
Sbjct: 87  P--QRPRKQRSLGSGFIISPDGYIVTNNHVIAGADVVSVNVESAKGEPDTFEATVVGTDS 144

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             DLA+LK+ + R    + F D++ ++VGE V  IGNPF L  +V+AGI+SAL RDI   
Sbjct: 145 ETDLALLKIDAGRPLATLPFGDSDALQVGEWVMAIGNPFGLDHSVTAGIISALGRDIRSG 204

Query: 215 P-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
           P   F Q DA IN GNSGGP  N+ G VIG+N  I+ SGQ   G+G  +P ++ ++ I  
Sbjct: 205 PFDDFIQTDASINPGNSGGPLINSDGKVIGINTAIIASGQ---GIGFAVPSNLARRVIEE 261

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           L +  RV  GW G+  Q++ +  A  LGL+ T+G+LI  V+   PADKAG++ GD+I  +
Sbjct: 262 LKTNKRVARGWIGVTIQDIDENTAKALGLKNTRGALIGNVLSGEPADKAGIRAGDIIIKV 321

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT 379
           +   I    D +  IA  SP ++  +   + G++ +  + LG   T
Sbjct: 322 NRNEISGASDLLRTIADLSPGDKATVVAVRNGAQKTFTLTLGERGT 367


>gi|217976793|ref|YP_002360940.1| protease Do [Methylocella silvestris BL2]
 gi|217502169|gb|ACK49578.1| protease Do [Methylocella silvestris BL2]
          Length = 523

 Score =  216 bits (549), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 152/514 (29%), Positives = 243/514 (47%), Gaps = 47/514 (9%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           R   S+ +I  V    ++F +  +      PP+    P  +A ++  +   +V     +S
Sbjct: 22  RNACSLLAIAAV----LMFGAASVAPGLGAPPAYAKGPDSLADLAADVSDAVVN----IS 73

Query: 64  VEQMFNAYGFGNLPEDHP-------LKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGF 114
             Q  +    G  P+  P        + +FR+        ++P      ER     GSGF
Sbjct: 74  ATQTMDEKRSGGAPQLEPGTPFDDLFEEFFRRRQQGQGGPDQPTPRAPRERKSNSLGSGF 133

Query: 115 FITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEF 174
            +   G I+T+NH++ D    +VI +D  +L A+++G D+  D+AVLKV+ D+    V+F
Sbjct: 134 VVDPSGIIITNNHVIADANDVTVIFTDGQKLKAEVLGKDSKVDVAVLKVKPDKPLKAVKF 193

Query: 175 EDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGP 233
            D++ +RVG+ V  +GNPF L GTV+AGI+SAL R+I   P   + Q DA IN+GNSGGP
Sbjct: 194 GDSDKMRVGDWVIAVGNPFGLGGTVTAGIISALKRNIDSGPYDNYFQTDAAINKGNSGGP 253

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
            FN  G V+G+N  I++     +G+G   P + +   I  L   G    GW G+  QN+ 
Sbjct: 254 LFNMAGEVVGINTAILSPSGGSIGIGFSTPAATVTPVIDQLQKFGETRRGWLGVRIQNVD 313

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
             +A  L L   +G+L+     + PA  AG++ GDVI   DG  IK   D    +AS   
Sbjct: 314 DTIAETLNLGSVRGALVAGADDKGPAKAAGIEAGDVILKFDGVPIKESHDLPKIVASAPV 373

Query: 354 KEQVKISLCKEGSKHSVAVVLG---SSPTAKNDMHLEVGD-----------KELLGMVLQ 399
            + V++ L ++G + +  + LG    +   K  + +  GD           +  LGM   
Sbjct: 374 GKDVEVVLLRQGKEITKTIKLGRLEDNEKQKAALTVRPGDDDKPPAANASMERALGMAFS 433

Query: 400 DINDGNKKLVRI--------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
            +NDG ++   I        +  +   +     K IQ G  I+ +N   V    DV + +
Sbjct: 434 GLNDGARRKYSIKQSVAAGVIVTDVEPDSGAAEKHIQPGDVIMEINQEPVKEPADVAKKV 493

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
            K K+  + S LL +       +G   M RFV+L
Sbjct: 494 AKLKDDGKKSALLLV------ANGQGEM-RFVAL 520


>gi|209965441|ref|YP_002298356.1| periplasmic serine protease, Do [Rhodospirillum centenum SW]
 gi|209958907|gb|ACI99543.1| periplasmic serine protease, Do [Rhodospirillum centenum SW]
          Length = 498

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/398 (31%), Positives = 209/398 (52%), Gaps = 19/398 (4%)

Query: 80  HPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
            PL+++F     +FF    P           GSGF I   G+I+T+NH+VE+     V  
Sbjct: 86  SPLEDFF----GEFFGRRGPDGGGPRPTRALGSGFVIDPAGFIVTNNHVVENADEIEVAF 141

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
                  AKL+GTD   D+A+LKV++      + + D+    VG+ V  IGNPF L GTV
Sbjct: 142 PSGDTYQAKLIGTDPATDIALLKVETPEPLPALAWGDSETAEVGDWVIAIGNPFGLGGTV 201

Query: 200 SAGIVSALDRDI-PDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGI+SA  RDI       F Q D  IN GNSGGP  +  G VIGVN  I +    ++G+
Sbjct: 202 TAGIISARARDIGAGNYDDFLQTDTAINTGNSGGPLIDMKGEVIGVNTAIFSRSGGNIGI 261

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  +P +I +     L  +G V+ G+ G+  Q ++ E+A  LGL+  +G+L+++V  +SP
Sbjct: 262 GFSVPSAIARSVAEELRDRGFVERGFLGVTIQQVSPEIAAALGLKEARGALVSSVTADSP 321

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A +AG++ GD+I  L+GR ++  +D    +A   P   V++ L ++G + +V   +G+ P
Sbjct: 322 AAQAGIETGDLITTLNGRPVERPRDLSRAVADTDPGRTVELGLLRQGRERTVTPKVGTLP 381

Query: 379 TAKNDMHLEVG---DKELLGMVLQDIN---------DGNKKLVRIVALNPNREREVEAKG 426
             +     E G    +  LG+ L  +          + + +   +V + PN       +G
Sbjct: 382 RERQVAEAETGGESGQATLGLTLAPLTPPLRERFGLEEDTQGTVVVGVAPN--SPAAQRG 439

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
            Q G  I   N  EV+  +D+++ I +A+++ RD++++
Sbjct: 440 FQPGDLITRANQSEVTSPEDLQQAIAEARKQGRDAIVV 477


>gi|148257342|ref|YP_001241927.1| putative Serine protease do-like [Bradyrhizobium sp. BTAi1]
 gi|146409515|gb|ABQ38021.1| Putative Serine protease do-like precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 498

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 147/499 (29%), Positives = 248/499 (49%), Gaps = 43/499 (8%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           +T  +F+  + +  A   P+S   P  IA V+  ++  +V      +VE      G G  
Sbjct: 14  VTAAVFAVGWALAPA---PASARGPEGIADVAEKVIDAVVNISTSQTVEAKGGGEGRGAN 70

Query: 77  PEDHP-----------LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTS 125
           P+  P            KN       +  +   P  +++      GSGF + D G ++T+
Sbjct: 71  PQVPPGSPFEEFFDDFFKNRRGGPGGRGGADNSPRRTNS-----LGSGFIVDDSGVVVTN 125

Query: 126 NHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
           NH++ D    +VI++D T++ A+LVG D   DLAVLK +  R    V+F D++ +R+G+ 
Sbjct: 126 NHVIADADEINVIMNDGTKIKAELVGVDKKTDLAVLKFKPPRPLTVVKFGDSDKLRLGDW 185

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  IGNPF L GTV+AGIVSA +RDI   P  ++ Q DA IN+GNSGGP FN  G VIGV
Sbjct: 186 VVAIGNPFSLGGTVTAGIVSAKNRDISSGPYDSYIQTDAAINRGNSGGPLFNLDGEVIGV 245

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N +I++     +G+G  +P   +   +  L   G +  GW G+  Q +T E+A  L ++ 
Sbjct: 246 NTLIISPSGGSIGIGFAVPSKTVAGVVDQLRQFGELRRGWLGVRIQGVTDEIAESLNIKP 305

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
            +G+L+  V  + PA  AG++ GDV+   DG  IK  +D    +A  +  ++V + + ++
Sbjct: 306 ARGALVAGVDDKGPAKPAGIEPGDVVVKFDGHDIKEPKDLSRIVADTAVGKEVDVIVIRK 365

Query: 365 GSKHSVAVVLG---------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI---- 411
           G + ++ V LG          +   K++   +   ++ LG+ L  ++   +   +I    
Sbjct: 366 GQEQTLKVKLGRLEDNEKVQQAAIKKDEPAEKPQTQKALGLDLAALSKDLRTRYKIKDSV 425

Query: 412 ---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
              +    ++  +   K +  G  IV V    V+   D+++ + + K+  + SVLL +  
Sbjct: 426 KGVIVTGVDQGSDAAEKRLSAGDVIVEVAQEAVTSGADIKKRVDQLKKDGKKSVLLLV-- 483

Query: 469 DPDMQSGNDNMSRFVSLKI 487
                S  D   RFV+L +
Sbjct: 484 -----SNADGELRFVALSL 497


>gi|85710218|ref|ZP_01041283.1| trypsin-like serine protease [Erythrobacter sp. NAP1]
 gi|85688928|gb|EAQ28932.1| trypsin-like serine protease [Erythrobacter sp. NAP1]
          Length = 511

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 138/397 (34%), Positives = 211/397 (53%), Gaps = 47/397 (11%)

Query: 110 FGSGFFITDDGYILTSNHIVEDG-----ASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
            GSGF I+ DG+++T+NH+V           +V + D TE  A+LVG DA  DLAVLK+Q
Sbjct: 109 LGSGFIISADGFVVTNNHVVSPDNRARLEEITVTMPDGTEYQAELVGADAQSDLAVLKIQ 168

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-----DRPGTFT 219
           S   F  V F D++  RVGE V  IGNPF L GTV++GIVSA+ R+       DR   + 
Sbjct: 169 SSETFPFVRFGDSSQTRVGEWVVAIGNPFGLGGTVTSGIVSAVYRNTGQGGAYDR---YI 225

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q DA IN+GNSGGP F+  G+VIG+N  I +     +G+G  IP  I    +  L     
Sbjct: 226 QTDASINRGNSGGPLFDMRGNVIGINNAIFSPSGGSVGIGFAIPAEIAAPIVDQLKQGQE 285

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           ++ G+ G+  + +  +LA  LGL   +G ++  V  +SPA +AG++ GDVI  ++GR + 
Sbjct: 286 IERGYLGVSLEPINDDLADSLGLERNRGEIVQIVTDDSPASRAGLRPGDVIVGVNGREVT 345

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT--------------AKNDMH 385
           S Q   + +A+  P E V + + +EG   +V   L   P+              ++  M 
Sbjct: 346 SEQSVSFIVANIEPGESVPVEVLREGRTITVNATLARRPSEEEIAQQTQTFDPESEEPMD 405

Query: 386 LEVGDK---ELLGMVLQDINDGNKKLVR------------IVALNPNREREVEAKGIQKG 430
            E  D+   E LG+ + D+     ++ R            I A++PN   +   KG+++G
Sbjct: 406 PEASDEMIAEKLGLQVLDL---TPQIARSLGVPTETTGLVIGAVDPN--SDAGRKGLRRG 460

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
             I+S N  EV+  + +   I  A+ + RD+VLL+I+
Sbjct: 461 DIILSANYQEVASTEALREQIAAAESEGRDAVLLRIQ 497


>gi|91976488|ref|YP_569147.1| peptidase S1C, Do [Rhodopseudomonas palustris BisB5]
 gi|91682944|gb|ABE39246.1| Peptidase S1C, Do [Rhodopseudomonas palustris BisB5]
          Length = 526

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 149/467 (31%), Positives = 230/467 (49%), Gaps = 44/467 (9%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLK-NYFRKDFHKFFSGEEP-- 99
           ++ +V PS++SV V   +K +  +        +  ED P +     + F + F GE P  
Sbjct: 78  IVEKVKPSVISVKVNIAEKTAKNE--------DRAEDSPFQPGSPMERFFRRFGGEMPPG 129

Query: 100 ILSDTVERLMFG--SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
           +        M G  SGFFI+ DGY +T+NH+V+      V   D     AK++GTD   D
Sbjct: 130 MRGHRGGGTMTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTD 189

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-G 216
           LA++K +    F P         R+G+ V  +GNPF L GTV+AGIVSA  RDI + P  
Sbjct: 190 LALIKAEGRTDF-PFAKLSEGKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYD 248

Query: 217 TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F QIDAP+N+GNSGGP F+  G V+GVN  I +     +G+   IP S +K  +  L  
Sbjct: 249 DFIQIDAPVNKGNSGGPAFDTNGEVMGVNTAIYSPSGGSVGIAFSIPASTVKTVVQQLKD 308

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
           KG V  GW G+  Q +T E+A  LGL+   G+L+       PA KAG++ GDVI  ++G 
Sbjct: 309 KGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGPAAKAGIESGDVITAVNGT 368

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----- 391
            +K  ++    I   +P   VK+++  +G+   + + LG  P   N +  +V D      
Sbjct: 369 PVKDARELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLP---NQVEAKVNDGGDNGN 425

Query: 392 --------ELLGMVL---QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
                     LG+ +     +    K  V +  ++P  +     +G ++G  I+ V    
Sbjct: 426 SSSRGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDP--KSAAADRGFKEGDVILEVAGKN 483

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           V+   DV   I  AK   ++SVL++++        +   SRFV++ I
Sbjct: 484 VASPGDVREAINTAKADNKNSVLIRVR--------SGGSSRFVAVPI 522


>gi|146279171|ref|YP_001169329.1| hypothetical protein Rsph17025_3140 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557412|gb|ABP72024.1| hypothetical protein Rsph17025_3140 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 483

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 130/375 (34%), Positives = 208/375 (55%), Gaps = 29/375 (7%)

Query: 16  ALTCVIFSSTYLVLEA---KLP--PSSVDLP-----PVIARVSPSIVSVMVEPKKKVSVE 65
           +L  V+ +ST L   A    LP  P+  ++P      ++ARVSP++V + V  K +    
Sbjct: 9   SLKAVLIASTLLAGGAVGTALPVAPAHAEVPMQGYADLVARVSPAVVFIEVTAKSQEPAP 68

Query: 66  QMFNAYGFGNLPEDHPLKNYFRK--DFHKFFSGEEPILSDTVERLM--FGSGFFITDDGY 121
           +  +           PL+ + R+  +    F    P   D   R+M   GSGF I+ DG 
Sbjct: 69  RAAS-----------PLEEFLRRFGEIDPQFRMPAPPERD---RVMHGLGSGFLISQDGV 114

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+VE+    +V L D  E  A++VG D + D+AV++++       VEF D++ +R
Sbjct: 115 IVTNNHVVENATDMTVKLEDGREFKAEMVGADPMTDIAVIRLRDASDLPFVEFGDSDRLR 174

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGH 240
           VG+AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G 
Sbjct: 175 VGDAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTSGT 234

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           V+G+N  I +     +G+G  IP + ++  +  L   G V  GW G+  Q LT E+A  L
Sbjct: 235 VVGMNTAIFSPTGGSVGIGFSIPANTVRDVVAQLQETGSVSRGWLGVTIQPLTPEIAQAL 294

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL G++G+L+  V  +SPA+  G++ GDVI  ++G+ I         IA+    E+ +++
Sbjct: 295 GLEGSRGALVAEVQPDSPAEAGGVESGDVITAVNGQEIGERSSLPRLIAAIPNGEEARLT 354

Query: 361 LCKEGSKHSVAVVLG 375
           + ++G +  + V +G
Sbjct: 355 VQRDGREREMTVTIG 369


>gi|317152597|ref|YP_004120645.1| protease Do [Desulfovibrio aespoeensis Aspo-2]
 gi|316942848|gb|ADU61899.1| protease Do [Desulfovibrio aespoeensis Aspo-2]
          Length = 471

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 161/492 (32%), Positives = 248/492 (50%), Gaps = 62/492 (12%)

Query: 25  TYLVLEAKLPPSSVDLP---PVIARVSPSIVSVMVEPKKKVSVE-QMFNAYGFGNLPEDH 80
           T LVL   L   +  LP    + AR   S+V +  E   + +   Q F       +PE H
Sbjct: 12  TGLVLALPLMARANGLPVFTELAARGGKSVVFISTEKTTQAAPGGQQFRQ----QVPEGH 67

Query: 81  PLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
           P + +F + F +FF G++P      +++  GSGF I+ +G I+T+NH++ED    +V   
Sbjct: 68  PFREFFDR-FDQFF-GQQP--GQPRKQMGQGSGFVISANGLIVTNNHVIEDADKVTVRFQ 123

Query: 141 DDT-ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           DD  E  AK+VG D   DLAV+K+ +DR    + F D++ ++VGE V  IGNPF L  TV
Sbjct: 124 DDAKEYVAKVVGRDKETDLAVIKIDTDRTLPVLAFGDSDALQVGEWVLAIGNPFGLDNTV 183

Query: 200 SAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGI+SA  R I   P   F Q DA IN GNSGGP  N  G V+G+N  I  +      +
Sbjct: 184 TAGIISAKHRIIGAGPFDNFLQTDASINPGNSGGPLLNMRGEVVGINTAINAAAD---NI 240

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  IP +  +K I  L     V  GW G+  Q+L +  A  LGL   KG+LI++V +  P
Sbjct: 241 GFAIPSTQAEKIIAQLKEGKAVKRGWIGVTIQSLDENQAKALGLPEAKGALISSVGQGHP 300

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           ADKAG++ GDV+  +DG  +   ++ + +IA   P ++ +++L +   + +  V LG   
Sbjct: 301 ADKAGIRQGDVVLEVDGNPVNDSKELLARIAGLKPGDKARLTLWRGNKRITKTVTLG--- 357

Query: 379 TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEA-------------- 424
                   E G+K +  M  Q    G +  V  +AL P  +RE  A              
Sbjct: 358 --------ERGEKIMAAM--QPPQPGAQAHVLGMALQPVGQREANALGLDQPQGLIVVEI 407

Query: 425 --------KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
                   +G+++G  I+  N  +V+   ++E +I  +++K R +V+L IK         
Sbjct: 408 KPDSPAANEGVRQGDVILQANQQDVNSPAELEGVI--SRDKARGAVMLLIK--------R 457

Query: 477 DNMSRFVSLKID 488
              + FV+L +D
Sbjct: 458 QGQNLFVALPLD 469


>gi|148262952|ref|YP_001229658.1| protease Do [Geobacter uraniireducens Rf4]
 gi|146396452|gb|ABQ25085.1| protease Do [Geobacter uraniireducens Rf4]
          Length = 476

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 142/428 (33%), Positives = 231/428 (53%), Gaps = 26/428 (6%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           V+  V+P++V++    KKK+ V+  F         E  PL       F  FF G      
Sbjct: 57  VVKAVNPAVVNISTVSKKKL-VQPFF---------EMSPL-------FDDFFGGRGGTPQ 99

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
              E  + GSGF I  DGYI+T++H+V D  S  V LS++     K+VG+D   D+AV+K
Sbjct: 100 YRRENSL-GSGFIINRDGYIITNDHVVRDAESIQVKLSNENVYSGKVVGSDPKTDIAVIK 158

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQ 220
           + +  +       D++ ++VG+    IGNPF L  TV+ G+VSA  R     +    F Q
Sbjct: 159 INAKEQLPVAVLGDSDKLQVGQWAIAIGNPFGLDRTVTVGVVSATGRSNMGIETYENFIQ 218

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
            DA IN GNSGGP  N  G VIG+N  IV +GQ   G+G  IP+++ K+A+P LI KG V
Sbjct: 219 TDASINPGNSGGPLLNVYGEVIGINTAIVAAGQ---GIGFAIPINMAKRAVPQLIKKGNV 275

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             GW G+  Q +T+E+A   GL+  +G+L++ ++  SPA KAG++ GD+I  + G+ IKS
Sbjct: 276 SRGWLGVSIQPVTEEIAQSFGLKRAQGALVSDIMAGSPAAKAGLRQGDIITGIAGKEIKS 335

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEV-GDKELLGMVLQ 399
            Q     +A       V+I + +EG    ++++  S+ +A       V  +   +G+ ++
Sbjct: 336 VQQLQLLVADMPVGSPVEIEVFREGRAKKLSIIPASADSAAGAKPKSVETETAWVGLSVE 395

Query: 400 DI-NDGNKKLVRIVALNPNREREVEA-KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK 457
           ++  D   K ++ V +       + A  GIQ+G  +VSVN  +++ + D  + +  A++K
Sbjct: 396 ELPRDIRLKGLQGVVVTSVEPGSLAADSGIQQGDVVVSVNQRKIAGVNDYAKAMKDAEKK 455

Query: 458 KRDSVLLQ 465
              ++L++
Sbjct: 456 GSVALLVR 463


>gi|77465252|ref|YP_354755.1| putative trypsin-like serine protease [Rhodobacter sphaeroides
           2.4.1]
 gi|77389670|gb|ABA80854.1| Putative trypsin-like serine protease [Rhodobacter sphaeroides
           2.4.1]
          Length = 483

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 206/374 (55%), Gaps = 27/374 (7%)

Query: 16  ALTCVIFSSTYL---VLEAKLPPSSV--DLP-----PVIARVSPSIVSVMVEPKKKVSVE 65
           +L  V+ +ST +   V    LPP++   ++P      ++ARVSP++V + V  K K S  
Sbjct: 9   SLKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVTAKSKESTP 68

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFH---KFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
              +           P + + R+      +F   + P     +  L  GSGF I+ DG I
Sbjct: 69  MAGS-----------PFEEFLRRFGEIDPQFRMPQAPEGGQVMHGL--GSGFLISQDGII 115

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+VE+     V L D  E  A++VGTD + D+AV++++  +    VE  D+  +RV
Sbjct: 116 VTNNHVVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRV 175

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHV 241
           G+AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V
Sbjct: 176 GDAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKV 235

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I +     +G+G  IP + +K  +  L  KG V  GW G+  Q +T E+A  +G
Sbjct: 236 VGMNTAIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMG 295

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L G  G+L+  V + SPAD+ G++ GDVI  ++G+ +         IA+    E+ ++++
Sbjct: 296 LEGRDGALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKAQLTV 355

Query: 362 CKEGSKHSVAVVLG 375
            ++G +  + V +G
Sbjct: 356 QRDGRQQEMTVTIG 369


>gi|242280385|ref|YP_002992514.1| protease Do [Desulfovibrio salexigens DSM 2638]
 gi|242123279|gb|ACS80975.1| protease Do [Desulfovibrio salexigens DSM 2638]
          Length = 480

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 150/450 (33%), Positives = 239/450 (53%), Gaps = 29/450 (6%)

Query: 35  PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF 94
           PS V+L     +  P++V++      +V    M + + F     ++P +++F K F+   
Sbjct: 28  PSFVELA---KKCGPAVVNINTVKMVEVG-NPMEDFFKFHGRDGNNPFEDFF-KQFNNRG 82

Query: 95  SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT-ELPAKLVGTD 153
           + ++P        L  GSGF I+ DG+++T+NH+V      +V L +D  E PAK++G D
Sbjct: 83  NNKQPKQKRKTGSL--GSGFIISKDGFVVTNNHVVASADEITVKLQNDGHEYPAKIIGRD 140

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              DLA+LK++  +    +EF +++   VGE V  IGNPF L  TV+ GI+SA  R I  
Sbjct: 141 KETDLALLKIEVKKDLPFLEFANSDKAEVGEWVLAIGNPFGLGHTVTKGIISAKGRIIGA 200

Query: 214 RP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
            P   F Q DA IN GNSGGP  +  G VIG+N  I+ SGQ   G+G  IP ++ +  I 
Sbjct: 201 GPFDNFIQTDASINPGNSGGPLIDLKGRVIGINTAIIASGQ---GIGFAIPSNMAENVIS 257

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L +  +V  GW G+  Q+   + A  LGL+  KG+L+ +V    PADK GMKVGDVI  
Sbjct: 258 QLKTDHKVSRGWLGVTIQDADAKTAKALGLKDEKGALVNSVNPGDPADKGGMKVGDVILK 317

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN------DMHL 386
           +DG  I    D +  +A+  P + V + + ++G + ++ +VLG     KN       M  
Sbjct: 318 IDGEKIDDTNDLLRTVAALPPGKAVSVQVWRKGREKNLRIVLGER-NGKNVVAEAEKMSP 376

Query: 387 EVGDKEL--LGMVLQDIND-------GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVN 437
           +  ++ L  LG+V++ +N        G  +   ++ +   +    E   I  G  I+  N
Sbjct: 377 KAAEENLDDLGLVVRRVNRKAEADSLGLDRPEGLLVIEVMQGTPSEDAAIAVGDVIIEAN 436

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            H+V+ IKD++++I   + KKR  V+L +K
Sbjct: 437 QHKVNSIKDLQKII-NTEGKKRGLVMLLLK 465


>gi|332560859|ref|ZP_08415177.1| putative trypsin-like serine protease [Rhodobacter sphaeroides
           WS8N]
 gi|332274657|gb|EGJ19973.1| putative trypsin-like serine protease [Rhodobacter sphaeroides
           WS8N]
          Length = 483

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 205/374 (54%), Gaps = 27/374 (7%)

Query: 16  ALTCVIFSSTYL---VLEAKLPPSSV--DLP-----PVIARVSPSIVSVMVEPKKKVSVE 65
           +L  V+ +ST +   V    LPP++   ++P      ++ARVSP++V + V  K K S  
Sbjct: 9   SLKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVTAKSKESTP 68

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFH---KFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
                          P + + R+      +F   + P     +  L  GSGF I+ DG I
Sbjct: 69  MA-----------GSPFEEFLRRFGEIDPQFRMPQAPEGGQVMHGL--GSGFLISQDGII 115

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+VE+     V L D  E  A++VGTD + D+AV++++  +    VE  D+  +RV
Sbjct: 116 VTNNHVVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRV 175

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHV 241
           G+AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V
Sbjct: 176 GDAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKV 235

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I +     +G+G  IP + +K  +  L  KG V  GW G+  Q +T E+A  +G
Sbjct: 236 VGMNTAIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMG 295

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L G  G+L+  V + SPAD+ G++ GDVI  ++G+ +         IA+    E+ ++++
Sbjct: 296 LEGRDGALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKAQLTV 355

Query: 362 CKEGSKHSVAVVLG 375
            ++G +  + V +G
Sbjct: 356 QRDGRQQEMTVTIG 369


>gi|85375095|ref|YP_459157.1| trypsin-like serine protease [Erythrobacter litoralis HTCC2594]
 gi|84788178|gb|ABC64360.1| trypsin-like serine protease [Erythrobacter litoralis HTCC2594]
          Length = 510

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 146/478 (30%), Positives = 236/478 (49%), Gaps = 61/478 (12%)

Query: 27  LVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYF 86
           +V  A  P S  +L     ++ P++V++    + +V     F    F +L          
Sbjct: 44  VVPRAGAPESFAEL---TEQLQPAVVNISTRQRIEVQNRNPFQGTPFADL---------- 90

Query: 87  RKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA-----SFSVILSD 141
              F++    ++P    T E    GSGFFI+ DGY++T+NH+V           +V L D
Sbjct: 91  ---FNRRGQPQQP---QTREAQSLGSGFFISADGYVVTNNHVVAPNGRGTVEEITVTLPD 144

Query: 142 DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
             E  A+LVG DA  DLAVLKV     F  V F D++  R G+ V  IGNPF L GTV++
Sbjct: 145 GREYAAELVGADAASDLAVLKVSRSEPFPFVRFGDSSQARAGDWVIAIGNPFGLGGTVTS 204

Query: 202 GIVSALDRDIP----DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           GIVSA  R+      DR   + Q DA IN+GNSGGP F+  G+VIG+N  I +     +G
Sbjct: 205 GIVSAQLRNTGGGAYDR---YIQTDASINRGNSGGPLFDMQGNVIGINNAIFSPSGGSVG 261

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +G  IP       +  L     ++ G+ G+  Q +++++A  LGL   +G ++  VV   
Sbjct: 262 IGFAIPAETAAPIVAQLQRGNAIERGYLGVQIQQVSEDVADSLGLPKNRGEIVQTVVDGE 321

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
            AD++G++ GDV+  +DG+ +   Q   + IA+ SP   V + + +EGS+ ++ V +G  
Sbjct: 322 AADRSGIRAGDVVLKIDGKDVTPDQTLSFLIANISPGTTVPVEVFREGSRRTLNVTVGKR 381

Query: 378 PTAKN---------------DMHLEVGDKELLG-------------MVLQDINDGNKKLV 409
           P+ +                D   E+ D E+L              +  Q     + + +
Sbjct: 382 PSEEELRQSQIFSQDEDEDPDAAPEMDDSEMLADKLGLGVIPVTPEIARQLGVAADTRGL 441

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            I  ++PN   +   KG+++   I+S N   V  ++D+E ++ +A+E  R SVLL+ +
Sbjct: 442 AIAVVDPN--SDAARKGLRRRDIILSANYEPVESVEDLEAIVQQAEEAGRSSVLLRFR 497


>gi|148260320|ref|YP_001234447.1| protease Do [Acidiphilium cryptum JF-5]
 gi|326403510|ref|YP_004283592.1| serine protease [Acidiphilium multivorum AIU301]
 gi|146402001|gb|ABQ30528.1| protease Do [Acidiphilium cryptum JF-5]
 gi|325050372|dbj|BAJ80710.1| serine protease [Acidiphilium multivorum AIU301]
          Length = 508

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 145/422 (34%), Positives = 217/422 (51%), Gaps = 37/422 (8%)

Query: 42  PVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL 101
           P++  VSP++VSV V  K    V+Q  N      +P   P    F     +     E   
Sbjct: 59  PLVKDVSPAVVSVTVHLK----VQQADNTQAQNGMPPGMPFAFPFPFPQPQQPQAVE--- 111

Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
                    GSGFFI+ DGYI+T+NH+V++  S  V LSD ++LPAK+VGTD   DLAVL
Sbjct: 112 -------AKGSGFFISSDGYIVTNNHVVKNAKSVFVTLSDGSKLPAKIVGTDPSTDLAVL 164

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD-RPGTFTQ 220
           KV+ D+ F  ++  D+  +  G+ V  IGNPF L  TV+ G+VSAL RDI D +  +F Q
Sbjct: 165 KVKRDKPFPYLQLGDSAKVVPGQWVIAIGNPFGLAETVTTGVVSALGRDIGDGQYDSFIQ 224

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
           IDAPIN+GNSGGP  N  G VIGVN  I+T     +G+G  IP  ++++    LI  G V
Sbjct: 225 IDAPINEGNSGGPLLNQRGEVIGVNTAILTPSGGSVGIGFSIPSDMVRRIADELIKSGHV 284

Query: 281 DHGWFGIMTQNLTQELAIPLGLR----GTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
             G+ G+  Q +T E+A  +G+        G+LI   +   PA KAG+K GD+I  +DG+
Sbjct: 285 TRGFIGVQVQTITPEMAQAMGVPVHDGRADGALIAETMPNGPAAKAGLKPGDIITKVDGK 344

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD------ 390
           +++  ++    I+   P  +  I+  + G+ H + + +   P          G       
Sbjct: 345 MVRDPRELALAISGIKPDGKASITYLRGGASHELNLRVEKMPANAEAAFAPGGSQSGPAM 404

Query: 391 -KELLGMVLQDINDGNKKLVR---------IVALNPNREREVEAKGIQKGMTIVSVNTHE 440
            K  LG+ L  ++D  ++ +          I  + PN     +  G++ G  IV V +  
Sbjct: 405 HKPELGLSLAPLSDAARQQLNLPDNVSGALIAHVAPN--SPADEAGLRSGDVIVGVGSMT 462

Query: 441 VS 442
           V+
Sbjct: 463 VN 464


>gi|126464715|ref|YP_001045828.1| protease Do [Rhodobacter sphaeroides ATCC 17029]
 gi|126106526|gb|ABN79056.1| protease Do [Rhodobacter sphaeroides ATCC 17029]
          Length = 483

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 206/374 (55%), Gaps = 27/374 (7%)

Query: 16  ALTCVIFSSTYL---VLEAKLPPSSV--DLP-----PVIARVSPSIVSVMVEPKKKVSVE 65
           +L  V+ +ST +   V    LPP++   ++P      ++ARVSP++V + V  K K S  
Sbjct: 9   SLKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVTAKSKESTP 68

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFH---KFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
              +           P + + R+      +F   + P     +  L  GSGF I+ DG I
Sbjct: 69  MAGS-----------PFEEFLRRFGEIDPQFRMPQAPEGGQVMHGL--GSGFLISQDGII 115

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+VE+     V L D  E  A++VGTD + D+AV++++  +    VE  D+  +RV
Sbjct: 116 VTNNHVVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRV 175

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHV 241
           G+AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V
Sbjct: 176 GDAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKV 235

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I +     +G+G  IP + +K  +  L  KG V  GW G+  Q +T E+A  +G
Sbjct: 236 VGMNTAIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMG 295

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L G  G+L+  V + SPAD+ G++ GDVI  ++G+ +         IA+    E+ ++++
Sbjct: 296 LEGRDGALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKAQLTV 355

Query: 362 CKEGSKHSVAVVLG 375
            ++G +  + V +G
Sbjct: 356 QRDGRQQEMTVTIG 369


>gi|218530834|ref|YP_002421650.1| protease Do [Methylobacterium chloromethanicum CM4]
 gi|218523137|gb|ACK83722.1| protease Do [Methylobacterium chloromethanicum CM4]
          Length = 511

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 142/417 (34%), Positives = 220/417 (52%), Gaps = 28/417 (6%)

Query: 76  LPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
           LP+  P ++ F + F +   G     +E     T +    GSGF I   G ++T+NH++ 
Sbjct: 82  LPQGTPFEDLFEEFFKRRGQGAPKGDDESPRGPTRKSNSLGSGFIIDASGIVVTNNHVIG 141

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ--SDRKFIPVEFEDANNIRVGEAVFT 188
           D     VILSD T+L A+++G D+  DLA+L+V+  ++R    V F D++ +R G+ V  
Sbjct: 142 DANDIQVILSDGTKLKAEIIGKDSKIDLALLRVKPTAERPLKAVPFGDSDKMRPGDWVMA 201

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  
Sbjct: 202 IGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINTA 261

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTK 306
           I++     +G+G  +P +   + +  L   G V  GW G+  QN+ +  A  LGL+ G K
Sbjct: 262 ILSPSGGSVGIGFAVPSATAGQVVDQLRQFGEVRRGWIGVRIQNVDEATAEALGLKGGAK 321

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G 
Sbjct: 322 GALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKSVDVQVVRKGE 381

Query: 367 KHSVAVVL-----GSSPTAKNDMHLEVG--DKELLGMVLQDINDGNKKLVRI-------- 411
           + + +VVL     G      N    E    ++++LG+ L  +ND  ++   I        
Sbjct: 382 EQTKSVVLGRLEDGEKAQVANLKQPEADSVNRQVLGLNLSGLNDEVRRRYGIKESVKTGV 441

Query: 412 --VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               ++PN       K IQ G  IV V    +S   DV + +   K++ R SVLL +
Sbjct: 442 VVTKVDPN--STAADKRIQPGEVIVEVGQEAISNPADVTKRVEALKKEGRKSVLLLV 496


>gi|120602655|ref|YP_967055.1| protease Do [Desulfovibrio vulgaris DP4]
 gi|120562884|gb|ABM28628.1| protease Do [Desulfovibrio vulgaris DP4]
          Length = 482

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 138/427 (32%), Positives = 222/427 (51%), Gaps = 32/427 (7%)

Query: 63  SVEQMFNAYG--FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           +V+   N +G    N P+  P   +F + F +F     P      ++   GSGF I+ DG
Sbjct: 50  TVQAPENPFGDMLRNAPQGTPFDRFFEQ-FERFHGKMRP-----QKQRSLGSGFIISADG 103

Query: 121 YILTSNHIVEDGASFSVILSDDT----ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           YI+T+NH++ D     V + ++T       AK++GTD   DLA+LK+ + R+   + F D
Sbjct: 104 YIVTNNHVIADADVIHVNIENETGKSASYDAKVIGTDEETDLALLKIDAKRQLPVLRFGD 163

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCF 235
           ++++ VGE +  IGNPF L  +V+AGI+SA  RDI   P   F Q DA IN GNSGGP  
Sbjct: 164 SDSLEVGEWLMAIGNPFGLDHSVTAGILSAKGRDIRSGPFDNFLQTDASINPGNSGGPLI 223

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N  IV SGQ   G+G  IP ++  + I  L S  +V  GW G+  Q++ + 
Sbjct: 224 NMKGEVIGINTAIVASGQ---GIGFAIPSNMAARIIDQLKSDKKVRRGWIGVTIQDVDEN 280

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
            A  LGL   +G+L+ +V+   PADKAG+K GD++  ++G  I      + ++A+  P E
Sbjct: 281 TARALGLGEPRGALVGSVMPGEPADKAGIKAGDILLKVEGEDIADSGRLLRRVAALKPGE 340

Query: 356 QVKISLCKEGSKHSVAVVLGSSP---------TAKNDMHLEVGDKELLGMVLQDINDGNK 406
             KI+L + G   +V + LG            T +     +      LG+ ++  N    
Sbjct: 341 TAKITLWRNGQTKTVNLTLGERTAEHLAAQGGTPRQTPESKQQASSSLGLTVRPPNAEEA 400

Query: 407 KLVR------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
           + ++      ++ +     R      I+ G  ++S N H V+   D+ +++ +   K+R 
Sbjct: 401 RALKLDRPQGLLVIAVEEGRPAADADIRAGDVVLSANLHPVNSTADLAKVV-QEDAKRRG 459

Query: 461 SVLLQIK 467
           +V+LQI+
Sbjct: 460 AVMLQIQ 466


>gi|221369257|ref|YP_002520353.1| Protease Do precursor [Rhodobacter sphaeroides KD131]
 gi|221162309|gb|ACM03280.1| Protease Do precursor [Rhodobacter sphaeroides KD131]
          Length = 474

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 204/373 (54%), Gaps = 27/373 (7%)

Query: 17  LTCVIFSSTYL---VLEAKLPPSSV--DLP-----PVIARVSPSIVSVMVEPKKKVSVEQ 66
           +  V+ +ST +   V    LPP++   ++P      ++ARVSP++V + V  K K S   
Sbjct: 1   MKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVTAKSKESTPM 60

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFH---KFFSGEEPILSDTVERLMFGSGFFITDDGYIL 123
                         P + + R+      +F   + P     +  L  GSGF I+ DG I+
Sbjct: 61  A-----------GSPFEEFLRRFGEIDPQFRMPQAPEGGQVMHGL--GSGFLISQDGIIV 107

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+NH+VE+     V L D  E  A++VGTD + D+AV++++  +    VE  D+  +RVG
Sbjct: 108 TNNHVVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRVG 167

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVI 242
           +AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V+
Sbjct: 168 DAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKVV 227

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N  I +     +G+G  IP + +K  +  L  KG V  GW G+  Q +T E+A  +GL
Sbjct: 228 GMNTAIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMGL 287

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
            G  G+L+  V + SPAD+ G++ GDVI  ++G+ +         IA+    E+ ++++ 
Sbjct: 288 EGRDGALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKARLTVQ 347

Query: 363 KEGSKHSVAVVLG 375
           ++G +  + V +G
Sbjct: 348 RDGRQQEMTVTIG 360


>gi|298530958|ref|ZP_07018359.1| protease Do [Desulfonatronospira thiodismutans ASO3-1]
 gi|298508981|gb|EFI32886.1| protease Do [Desulfonatronospira thiodismutans ASO3-1]
          Length = 472

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/369 (34%), Positives = 198/369 (53%), Gaps = 20/369 (5%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           I T  L  + F  +  +  A LP    +   +  +  P++V++     KKV   +M + +
Sbjct: 5   IKTFLLLTLFFIWSGSIAGASLP----EFSDLAEKAGPAVVNIST--VKKVERPEMGDFF 58

Query: 72  -GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
            GF +    HP + +F + F +FF   E       E+   GSGF I+ DGY++T+NH+VE
Sbjct: 59  RGFQD--RGHPFEEFFDQ-FERFFGERE---RQPREQRSLGSGFIISQDGYVVTNNHVVE 112

Query: 131 DGASFSVIL---SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
                        ++    A+++GTD   DLA++K+ +D +   +EF ++ +++VG+ V 
Sbjct: 113 GAEEIKATFRLEDEEKTFEAEIIGTDPETDLALIKINTDMELPTLEFGNSEDMKVGQWVV 172

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IGNPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP  N  G VIG+N 
Sbjct: 173 AIGNPFGLNHTVTAGIISAKGRVIGAGPYDNFIQTDASINPGNSGGPLLNMQGEVIGINT 232

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
            IV +GQ   G+G  IP ++ +  I  L +  +V  GW G+  QN+ Q++A  LGL   +
Sbjct: 233 AIVAAGQ---GIGFAIPSTMAEDIISQLKTDQKVSRGWLGVTIQNVDQDIADALGLEEAR 289

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+  V    PA++AGM+ GDVI  L+G  ++   D   +I   +P  +  +   ++G 
Sbjct: 290 GALVAGVTPGDPAEEAGMEAGDVIVSLNGDSVEDSSDLTRKIGQLAPGSEATVGFYRDGE 349

Query: 367 KHSVAVVLG 375
           K  V V LG
Sbjct: 350 KKDVTVTLG 358



 Score = 40.0 bits (92), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  ++ +QE A  LGL   +G L+T V   SPA +A +  GD+I   +G+ + S  DF
Sbjct: 380 LGMSFRSPSQEEAEQLGLSEPQGLLVTEVEPRSPAHRADIAPGDLILQANGQRVDSTNDF 439

Query: 345 VWQIASRSPKEQVKISLC 362
              +   +  +QV + L 
Sbjct: 440 FTILEEDAKPKQVLMLLV 457


>gi|222086375|ref|YP_002544909.1| serine protease DO-like protein [Agrobacterium radiobacter K84]
 gi|221723823|gb|ACM26979.1| serine protease DO-like protein [Agrobacterium radiobacter K84]
          Length = 583

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 118/338 (34%), Positives = 184/338 (54%), Gaps = 10/338 (2%)

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
           P  +A ++  ++  +V       V+   +      +P++ P +++F    + FF      
Sbjct: 83  PASVADLASGLLDAVVNISTSQKVKDQGDGPANPKVPDNSPFQDFF----NDFFKNRN-- 136

Query: 101 LSDTVERLM--FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
            +D   R +   GSGF I   GYI+T+NH++E      VI  +  +L A+L+GTD   DL
Sbjct: 137 -NDNSNRKVSSLGSGFVIDPTGYIVTNNHVIEGADDIEVIFPNGNKLKARLIGTDTKTDL 195

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GT 217
           +VLKV+S R  + V+F D+  +R+G+ V  IGNPF L G+V+ GIVSA  R+I   P   
Sbjct: 196 SVLKVESKRPLVSVKFGDSAKMRIGDWVMAIGNPFGLGGSVTVGIVSARGRNINAGPYDN 255

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F Q DA IN+GNSGGP FN  G VIG+N  I++     +G+G  +P  + +  +  L+  
Sbjct: 256 FIQTDAAINKGNSGGPLFNMKGEVIGINTAIISPSGGSIGIGFAVPSELAEGVVKQLMDF 315

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           G    GW G+  Q +T ++A  LGL G KG+L+  V+K  P D   +K GDVI   DG+ 
Sbjct: 316 GETRRGWLGVRIQPVTDDVANSLGLDGAKGALVAGVIKGGPVDNGSIKAGDVILKFDGKD 375

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           +   +D    +A     + V + + ++G + +V V LG
Sbjct: 376 VDEMRDLPRVVAESPVGKAVDVVIMRDGKQQTVKVTLG 413


>gi|254293643|ref|YP_003059666.1| protease Do [Hirschia baltica ATCC 49814]
 gi|254042174|gb|ACT58969.1| protease Do [Hirschia baltica ATCC 49814]
          Length = 519

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 127/380 (33%), Positives = 210/380 (55%), Gaps = 22/380 (5%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGFFI+D GYI+T+NH+VE+ +  ++ LS+  EL A+++G D L DLAVLKV+   K+
Sbjct: 124 LGSGFFISDTGYIVTNNHVVENASEVTITLSNGDELEAEIIGLDELTDLAVLKVKEGGKY 183

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQG 228
             VEFE     RVG+ V  +GNPF L GT +AGIVSA+ R++       + Q+DA IN+G
Sbjct: 184 PYVEFELGAPPRVGDWVVAVGNPFGLGGTATAGIVSAISREMNGSNYSNYIQVDASINRG 243

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP F+  G VIGVN  I +     +G+G  I  ++ K+    LI  G+V  GW G+ 
Sbjct: 244 NSGGPTFDLYGKVIGVNTAIYSPSGGSVGIGFAIESTVAKEITDILIKDGKVTRGWLGVS 303

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q++T E+A   GL+  KG+L+  V   SPA+K G++ GDVI  ++G  +K  ++    +
Sbjct: 304 IQSMTVEMAESQGLKNEKGALVADVQVGSPAEKGGIERGDVILSVNGLAVKDSRELTRLV 363

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPT------------AKNDMHLEVGDKELL-- 394
                + + +  L ++G + +V+V +G  P+            ++ +   EV  +  L  
Sbjct: 364 GGLIAESKNEFKLIRDGKEKTVSVTVGVRPSDVDSAFNRGGSESEGEKEDEVAPEGALVH 423

Query: 395 GMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
           G+ ++ ++    +L         ++ L+ NR       GI KG  ++      +    D+
Sbjct: 424 GLTVKPLSKPEFELFGLKENENGVLVLDLNRNSAFAEAGIAKGDALLEAQGTTLKSADDL 483

Query: 448 ERLIGKAKEKKRDSVLLQIK 467
             +I  AK++ + ++L+ ++
Sbjct: 484 ASVIKNAKKEGKKNILVAVR 503


>gi|188584310|ref|YP_001927755.1| protease Do [Methylobacterium populi BJ001]
 gi|179347808|gb|ACB83220.1| protease Do [Methylobacterium populi BJ001]
          Length = 496

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 138/390 (35%), Positives = 209/390 (53%), Gaps = 16/390 (4%)

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           +R   GSGF I+ DGY++T+NH+V+   +  V L D   L AK++G D   D+A+LK+  
Sbjct: 115 QRGGVGSGFIISADGYVVTNNHVVDHAKTVQVTLDDGRTLDAKVIGKDPKTDIALLKITE 174

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAP 224
              +  V+F      RVG+ V  IGNPF L GTV+AGIVSA  RDI   P   F QIDAP
Sbjct: 175 SGSYPYVQFGKGAP-RVGDWVLAIGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDAP 233

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           IN+GNSGGP FN  G V+GVN  I +     +G+G  IP   ++  +  L + G+V  G+
Sbjct: 234 INKGNSGGPTFNVNGEVVGVNTAIASPSGGSVGLGFAIPAETVQTVVDQLRTDGKVVRGY 293

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  Q +T+++A  LGL   KG+L+      +PA KAG+K GDVI  ++G  I + +D 
Sbjct: 294 LGVQVQPVTKDIAEGLGLDKAKGALVNDAESGTPAAKAGLKPGDVIESVNGVPIDNARDL 353

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE-----LLGMVLQ 399
              IA   P  +VK++  + G   +  V LG+ P   +   +  GD        LG+ L 
Sbjct: 354 SRLIAGLKPGTEVKLTYRRGGKSDTATVELGTLP--GDGKVVSRGDDAPSGQVRLGLSLA 411

Query: 400 DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
             ++       +  ++ +      A+GI +G  I+ V    V+   DV+  I  A+   R
Sbjct: 412 PASEVGLGDEGVAVMDVDPTGPAAARGISQGDVILDVGGTSVAKPSDVQAQIRAAESSGR 471

Query: 460 DSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            +VL+++K       G    +RFV++ ++K
Sbjct: 472 KAVLMRVK-------GARGQTRFVAVALNK 494


>gi|258543537|ref|YP_003188970.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-01]
 gi|256634615|dbj|BAI00591.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-01]
 gi|256637671|dbj|BAI03640.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-03]
 gi|256640725|dbj|BAI06687.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-07]
 gi|256643780|dbj|BAI09735.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-22]
 gi|256646835|dbj|BAI12783.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-26]
 gi|256649888|dbj|BAI15829.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-32]
 gi|256652878|dbj|BAI18812.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655932|dbj|BAI21859.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-12]
          Length = 510

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 158/502 (31%), Positives = 253/502 (50%), Gaps = 47/502 (9%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVI-------------ARVSPSIVS 53
           +SV+     +L+ ++ +    V  A+   ++   PPV+             A++ P++V+
Sbjct: 3   ISVRFARVFSLSGLLLAGASFVHPARADQAATATPPVVVAQRVPESFADLAAKLLPAVVN 62

Query: 54  VMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE-EPILSDTVERLM--F 110
           V      +   +          +P + P  + F K FH F + + EP   D   R M   
Sbjct: 63  VSTTQTVRADSDDDDEDDQLPQMP-NFPQGSPFEKFFHDFMNRQTEP---DAPPRRMQAL 118

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I   GYI+T+NH++      +V L D+T L AK VG D   DLA+LKV+S +   
Sbjct: 119 GSGFIIDPTGYIVTNNHVIRKADRITVTLQDNTVLTAKAVGHDDRTDLALLKVESKKPLP 178

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            V+F ++++ RVG+ V  IGNPF L GTV+AGI+S+  R+I   P   F Q DAPIN+GN
Sbjct: 179 FVQFGNSDSHRVGDWVLAIGNPFGLSGTVTAGIISSRGRNIDQGPYDDFIQTDAPINKGN 238

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F+  G VIGVN  I +     +G+G  IP +  +  +  L   G+V  GW G+  
Sbjct: 239 SGGPLFDMNGQVIGVNTAIYSPSGGSVGIGFAIPSNEARNVVEQLRKTGKVSRGWLGVRI 298

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           QN+TQ++A  LGL   +G+L+  V K  PA KAG++ GDVI  L+ + I+     + +++
Sbjct: 299 QNVTQDIADGLGLTPARGALVAGVEKNGPAAKAGLQTGDVIQSLNAQPIEGKA--LPRLS 356

Query: 350 SRSPKEQV-KISLCKEGSKHSVAVVLGSSPTAKND--MHLEVGDKELLGMVLQDIN---- 402
           ++ P   V  + + + G    + V + + P   ++      V  K    +   D      
Sbjct: 357 AQLPVGSVAHLGVWRHGKTLDLPVTIAALPEPADETPQKTTVPSKTKETVSFADFGFSVG 416

Query: 403 ------------DGNKKLVRIVALNPNREREVEA-KGIQKGMTIVSVNTHEVSCIKDVER 449
                         N+K V + ++   +E  + A +G++ G  I  V   EV+   D+++
Sbjct: 417 IIDTAARQKYGLSANQKGVLVTSV---QEDGLAADRGLKPGDVITEVQQAEVNTPADLKK 473

Query: 450 LIGKAKEKKRDSVLLQIKYDPD 471
            I  AK+ K+ SVLL + +D D
Sbjct: 474 RIEAAKKDKKRSVLLLV-HDSD 494


>gi|209544159|ref|YP_002276388.1| protease Do [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531836|gb|ACI51773.1| protease Do [Gluconacetobacter diazotrophicus PAl 5]
          Length = 524

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 190/343 (55%), Gaps = 25/343 (7%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I+ DGY++T+NH+V+     +V L D T LPAK+VG D+  DLA+LKV S  K  
Sbjct: 122 GSGFIISADGYVVTNNHVVKGATKVTVTLDDGTTLPAKIVGRDSKTDLALLKVTSQGKLR 181

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            +E  D++ +  GE V  +GNP+ L GTV+AGIVSA  RDI D P  +F Q+DAPIN+GN
Sbjct: 182 FIELGDSDKVEPGEWVVAVGNPYGLGGTVTAGIVSARGRDIGDGPYDSFIQVDAPINRGN 241

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F   G V+GVN  I++     +G+G  IP  ++K  +  L   G V  G+ G++ 
Sbjct: 242 SGGPLFTQDGKVVGVNTAILSPSGGSIGIGFAIPSDVVKNVVYQLQKTGHVTRGYLGVVA 301

Query: 290 QNLTQELAIPLGLRGT------KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           Q +T  +A  LGL+         G+L+ +V   SPA+KAG+K GDVI  L+G+ I S  D
Sbjct: 302 QVITPAMATALGLKPAAPGAPPSGALVASVSNGSPAEKAGIKAGDVITTLNGQKIDSPHD 361

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVV---LGSSPTAKNDMHLEVGDKELLGMVLQD 400
              ++AS  P  +  ++  +  +  S  V    L  +P+        VGD+         
Sbjct: 362 LAVKVASIVPGSKAAVNYMRGTAAQSTTVTIANLSGAPSPDG----AVGDR--------- 408

Query: 401 INDGNKKL-VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
            NDG  +L V +  L  +  +++   G  +G+ +  V +   +
Sbjct: 409 -NDGGPRLGVSLSPLTSDLRQQLGLDGSVRGVVVSDVQSGSAA 450


>gi|254239129|ref|ZP_04932452.1| serine protease MucD precursor [Pseudomonas aeruginosa C3719]
 gi|126171060|gb|EAZ56571.1| serine protease MucD precursor [Pseudomonas aeruginosa C3719]
          Length = 474

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 205/370 (55%), Gaps = 15/370 (4%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    ++K+    M  A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNIST--RQKLPDRAM--ARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVE 130
             ++P+   L   FR DF +    + P      +R     GSGF I++DGYILT+NH+V 
Sbjct: 59  QLSIPDLEGLPPMFR-DFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVA 117

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTI 189
           D     V LSD +E  AKLVG D   D+AVLK+++  K +P ++  D+N ++VGE V  I
Sbjct: 118 DADEILVRLSDRSEHKAKLVGADPRSDVAVLKIEA--KNLPTLKLGDSNKLKVGEWVLAI 175

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G+PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I
Sbjct: 176 GSPFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQI 235

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+
Sbjct: 236 FTRSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGA 295

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + 
Sbjct: 296 LVAQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRK 355

Query: 369 SVAVVLGSSP 378
           S+++ +GS P
Sbjct: 356 SLSMAVGSLP 365


>gi|46579879|ref|YP_010687.1| peptidase/PDZ domain-containing protein [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|46449295|gb|AAS95946.1| peptidase/PDZ domain protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234120|gb|ADP86974.1| protease Do [Desulfovibrio vulgaris RCH1]
          Length = 482

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 222/427 (51%), Gaps = 32/427 (7%)

Query: 63  SVEQMFNAYG--FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           +V+   N +G    N P+  P   +F + F +F     P      ++   GSGF ++ DG
Sbjct: 50  TVQAPENPFGDMLRNAPQGTPFDRFFEQ-FERFHGKMRP-----QKQRSLGSGFILSADG 103

Query: 121 YILTSNHIVEDGASFSVILSDDT----ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           YI+T+NH++ D     V + ++T       AK++GTD   DLA+LK+ + R+   + F D
Sbjct: 104 YIVTNNHVIADADVIHVNIENETGKSASYDAKVIGTDEETDLALLKIDAKRQLPVLRFGD 163

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCF 235
           ++++ VGE +  IGNPF L  +V+AGI+SA  RDI   P   F Q DA IN GNSGGP  
Sbjct: 164 SDSLEVGEWLMAIGNPFGLDHSVTAGILSAKGRDIRSGPFDNFLQTDASINPGNSGGPLI 223

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N  IV SGQ   G+G  IP ++  + I  L S  +V  GW G+  Q++ + 
Sbjct: 224 NMKGEVIGINTAIVASGQ---GIGFAIPSNMAARIIDQLKSDKKVRRGWIGVTIQDVDEN 280

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
            A  LGL   +G+L+ +V+   PADKAG+K GD++  ++G  I      + ++A+  P E
Sbjct: 281 TARALGLGEPRGALVGSVMPGEPADKAGIKAGDILLKVEGEDIADSGRLLRRVAALKPGE 340

Query: 356 QVKISLCKEGSKHSVAVVLGSSP---------TAKNDMHLEVGDKELLGMVLQDINDGNK 406
             KI+L + G   +V + LG            T +     +      LG+ ++  N    
Sbjct: 341 TAKITLWRNGQTKTVNLTLGERTAEHLAAQGGTPRQTPESKQQASSSLGLTVRPPNAEEA 400

Query: 407 KLVR------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
           + ++      ++ +     R      I+ G  ++S N H V+   D+ +++ +   K+R 
Sbjct: 401 RALKLDRPQGLLVIAVEEGRPAADADIRAGDVVLSANLHPVNSTADLAKVV-QEDAKRRG 459

Query: 461 SVLLQIK 467
           +V+LQI+
Sbjct: 460 AVMLQIQ 466


>gi|162147098|ref|YP_001601559.1| Serine protease [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785675|emb|CAP55246.1| Serine protease [Gluconacetobacter diazotrophicus PAl 5]
          Length = 509

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 190/343 (55%), Gaps = 25/343 (7%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I+ DGY++T+NH+V+     +V L D T LPAK+VG D+  DLA+LKV S  K  
Sbjct: 107 GSGFIISADGYVVTNNHVVKGATKVTVTLDDGTTLPAKIVGRDSKTDLALLKVTSQGKLR 166

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            +E  D++ +  GE V  +GNP+ L GTV+AGIVSA  RDI D P  +F Q+DAPIN+GN
Sbjct: 167 FIELGDSDKVEPGEWVVAVGNPYGLGGTVTAGIVSARGRDIGDGPYDSFIQVDAPINRGN 226

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F   G V+GVN  I++     +G+G  IP  ++K  +  L   G V  G+ G++ 
Sbjct: 227 SGGPLFTQDGKVVGVNTAILSPSGGSIGIGFAIPSDVVKNVVYQLQKTGHVTRGYLGVVA 286

Query: 290 QNLTQELAIPLGLRGT------KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           Q +T  +A  LGL+         G+L+ +V   SPA+KAG+K GDVI  L+G+ I S  D
Sbjct: 287 QVITPAMATALGLKPAAPGAPPSGALVASVSNGSPAEKAGIKAGDVITTLNGQKIDSPHD 346

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVV---LGSSPTAKNDMHLEVGDKELLGMVLQD 400
              ++AS  P  +  ++  +  +  S  V    L  +P+        VGD+         
Sbjct: 347 LAVKVASIVPGSKAAVNYMRGTAAQSTTVTIANLSGAPSPDG----AVGDR--------- 393

Query: 401 INDGNKKL-VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
            NDG  +L V +  L  +  +++   G  +G+ +  V +   +
Sbjct: 394 -NDGGPRLGVSLSPLTSDLRQQLGLDGSVRGVVVSDVQSGSAA 435


>gi|32330661|gb|AAP79877.1| serine protease [Wolbachia endosymbiont of Onchocerca volvulus]
          Length = 494

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 138/418 (33%), Positives = 230/418 (55%), Gaps = 25/418 (5%)

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           F + F +FF    P  S   E ++ GSGF I   G I+T+ H+++D    +V ++DDT  
Sbjct: 88  FFEYFDQFFMDRGP--SVNREAVLLGSGFIIDKSGIIVTNYHVIKDAQHITVTMNDDTYF 145

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            A+++G DA  DLAVLK+++D+ F  V   +++  RVG+ V  IGNPF L G VS GI+S
Sbjct: 146 KAEVLGYDAKTDLAVLKIKADKDFSFVTLGNSDEARVGDMVMAIGNPFGLGGPVSTGIIS 205

Query: 206 ALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF--HMGVGLII 262
           A  RDI       F Q DA IN+GNSGGP F+  G VIG+N  I +  +   ++G+G  I
Sbjct: 206 ARSRDISIGTTSEFIQTDAAINRGNSGGPLFDLNGKVIGINTAIYSPSESGGNVGIGFAI 265

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P ++    I +L S  ++ HGW G+  Q +T+E A  LGL+  KG+L+  +VK+SPA+K 
Sbjct: 266 PSNLAISIIDTLKSGKKIKHGWLGVQVQPITREFAESLGLKDVKGALVANIVKDSPAEKG 325

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK- 381
           G+KVGD++   DG+ I     +       +  ++V+I L ++G + +V VV+  S  A  
Sbjct: 326 GIKVGDILLEFDGKKIDRMTHYPKWFQGLNLGKKVQIKLLRKGKEVNVKVVIEESVNAAK 385

Query: 382 ---NDMHLEVGDKELLGMVLQDINDGNKK------LVRIVALNPNREREVEAKGIQKGMT 432
                 +  + D  + G+ + ++    K+      +  ++  N +       +GI+KG  
Sbjct: 386 IAIQKKNRSISD-YITGLTVSNLPKEPKESKNGPPIKGVIVTNVDSNSNATLRGIKKGDI 444

Query: 433 IVSVNTHEVSCIKDVERLIGKA-KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           I+ ++  ++   ++ ++ +  A K+  +DS++L I      ++GN     F S+K+ K
Sbjct: 445 IIQLDGVDIENTENFQKQVDLAIKKSGKDSIMLLI-----YRNGN---QFFTSIKLKK 494


>gi|114331760|ref|YP_747982.1| protease Do [Nitrosomonas eutropha C91]
 gi|114308774|gb|ABI60017.1| protease Do [Nitrosomonas eutropha C91]
          Length = 490

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 148/487 (30%), Positives = 245/487 (50%), Gaps = 35/487 (7%)

Query: 15  VALTCVIFSSTYLV---LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           +A    +  S +++   L+AK  P   DL   + +   ++V++     ++V V Q     
Sbjct: 27  IAFIIFLCWSAFMLPVSLQAKDLPDFTDL---VEKHGQAVVNISTVQTQQVGVGQFLPE- 82

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
              N+PED P   +FR+    F SG         E    GSGF I+ DGYILT+ H+VE 
Sbjct: 83  -IPNIPEDSPFYEFFRRHIQPF-SGPR-----KYESRSLGSGFIISKDGYILTNAHVVEA 135

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA-NNIRVGEAVFTIG 190
               +V L+D  E  AK++G D   D+A+LK+  D   +PV  + +   ++VGE V  IG
Sbjct: 136 ANEITVRLTDKREFSAKVIGADQKTDIALLKI--DANDLPVVTQGSPEQLKVGEWVVAIG 193

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
            PF    TV+AGIVSA  R +       F Q D  IN GNSGGP FN  G V+G+N+ I 
Sbjct: 194 APFGFENTVTAGIVSAKGRSLAQENYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQIY 253

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +     MG+   IP+ +       L + G++  G  G+M Q +T ELA    L  ++G+L
Sbjct: 254 SRTGGFMGLSFAIPIDVAMDIADQLKTYGKISRGKIGVMIQEMTDELAESFSLDKSRGAL 313

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           + +V K  PADKAG+K+ DVI   DG+ I++  D    + +  P  +V + + + GS   
Sbjct: 314 VVSVEKGGPADKAGIKIRDVILKFDGKDIEASSDLPRIVGNTKPGSKVPVEIWRSGSVKK 373

Query: 370 VAVVLGSSPTAK---NDMHLEVGDK-ELLGMVLQDINDGNKKLVRI---VALNPNREREV 422
           + + +G  P      N    + GD    LG+VL++++   K  + I   + ++   +   
Sbjct: 374 MTISVGEMPADGNIVNQKQSKSGDATSRLGLVLRELSANQKNQLGIENGLLVDEVYDGIA 433

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
            + GI+ G  I+  N  ++  I+   +L+  A + +  ++L++            +++ F
Sbjct: 434 SSSGIRPGDIILGFNNQDIKSIRQFNKLLNDAPKGRNIALLIR----------RGDVATF 483

Query: 483 VSLKIDK 489
           +++KID+
Sbjct: 484 ITIKIDE 490


>gi|126725615|ref|ZP_01741457.1| possible serine protease [Rhodobacterales bacterium HTCC2150]
 gi|126704819|gb|EBA03910.1| possible serine protease [Rhodobacterales bacterium HTCC2150]
          Length = 508

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 139/426 (32%), Positives = 217/426 (50%), Gaps = 28/426 (6%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE  PL+++FR    +   G+ P  S        GSGF I+ DGYI+T+NH+++     
Sbjct: 96  VPEGSPLEDFFRDFTERQRDGQRPRRS-----AALGSGFVISADGYIVTNNHVIDKADEI 150

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            +      EL AKLVGTD   D+A+LKV+SD     VEF +++  RVG+ V  +GNP   
Sbjct: 151 MIEFFSGLELEAKLVGTDPKTDIALLKVESDVPLEFVEFGNSDVARVGDWVMAVGNPLGQ 210

Query: 196 RGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
             +VSAGI+SA +R +      F Q DA IN+GNSGGP FN  G VIGVN  I++     
Sbjct: 211 GFSVSAGIISARNRSLSGTYDDFIQTDAAINKGNSGGPLFNMDGDVIGVNTAILSPSGGS 270

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +  S++   +  L+  G    GW G+  Q++T ++A  LGL   +G+LIT  V 
Sbjct: 271 IGIGFSMSSSVVTNVVDQLLEFGETRRGWLGVRIQDVTADVAEALGLAKAEGALITD-VP 329

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           + PA  AG+  GDVI   DG  I   ++ V  + +    + V + + +EG++ ++A+ LG
Sbjct: 330 DGPAKDAGVLAGDVILTFDGADIVDTRELVRIVGNTQVGKAVDVLVVREGAEVTLAITLG 389

Query: 376 SS-------PTAKNDMHLEVGDKELLGMVLQDINDG-------NKKLVRIVALNPNRERE 421
                    P +         D+E+LG+ L  + D         +K   +V  + + + E
Sbjct: 390 RREEAESVVPASAPATETPPADQEVLGIKLAPLTDELRAELDLGEKATGLVVRDLDEQSE 449

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSR 481
              KG++ G  I      +V    D+ + +  A E  R S+LL ++             R
Sbjct: 450 AYEKGLRAGDLIAEAGQKKVVSAADLTKQVEIAIEAGRKSLLLLVR--------RAGQPR 501

Query: 482 FVSLKI 487
           FV+L +
Sbjct: 502 FVALSV 507


>gi|15595963|ref|NP_249457.1| serine protease MucD precursor [Pseudomonas aeruginosa PAO1]
 gi|254245021|ref|ZP_04938343.1| serine protease MucD precursor [Pseudomonas aeruginosa 2192]
 gi|9946654|gb|AAG04155.1|AE004511_8 serine protease MucD precursor [Pseudomonas aeruginosa PAO1]
 gi|1184684|gb|AAC43676.1| MucD [Pseudomonas aeruginosa PAO1]
 gi|1220194|gb|AAC43718.1| MucD [Pseudomonas aeruginosa PAO1]
 gi|126198399|gb|EAZ62462.1| serine protease MucD precursor [Pseudomonas aeruginosa 2192]
 gi|157004259|gb|ABV00672.1| MucD [Pseudomonas aeruginosa]
          Length = 474

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 129/370 (34%), Positives = 205/370 (55%), Gaps = 15/370 (4%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    ++K+    M  A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNIST--RQKLPDRAM--ARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVE 130
             ++P+   L   FR DF +    + P      +R     GSGF I++DGYILT+NH+V 
Sbjct: 59  QLSIPDLEGLPPMFR-DFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVA 117

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTI 189
           D     V LSD +E  AKL+G D   D+AVLK+++  K +P ++  D+N ++VGE V  I
Sbjct: 118 DADEILVRLSDRSEHKAKLIGADPRSDVAVLKIEA--KNLPTLKLGDSNKLKVGEWVLAI 175

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G+PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I
Sbjct: 176 GSPFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQI 235

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+
Sbjct: 236 FTRSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGA 295

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + 
Sbjct: 296 LVAQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRK 355

Query: 369 SVAVVLGSSP 378
           S+++ +GS P
Sbjct: 356 SLSMAVGSLP 365


>gi|94986790|ref|YP_594723.1| trypsin domain/PDZ domain-containing protein [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731039|emb|CAJ54402.1| trypsin domain/PDZ domain protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 474

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 155/475 (32%), Positives = 239/475 (50%), Gaps = 41/475 (8%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           IC   +  +    T  + E+ LP    +  P++   S ++V++  E KK       F   
Sbjct: 9   ICITLMFIITVVPT--IAESALP----NFVPLVKDASKAVVNISTE-KKIPRGRTEFPME 61

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV--ERLMFGSGFFITDDGYILTSNHIV 129
            F  LP            F +FF   EP   D+   ++   G+GF I+ DGYI+T+NH++
Sbjct: 62  MFRGLPPG----------FERFFEQFEPKGPDSQIHKQRSLGTGFIISSDGYIVTNNHVI 111

Query: 130 EDGASFSVILS----DDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
           E   S  V L      +  LPA+++G D   DLA+LKV+S      + F +++ + VGE 
Sbjct: 112 EGADSVRVNLEGTSGKEESLPAEVIGRDEETDLALLKVKSKDSLPYLIFGNSDTMEVGEW 171

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  IGNPF L  TV+AGI+SA  RDI   P   F Q DA IN GNSGGP  N  G V+G+
Sbjct: 172 VLAIGNPFGLGHTVTAGILSAKGRDIHAGPFDNFLQTDASINPGNSGGPLINMSGQVVGI 231

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I+ SGQ   G+G  IP S+  + I  L +  +V  GW G+  Q++    A  LGL  
Sbjct: 232 NTAIMASGQ---GIGFAIPSSMADRIIEQLKTNKKVSRGWIGVTIQDVDTNTAKALGLSQ 288

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
            KG+L+ +VV   PADKAG+KVGD++   DG+ I S    +  IA++ P   VK+ + ++
Sbjct: 289 AKGALVGSVVPGDPADKAGLKVGDIVTQADGKQIDSASSLLKAIATKPPFSVVKLKVWRD 348

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGD-KELLGMVLQDINDGNKKL--------VRIVALN 415
           G    +++ LG   T  +            LG+ ++ +     K         + +V++ 
Sbjct: 349 GKSKDISITLGERKTTSSQKQSSPESLPGALGLSVRPLTQEESKSFDVKLGIGLLVVSVE 408

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI-GKAKEKKRDSVLLQIKYD 469
           PN  +     GI++   I+S N   +    D+  +I G A  KK+  ++LQ++ +
Sbjct: 409 PN--KPASEAGIREQDIILSANLKPLQSADDLANIICGDA--KKKGVIMLQLQRN 459


>gi|226940143|ref|YP_002795216.1| HtrA [Laribacter hongkongensis HLHK9]
 gi|226715069|gb|ACO74207.1| HtrA [Laribacter hongkongensis HLHK9]
          Length = 497

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 138/391 (35%), Positives = 206/391 (52%), Gaps = 17/391 (4%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PED PL  +F++        +EP  SD++    +GSGF ++ DG++LT+ H+V+     
Sbjct: 89  IPEDDPLFEFFKRFMPPGGGNQEPEESDSIS---YGSGFIVSPDGFVLTNAHVVQGAQQI 145

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFR 194
            V L+D  E+ AKLVG D   D+A+LK+  D   +P V+  D N ++VGE V  IG PF 
Sbjct: 146 QVKLTDKREVRAKLVGLDRRTDVALLKI--DAASLPTVKIGDPNTLKVGEWVAAIGAPFG 203

Query: 195 LRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
              TV+AGIVSA  R +PD     F Q D  IN GNSGGP FN  G V+G+N+ I +   
Sbjct: 204 FDNTVTAGIVSAKGRSLPDDTFVPFIQTDVAINPGNSGGPLFNLKGQVVGINSQIYSRSG 263

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             MG+   IP+ I       L + GRV  G  G+  Q L+QELA   GL    G+L+  V
Sbjct: 264 GFMGISFAIPIDIAMSVAEQLKANGRVSRGQLGVHIQELSQELARSFGLSTAAGALVVRV 323

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
              SPA KAG++ GD+I  LDGR ++S  D    +    P   VK+ + ++G + ++   
Sbjct: 324 EPGSPAAKAGLQPGDIILNLDGRKVQSSTDLPMMVGQMKPGTTVKLGVWRKGKEVTLDAT 383

Query: 374 LG--------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVA-LNPNREREVEA 424
           L          +P  K    +     + LG+ L +++   +K + + + L  ++     A
Sbjct: 384 LAEMRNPGTEEAPQQKAPSQIPSTTFDKLGLTLSELSASQRKELGVQSGLLVDKVGGPAA 443

Query: 425 K-GIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           K G+  G  I+ VN   VS I++  +LI  A
Sbjct: 444 KSGLMHGDIILGVNQSPVSNIEEFRKLIDAA 474


>gi|222054125|ref|YP_002536487.1| protease Do [Geobacter sp. FRC-32]
 gi|221563414|gb|ACM19386.1| protease Do [Geobacter sp. FRC-32]
          Length = 476

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 139/396 (35%), Positives = 202/396 (51%), Gaps = 39/396 (9%)

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
           F  FF G   +     E  + GSGF I+ DGYI+T++H+V D  S  V LSD+     K+
Sbjct: 87  FEDFFGGRGGMPQYRRENSL-GSGFIISKDGYIITNDHVVRDAESIQVTLSDEKTYKGKV 145

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           VG D   D+AV+K+ ++         D++ + VG+    IGNPF L  TV+ G++SA  R
Sbjct: 146 VGGDPKTDIAVIKINANGDLPVAVLGDSDKLSVGQWSIAIGNPFGLNRTVTVGVISATGR 205

Query: 210 DIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSII 267
                +    F Q DA IN GNSGGP  N  G VIG+N  IV SGQ   G+G  IP+++ 
Sbjct: 206 SNMGIETYENFIQTDASINPGNSGGPLLNVYGEVIGINTAIVASGQ---GIGFAIPINMA 262

Query: 268 KKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVG 327
           K A+P LI KG V  GW G+  Q +T++LA   GL  T+G+L++ VV  SPA KAG++ G
Sbjct: 263 KIAVPQLIKKGNVTRGWLGVSIQPVTEDLAQSFGLNKTQGALVSDVVPGSPAAKAGVRQG 322

Query: 328 DVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV--------------- 372
           D+I    G+ IKS Q     +A+      V+I + +EG    + V               
Sbjct: 323 DIITGFAGKEIKSVQQLQLTVANTPVGSAVEIEVLREGQTKKLTVAPASADSAAALAPAP 382

Query: 373 -VLGSSP--TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQK 429
              GS+    A  D+  E+    L G+++ D+ +G                     GIQ+
Sbjct: 383 SEAGSAALGLAVADLPRELKQTGLQGVIVTDVEEGGL---------------AAESGIQQ 427

Query: 430 GMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
           G  +VSVN  ++S   D  R I  A+ K   ++L++
Sbjct: 428 GDVLVSVNQKKISGTGDYARAIKDAERKGSVALLVR 463


>gi|148266305|ref|YP_001233011.1| protease Do [Geobacter uraniireducens Rf4]
 gi|146399805|gb|ABQ28438.1| protease Do [Geobacter uraniireducens Rf4]
          Length = 466

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 129/349 (36%), Positives = 185/349 (53%), Gaps = 11/349 (3%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I+D+GYI+T+NH+V       V LSD  E   ++ G+D   DLA++K+ +    
Sbjct: 95  LGSGFIISDEGYIITNNHVVSGADEIKVKLSDGREFKGEIKGSDEKLDLALVKISAKDHL 154

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
                 D++ I VGE V  IGNPF L  TV+AGIVSA  R I   P   F Q DA IN G
Sbjct: 155 PVATLGDSDTIEVGEWVMAIGNPFGLAQTVTAGIVSAQGRVIGSGPYDDFIQTDASINPG 214

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FNA G VIG+N  I+  GQ   G+G  IP+++ K  I  L   G+V  GW G+ 
Sbjct: 215 NSGGPLFNAHGEVIGINTAIIAGGQ---GIGFAIPVNMAKNIITQLKETGKVTRGWIGVS 271

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +T ELA    L G KG+L+  +VK+SPA+KAG+K GD+I   +G++I    +    +
Sbjct: 272 IQPITPELAQSFDLEGEKGALVAEIVKDSPAEKAGIKTGDIILEFNGKMIHEMNELPRLV 331

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIND----- 403
           A+    ++V + + +EG    V V +      +      +G ++ LGM ++ +N      
Sbjct: 332 AATPVGKKVTVKILREGKSEDVPVTVERLKDGEAGGQPGIG-QDRLGMTVRALNKDLAAR 390

Query: 404 -GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
            G K+   +V          E  GI  G  I  +N   +  I D E+ +
Sbjct: 391 MGIKEQSGVVVTEIKAGGSAEQAGISIGDIIREINGARIDSIGDYEKAV 439


>gi|313105588|ref|ZP_07791854.1| serine protease MucD precursor [Pseudomonas aeruginosa 39016]
 gi|310878356|gb|EFQ36950.1| serine protease MucD precursor [Pseudomonas aeruginosa 39016]
          Length = 474

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 129/370 (34%), Positives = 205/370 (55%), Gaps = 15/370 (4%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    ++K+    M  A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNIST--RQKLPDRAM--ARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVE 130
             ++P+   L   FR DF +    + P      +R     GSGF I++DGYILT+NH+V 
Sbjct: 59  QLSIPDLEGLPPMFR-DFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVA 117

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTI 189
           D     V LSD +E  AKL+G D   D+AVLK+++  K +P ++  D+N ++VGE V  I
Sbjct: 118 DADEILVRLSDRSEHKAKLIGADPRSDVAVLKIEA--KNLPTLKLGDSNKLKVGEWVLAI 175

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G+PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I
Sbjct: 176 GSPFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLEGEVVGINSQI 235

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+
Sbjct: 236 FTRSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGA 295

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + 
Sbjct: 296 LVAQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRK 355

Query: 369 SVAVVLGSSP 378
           S+++ +GS P
Sbjct: 356 SLSMAVGSLP 365


>gi|218893291|ref|YP_002442160.1| serine protease MucD precursor [Pseudomonas aeruginosa LESB58]
 gi|218773519|emb|CAW29331.1| serine protease MucD precursor [Pseudomonas aeruginosa LESB58]
          Length = 474

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 129/370 (34%), Positives = 205/370 (55%), Gaps = 15/370 (4%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    ++K+    M  A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNIST--RQKLPDRAM--ARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVE 130
             ++P+   L   FR DF +    + P      +R     GSGF I++DGYILT+NH+V 
Sbjct: 59  QLSIPDLEGLPPMFR-DFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVA 117

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTI 189
           D     V LSD +E  AKL+G D   D+AVLK+++  K +P ++  D+N ++VGE V  I
Sbjct: 118 DADEILVRLSDRSEHKAKLIGADPRSDVAVLKIEA--KNLPTLKLGDSNKLKVGEWVLAI 175

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G+PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I
Sbjct: 176 GSPFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLEGEVVGINSQI 235

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+
Sbjct: 236 FTRSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGA 295

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + 
Sbjct: 296 LVAQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRK 355

Query: 369 SVAVVLGSSP 378
           S+++ +GS P
Sbjct: 356 SLSMAVGSLP 365


>gi|126740174|ref|ZP_01755863.1| Putative trypsin-like serine protease [Roseobacter sp. SK209-2-6]
 gi|126718629|gb|EBA15342.1| Putative trypsin-like serine protease [Roseobacter sp. SK209-2-6]
          Length = 377

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 124/361 (34%), Positives = 201/361 (55%), Gaps = 15/361 (4%)

Query: 23  SSTYLVLEAKLP----PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
           ++T L+  A  P    P S     ++  VSP++V V V  K+    E        G  P 
Sbjct: 19  AATVLLSLAPAPALAVPGSGGYADLVESVSPAVVYVEVTGKRTTKAEA-------GAKPH 71

Query: 79  DH--PLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
               P +++F ++F + F  + P           GSGF I+++G I+T++H+V+   +  
Sbjct: 72  KQMSPGEDFF-EEFRRRFGHQMPGQGQMRPTKGAGSGFVISEEGLIVTNHHVVKGADTVE 130

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V LSD ++  A+++G D L D+A+L++++ +    VEF  + ++RVGE V  +G+PF L 
Sbjct: 131 VTLSDGSKHAAEVIGADPLTDIALLQIEAGKDLPVVEFGSSGDLRVGEEVIAMGSPFGLS 190

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV++GIVSA  R+I   P   F Q DA IN+GNSGGP FN  G V+GVN  I +     
Sbjct: 191 GTVTSGIVSATSRNINAGPFDDFIQTDAAINRGNSGGPLFNGEGDVVGVNTAIFSPDGGS 250

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +P  +++  +  L   GR+D GW G+  + L+++ A  LGL   KG +I +VV 
Sbjct: 251 VGIGFAVPSDLVRDIVADLQDDGRIDRGWLGVQIKPLSEDAANVLGLEAGKGVVIESVVA 310

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           +SPA+ AG+K GDV+    G  +   +D    +A  +P+E+ K+ + + G    + V LG
Sbjct: 311 DSPAEAAGLKPGDVVVSFGGAEVGELRDLTKAVAMNNPEEETKMEILRRGKTLEIDVTLG 370

Query: 376 S 376
           +
Sbjct: 371 N 371


>gi|148269492|ref|YP_001243952.1| protease Do [Thermotoga petrophila RKU-1]
 gi|147735036|gb|ABQ46376.1| protease Do [Thermotoga petrophila RKU-1]
          Length = 459

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 132/378 (34%), Positives = 218/378 (57%), Gaps = 16/378 (4%)

Query: 85  YFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
           YF + F K+F    P     V  L  GSGF    +GYILT+ H+V    + +V + D ++
Sbjct: 57  YFEQFFKKWFGELPPGFERQVASL--GSGFIFDPEGYILTNYHVVGGADNITVTMLDGSK 114

Query: 145 LPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
             A+ +G D   D+AV+K++ SD+KF  +EF D++ +++GE    IGNP   + TV+ G+
Sbjct: 115 YDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGV 174

Query: 204 VSALDRDIPDRPGT-----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           VSA +R IP   G+       Q DA IN GNSGGP  N  G VIG+N  IV   Q  + +
Sbjct: 175 VSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNP-QEAVNL 233

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  IP++ +KK + +++++ +V+  + G+   NLT+E A  LGL  T G+LIT+V K SP
Sbjct: 234 GFAIPINTVKKFLDTILTQKKVEKAYLGVTVMNLTEETAKALGLESTSGALITSVQKGSP 293

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A+KAG+K GDVI  +D + ++SH++ V  I +  P +   +++ ++G    V V  GSS 
Sbjct: 294 AEKAGLKEGDVILKVDDQDVRSHEELVSIIHTYKPGDTAVLTIERKGKIMKVQVTFGSS- 352

Query: 379 TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI-VALNPNREREVEAK-GIQKG--MTIV 434
           + +          ++LG+ + +I   +++   I   +N    +E   K G+QKG  +T V
Sbjct: 353 SEEEKTTTGEEKIDVLGITVSNITPADRETYSIPEEINGVIVKESTGKFGLQKGDVITTV 412

Query: 435 SVN--THEVSCIKDVERL 450
            VN   ++++ ++D++++
Sbjct: 413 YVNGKRYDINSVEDLKKV 430


>gi|90419206|ref|ZP_01227116.1| serine protease [Aurantimonas manganoxydans SI85-9A1]
 gi|90336143|gb|EAS49884.1| serine protease [Aurantimonas manganoxydans SI85-9A1]
          Length = 492

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 149/472 (31%), Positives = 234/472 (49%), Gaps = 51/472 (10%)

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG----NLPEDHPLKNYFRKDFHKFFSG 96
           P  +A ++  ++  +V     +S  Q  +  G G      PE  PL+++F          
Sbjct: 26  PASVADLAEGLLDAVV----NISTSQSVDVAGRGVPPLEAPEGSPLQDFF----DDLLQD 77

Query: 97  EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
            + + +  V+ L  GSGF +   G ++T+NH++ D  + +V  +D T+L A+L+GTD   
Sbjct: 78  RDGLGNRRVQSL--GSGFVVDPSGVVVTNNHVIADADTITVNFADGTQLDAELIGTDPKT 135

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP- 215
           DLAVLKV+ +   + V+F D+  +R+G+ V  IGNPF L G+VS GIVSA  R+I   P 
Sbjct: 136 DLAVLKVEPEEPLVSVKFGDSEALRIGDWVMAIGNPFGLGGSVSIGIVSARGRNINAGPY 195

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q DA IN+GNSGGP F+  G V+G+N  I++     +G+G  +P ++    I  L 
Sbjct: 196 DNFIQTDAAINRGNSGGPLFDLNGDVVGINTAIISPSGGSIGIGFSVPSNLAVNVIDQLR 255

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
             G    GW GI  Q +T ++A  LG+   +G+++  +V+  P+D   +KVGDVI   DG
Sbjct: 256 EFGETRRGWLGIRLQAVTDDIAEGLGIGEARGAVVMGIVEGGPSDNGLLKVGDVIVSFDG 315

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLC------KEGSKHSVAVVLG-------------- 375
             ++S +D    +A     + V + +       K   + SV V LG              
Sbjct: 316 AAVESSRDLPRIVAETPVGKAVAVEVLRKTATDKPAERTSVEVTLGRLEDGEKLMAESDD 375

Query: 376 ----SSPTAKNDMHLEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREV 422
               S P A      + G  E LGM L +I+           + K V I A+ P+     
Sbjct: 376 AAPTSDPEAAETGDTDAGPVETLGMTLTEIDPTLREQYALAEDAKGVVITAVAPS--SNA 433

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK-EKKRDSVLLQIKYDPDMQ 473
             KGI+ G  I  V   EV+  ++V   I K K E +R+++LL    + D++
Sbjct: 434 AEKGIEAGTLIREVAQEEVATAREVADKIAKLKDEGRRNALLLLAASNGDLR 485


>gi|254476627|ref|ZP_05090013.1| protease DO [Ruegeria sp. R11]
 gi|214030870|gb|EEB71705.1| protease DO [Ruegeria sp. R11]
          Length = 500

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 141/434 (32%), Positives = 227/434 (52%), Gaps = 34/434 (7%)

Query: 74  GNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
           G +PE  P +++FR+   +   G  P  S        GSGF I++DGYI+T+NH++E+  
Sbjct: 79  GIVPEGSPFEDFFREFQDRNGQGNRPRRSSA-----LGSGFVISEDGYIVTNNHVIEEAD 133

Query: 134 SFSV-ILSDDTE----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
              +     D +    LPAK+VGTD   D+A+LKV +      V+F D++  RVG+ V  
Sbjct: 134 EIEIEFFPGDGQPAQPLPAKVVGTDPNTDIALLKVDAPMPLSFVKFGDSDIARVGDWVVA 193

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           +GNP     +VSAGIVSA +R++      + Q DA IN+GNSGGP FN  G VIGVN  I
Sbjct: 194 MGNPLGQGFSVSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAI 253

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           ++     +G+G  +  +++ K +  L   G    GW G+  Q++T ++A  +G+   KG+
Sbjct: 254 LSPNGGSIGIGFSMASNVVTKVVDQLREYGETRRGWLGVRIQDVTSDVAEAMGMDSAKGA 313

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+T  V E PA  AG+  GDVI   DG  ++  +  V Q+ +    + V++ + +EG   
Sbjct: 314 LVTD-VPEGPAKDAGLLAGDVILSFDGADVEDTRGLVRQVGNTEVGKAVRVVVYREGKTE 372

Query: 369 SVAVVLGSSPTAKNDMHLEVG--------DKELLGMVLQDINDGNKKLVRI-------VA 413
           ++ V LG    A+     + G        +KELLG+ +  ++D  +  + +       V 
Sbjct: 373 TLRVTLGRREDAQRQAGADTGSEIAPDTREKELLGLTVSRLSDDQRSELNVPEGTDGLVI 432

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
              +   E   KG++ G  I      ++S I ++E  I +AKE  R S+LL ++     +
Sbjct: 433 TGVDETSEAFEKGLRAGDIITEAGQQKLSTIAELEDRISEAKEAGRKSLLLLVR-----R 487

Query: 474 SGNDNMSRFVSLKI 487
           +G     RFV+L +
Sbjct: 488 AGE---PRFVALNL 498


>gi|159185024|ref|NP_355011.2| htrA family protein [Agrobacterium tumefaciens str. C58]
 gi|159140298|gb|AAK87796.2| htrA family protein [Agrobacterium tumefaciens str. C58]
          Length = 514

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 128/377 (33%), Positives = 198/377 (52%), Gaps = 19/377 (5%)

Query: 42  PVIARV---SPSIVSVMVEP----KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF 94
           PV AR     P  V+ + EP       +S  Q     G G +P   P  + F++ F  +F
Sbjct: 29  PVAARAQSHGPESVADLAEPLLDAVVNISTSQNVKTEGKGPVPPKLPEGSPFQEFFKDYF 88

Query: 95  SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
             ++P   + V  L  GSGF I   GY++T+NH++E   +  VI  + ++L A LVGTD 
Sbjct: 89  DSQKPEGGEKVNSL--GSGFVIDPAGYVVTNNHVIEGADAIEVIFPNGSKLKATLVGTDT 146

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             DL+VLKV+       V+F D+ ++R+G+ V  +GNPF L G+++ G++SA  R+I   
Sbjct: 147 KTDLSVLKVEPKTPLKAVKFGDSRSMRIGDWVMAVGNPFGLGGSLTVGVISARGRNINAG 206

Query: 215 P-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
           P   F Q DA IN+GNSGGP FN  G VIG+N  I++     +G+G  +P  + +  +  
Sbjct: 207 PYDNFIQTDAAINKGNSGGPLFNMKGEVIGINTAIISPSGGSIGIGFAVPTELAQNIVQQ 266

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           LI  G    GW G+  Q +T ++A  LG+   KG+LI+ V K  P +   ++ GDV+   
Sbjct: 267 LIEFGETRRGWLGVRVQPVTDDVAASLGMDSAKGALISGVAKGGPVENGPIQAGDVVLKF 326

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS------SPTAKNDMHLE 387
           DG+ I   +D +  +A     ++V + + ++G + +V V LG          + +D   E
Sbjct: 327 DGKDINEMRDLLRIVAESPVGKEVDVVVYRDGKEETVKVKLGQLQDTTDEKASTDDPQGE 386

Query: 388 VGDKELLGMVLQDINDG 404
            GD     MV  D  DG
Sbjct: 387 DGDGS---MVAPDDKDG 400


>gi|254292839|ref|YP_003058862.1| protease Do [Hirschia baltica ATCC 49814]
 gi|254041370|gb|ACT58165.1| protease Do [Hirschia baltica ATCC 49814]
          Length = 489

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 165/480 (34%), Positives = 249/480 (51%), Gaps = 36/480 (7%)

Query: 11  SICT-VALTCVIFSSTYLVLE--AKLPPSSVD-LPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           ++C  + L C   +S    +E  A+ P ++ D    + AR+ PS+V++          + 
Sbjct: 15  TLCVGLVLGCFSVASAQTAIETPAQAPQNAPDSFSKLAARLMPSVVNISTR-------QT 67

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFITDDGYILTS 125
           M    G G   ED PL+     +F++FF+ +     D ++R+   GSGF I  +GY++T+
Sbjct: 68  MSAGSGIGAFGEDSPLE-----EFNEFFNRD----GDGLKRVSSLGSGFIIDVEGYVVTN 118

Query: 126 NHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
           NH++E      V+LSD T L A+LVG DA  DLA+LKV  +   I V+F D+++  VG+ 
Sbjct: 119 NHVIESADEIDVVLSDGTILAAELVGRDAATDLALLKVVPEAPLISVDFGDSDSALVGDW 178

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  IGNPF L GTV+AGIVSA DR+I   +   F Q DA IN+GNSGGP FN  G VIGV
Sbjct: 179 VVAIGNPFGLGGTVTAGIVSARDRNINAGQYDDFIQTDAAINKGNSGGPLFNLNGEVIGV 238

Query: 245 NAMIVT--SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           N  I +   G   +GVG  +P ++  + +  L  KG V+ GW G+  Q +T ELA   G 
Sbjct: 239 NTAIYSPSGGGGSVGVGFSVPSNLTTQIVQQLKDKGFVERGWLGVRVQGVTPELARSYGR 298

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
           +   G+++T V + SPA +AG+++GD+I    G+ IK  +D    +AS    E V +S+ 
Sbjct: 299 KRAVGAIVTHVTENSPASRAGLEIGDLIYAFHGQEIKETRDLSSIVASAPIGEGVAMSVL 358

Query: 363 KEGSKHSVAVVLG-SSPTAKNDMHLEVGD----KELLGMVLQDINDGNKKLVRIVALNPN 417
           ++  +  + V L       ++D  ++         LLG+ L  I+D +++  RI A    
Sbjct: 359 RKKKETEIVVTLDLMESDVRSDEPVDYSGAPSFSNLLGVELSVISDEDRRRYRIPASVEG 418

Query: 418 REREVEAKG------IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
                   G      + KG  IV VN   V    D      +    + + VLLQ   D D
Sbjct: 419 VVVVRVEPGSDAIGKLSKGDVIVEVNFLTVRT-PDEAIAEAEIVAARGEPVLLQFYRDGD 477


>gi|291279451|ref|YP_003496286.1| peptidase S1C, Do [Deferribacter desulfuricans SSM1]
 gi|290754153|dbj|BAI80530.1| peptidase S1C, Do [Deferribacter desulfuricans SSM1]
          Length = 453

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 203/365 (55%), Gaps = 19/365 (5%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRK 168
            GSGF I   GYI+T+NH+V+      V L+D  E  AK+VG D L DLA+LK+   D +
Sbjct: 85  LGSGFVIDKSGYIVTNNHVVDGADEIIVKLADKKEFKAKVVGKDPLTDLALLKIDPKDEE 144

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQ 227
             P+   D++   VGE V  IGNPF L  TV+AGI+SA  R + + P   F Q DA IN 
Sbjct: 145 LKPLPLGDSDKTEVGEWVVAIGNPFGLEWTVTAGIISAKGRVLGEGPYDNFMQTDASINP 204

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP  N  G V+G+N  I+ SGQ   G+G  IP++++K+ +P L  +G+V  GW G+
Sbjct: 205 GNSGGPLVNMKGEVVGINTAIIPSGQ---GLGFAIPVNMLKELLPKL-KEGKVKRGWLGV 260

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q L  +LA   GL   +G+LI  V+K  PADKAG+K GD++  +D   +K  +D V  
Sbjct: 261 TVQPLDDKLAKSFGLDKNEGALIADVIKGDPADKAGLKAGDIVIAVDNEPVKDSRDLVMI 320

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKK 407
           I   +P ++V +++ ++G      V LG     +     E+ + +L   V+ D++    K
Sbjct: 321 IGKHNPGDKVTLAIIRDGKVLKKTVKLGERKDGQVAQGGELREGKL---VVDDLSQSELK 377

Query: 408 ------LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
                  V++V ++P+     EA G++KG  IV +N H++    +      K   KK D 
Sbjct: 378 DYGIDGGVKVVNVDPS-SNAYEA-GLRKGDVIVWINRHKIKNSSEFYEYYDKI--KKDDI 433

Query: 462 VLLQI 466
           V L++
Sbjct: 434 VALKV 438


>gi|254448854|ref|ZP_05062310.1| peptidase S1C, Do [gamma proteobacterium HTCC5015]
 gi|198261544|gb|EDY85833.1| peptidase S1C, Do [gamma proteobacterium HTCC5015]
          Length = 478

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 206/389 (52%), Gaps = 22/389 (5%)

Query: 81  PLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
           P    FR  F     G    PI  D    L  GSGF I+DDGYI+T+NH++E      V 
Sbjct: 70  PWGELFRHYFDAPQGGGRGAPIPRDQHHSL--GSGFIISDDGYIITNNHVIEGADEVVVK 127

Query: 139 LSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGT 198
           L+D +E  A+++G+DA  D+A+LKV++D+    VE  D+ ++ VGE V  IG+PF    +
Sbjct: 128 LNDRSEYIAEVIGSDADTDIALLKVEADKSLPTVELGDSQSVNVGEWVLAIGSPFGFDAS 187

Query: 199 VSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           V+AGIVSA  R +P+     F Q D  IN GNSGGP FN  G V+GVN+ I +    +MG
Sbjct: 188 VTAGIVSAKARALPNENYVPFLQTDVAINPGNSGGPLFNLDGEVVGVNSQIYSRTGGYMG 247

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +   +P+ +    +  +   G V  GW G+  Q +T ELA   GL   +G+L+ +V+ +S
Sbjct: 248 LSFAVPIDVAMDVVEQIKESGSVSRGWLGVAIQEVTLELAESFGLDKPRGALVASVMPDS 307

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           PA+KAG++ GD+I  +D + ++        +   +  + V + + ++G K ++AV LG  
Sbjct: 308 PAEKAGIETGDIILSVDDKDVRRSSALPPIVGRHTAGDSVDVEVLRQGKKRTIAVELGEL 367

Query: 378 PTAKNDM-----HLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEA-------- 424
            + K+       H E      LGM L  +++  ++ +++    P+   EV+         
Sbjct: 368 ASGKSGQRSDRSHSEPTSDNRLGMALGAVDERKRRALKL----PDGGVEVKQLVAGAAAN 423

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
            G++ G  I  +N   ++  +   RL+ +
Sbjct: 424 AGLRVGDVITHINNQAINSAQQANRLVAE 452


>gi|170739393|ref|YP_001768048.1| protease Do [Methylobacterium sp. 4-46]
 gi|168193667|gb|ACA15614.1| protease Do [Methylobacterium sp. 4-46]
          Length = 501

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 149/435 (34%), Positives = 219/435 (50%), Gaps = 34/435 (7%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           LP   P ++ F   F++   G++P        L  GSGF I   G ++T+NH++ D    
Sbjct: 79  LPPGTPFEDLFEDFFNRRGGGDQPRQPRKSNSL--GSGFIIDASGIVVTNNHVIGDANDI 136

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKV--QSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
            VIL D  +L A++VG D+  D+AVL+V  ++DR    V   D+  +R G+ V  IGNPF
Sbjct: 137 QVILHDGRKLKAEIVGKDSKTDIAVLRVKPEADRPLKAVPLGDSEKMRPGDWVIAIGNPF 196

Query: 194 RLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
            L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  I++  
Sbjct: 197 GLGGSVSAGIVSARGRNIDSGPYDNYIQTDAAINKGNSGGPLFNMSGEVIGINTAILSPT 256

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTKGSLIT 311
              +G+G  +P +     I  L   G    GW G+  QN+    A  LGL+ G +G+LI 
Sbjct: 257 GGSVGIGFAVPTATAAPVIEQLRQYGETRRGWLGVRIQNVDDTTAEALGLKGGARGALIA 316

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            + ++ PA  AG +VGDVI   +G  +KS  D    +A+    + V +   ++G++ +  
Sbjct: 317 GIDEKGPAKTAGFEVGDVIVKFNGVEVKSSSDLPRIVATTPVGKTVDVLTIRKGAEQTRP 376

Query: 372 VVLGS-------SPTAKNDMHLEVG-DKELLGMVLQ----------DINDGNKKLVRIVA 413
           V LG         P A N    E    ++ LG+ L           +I DG K +V +  
Sbjct: 377 VTLGRLEDNDKPQPAALNRPQPEADVTRQALGLNLTGLSEEARRRFNIKDGLKGVV-VTR 435

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           ++PN       K IQ G  IV V    V+   DV R + + K++ R S LL +       
Sbjct: 436 VDPN--SNAADKRIQAGDLIVEVGQEPVNSPSDVTRRLDQIKKEGRKSALLLV------- 486

Query: 474 SGNDNMSRFVSLKID 488
           S      RFV+L ++
Sbjct: 487 SNAQGEVRFVALSLE 501


>gi|319777824|ref|YP_004134254.1| protease do [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317171543|gb|ADV15080.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 463

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 136/396 (34%), Positives = 204/396 (51%), Gaps = 26/396 (6%)

Query: 88  KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
            DF   F G   I     E L  GSGF I+ +GYI+T+NH+V D     V+ SD    PA
Sbjct: 63  NDFLNPFDGGGRIQPQVREAL--GSGFVISPEGYIVTNNHVVADATEIHVVFSDKETAPA 120

Query: 148 KLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSAL 207
           ++VG D   D+AVLKV          + D++ ++ G     IG+PF L GTV+ G++SA 
Sbjct: 121 RVVGRDPATDIAVLKVDPRPNMTATAWGDSDAMQPGAWTIAIGSPFGLGGTVTVGVLSAR 180

Query: 208 DRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
            RDI   P   F Q DA IN+GNSGGP FNA G VIGVN  IV+     +G+G  +P   
Sbjct: 181 SRDIQAGPYDDFLQTDASINRGNSGGPLFNARGEVIGVNTAIVSPSGGSIGIGFAVPSRT 240

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
            +  +  LIS GR++ G+ G+  Q +T  +A  LG+ G KG+L+ +V   SPA KAG++ 
Sbjct: 241 ARTIVDQLISTGRIERGFIGVRLQEITPSIAEALGMPGAKGALVASVEAGSPAQKAGIQA 300

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL 386
           GDVI   + + I+   D     AS+ P  +V ++  + G+   +++ +      + D   
Sbjct: 301 GDVITRFNDKDIQGVHDLTLAAASQKPGSKVTVTTNRGGTNQELSLTVDR----RRDQEE 356

Query: 387 EVG-------DKELLGMVLQDINDGNKKLVRIVA---------LNPNREREVEAKGIQKG 430
           + G       + + LGM L  I D  ++ + + A         + PN        GI+ G
Sbjct: 357 QTGAIPSLGTEDQRLGMSLSAIPDEARQQLGLQADTTGVFVQDVAPN--SLAAESGIRPG 414

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
             IVS N   ++   DV     K++++K+  VL +I
Sbjct: 415 DVIVSANNRNMTQPSDVREEWAKSRQQKK-PVLFRI 449


>gi|307821954|ref|ZP_07652186.1| protease Do [Methylobacter tundripaludum SV96]
 gi|307736520|gb|EFO07365.1| protease Do [Methylobacter tundripaludum SV96]
          Length = 467

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 136/427 (31%), Positives = 233/427 (54%), Gaps = 29/427 (6%)

Query: 75  NLPEDHP--LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
            LPE  P  ++ +F++  ++   G  P   DT      GSGF I+ DGY+LT++H+V+D 
Sbjct: 58  QLPEGMPPEMEEFFKRFLNEQGGGYVP--RDTTS---LGSGFVISPDGYVLTNSHVVKDA 112

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGN 191
               V LSD  EL AK++GTDA  D+A+LKV  D K +P V   + N ++VGE V  IG+
Sbjct: 113 DEIVVKLSDHRELLAKVIGTDARTDVALLKV--DAKDLPAVTIGNPNKLQVGEWVLAIGS 170

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGI+SA  R +P      F Q D  IN GNSGGP FN  G V+G+N+ I +
Sbjct: 171 PFGFEQSVTAGIISAKGRSLPGGNYVPFIQTDVAINPGNSGGPLFNMEGKVVGINSQIYS 230

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ ++   +  + + G+  HGW G+  Q++T+ELA   G++  +G+L+
Sbjct: 231 RTGGFMGLSFAIPMDVVMNVVDQIKATGKAAHGWLGVQIQDVTRELAESFGMKKPQGALV 290

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           + V+ +SPA+KAG+++GD+I   +G+ I++  D    +      ++  + + ++G   S+
Sbjct: 291 SKVLPDSPAEKAGLQIGDIITEFNGQQIETSGDLPPMVGITPINDKATLKIIRQGETKSL 350

Query: 371 AVVLGSSPTAKNDM-HLEVGDK---ELLGMVLQDINDGNKKLVRI----VALNPNREREV 422
              +G  P   + +   +V  K     LG+ + D+ D  ++ ++I    V +    +   
Sbjct: 351 DFKVGLLPDEADKLAEAKVAPKLPHNRLGVNVIDLTDTQRETLQIAKNGVLVQDVAKGTA 410

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
           +  GIQ+G  I+ +  + V    D E+++ K    K  ++L+Q +  P           F
Sbjct: 411 KDAGIQRGDVILRIQNNVVRDAADFEKIVTKLPAGKSVAILIQRQGSP----------VF 460

Query: 483 VSLKIDK 489
           +++K++K
Sbjct: 461 LAIKVEK 467


>gi|220920738|ref|YP_002496039.1| protease Do [Methylobacterium nodulans ORS 2060]
 gi|219945344|gb|ACL55736.1| protease Do [Methylobacterium nodulans ORS 2060]
          Length = 500

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 152/435 (34%), Positives = 220/435 (50%), Gaps = 35/435 (8%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           LP   P ++ F +DF     G++P        L  GSGF I   G ++T+NH++ D    
Sbjct: 79  LPPGTPFEDLF-EDFFNRRQGDQPRAPRRSNSL--GSGFIIDASGIVVTNNHVIGDANDI 135

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQ--SDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
            VIL D  +L A++VG D+  D+AVL+V+  +DR    V   D++ +R G+ V  IGNPF
Sbjct: 136 QVILHDGRKLKAEIVGKDSKTDIAVLRVKPDTDRPLKAVPLGDSDKMRPGDWVIAIGNPF 195

Query: 194 RLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
            L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  I++  
Sbjct: 196 GLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINTAILSPT 255

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTKGSLIT 311
              +G+G  +P +     I  L   G    GW G+  QN+    A  LGL+ G +G+LI 
Sbjct: 256 GGSVGIGFAVPTATAAPVIEQLRQYGETRRGWLGVRIQNVDDTTAEALGLKGGARGALIA 315

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V ++ PA  AG +VGDVI   +G  +KS  D    +A+    + V +   ++G + +  
Sbjct: 316 GVDEKGPAKAAGFEVGDVIVKFNGIDVKSSSDLPRIVAATPVGKTVDVITVRKGQEQNRP 375

Query: 372 VVLG-------SSPTAKNDMHLEVG-DKELLGMVLQ----------DINDGNKKLVRIVA 413
           V LG       + P A N    E    ++ LG+ L           +I DG K +V +  
Sbjct: 376 VTLGRLEDNDKAQPAALNRPQPEADVTRQALGLNLSGLSDEVRRRFNIKDGVKGVV-VTR 434

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           ++PN       K IQ G  IV V    V+   DV R I + K++ R S LL +       
Sbjct: 435 VDPN--STAADKRIQPGDIIVEVGQEPVNSPTDVTRRIDQIKKEGRKSALLLV------- 485

Query: 474 SGNDNMSRFVSLKID 488
           S      RFV+L ++
Sbjct: 486 SNAQGEVRFVALSLE 500


>gi|152988178|ref|YP_001350095.1| serine protease MucD precursor [Pseudomonas aeruginosa PA7]
 gi|119632849|gb|ABL84422.1| MucD [Pseudomonas aeruginosa]
 gi|150963336|gb|ABR85361.1| serine protease MucD precursor [Pseudomonas aeruginosa PA7]
          Length = 474

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 128/370 (34%), Positives = 205/370 (55%), Gaps = 15/370 (4%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    ++K+    M  A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNIST--RQKLPDRAM--ARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVE 130
             ++P+   L   FR DF +    + P      +R     GSGF I++DGYILT+NH+V 
Sbjct: 59  QLSIPDLEGLPPMFR-DFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVA 117

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTI 189
           D     V LSD +E  AKL+G D   D+AVLK+++  K +P ++  D+N ++VGE V  I
Sbjct: 118 DADEILVRLSDRSEHKAKLIGADPRSDVAVLKIEA--KNLPTLKLGDSNKLKVGEWVLAI 175

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G+PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I
Sbjct: 176 GSPFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQI 235

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+
Sbjct: 236 FTRSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGA 295

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + 
Sbjct: 296 LVAQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLEVIRNGQRK 355

Query: 369 SVAVVLGSSP 378
           ++++ +GS P
Sbjct: 356 TLSMAVGSLP 365


>gi|116048682|ref|YP_792518.1| serine protease MucD precursor [Pseudomonas aeruginosa UCBPP-PA14]
 gi|12963467|gb|AAK11276.1|AF343973_1 MucD [Pseudomonas aeruginosa]
 gi|115583903|gb|ABJ09918.1| serine protease MucD precursor [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 474

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 129/370 (34%), Positives = 205/370 (55%), Gaps = 15/370 (4%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    ++K+    M  A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNIST--RQKLPDRAM--ARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVE 130
             ++P+   L   FR DF +    + P      +R     GSGF I++DGYILT+NH+V 
Sbjct: 59  QLSIPDLEGLPPMFR-DFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVA 117

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTI 189
           D     V LSD +E  AKLVG D   D+AVLK+++  K +P ++  D+N ++VGE V  I
Sbjct: 118 DADEILVRLSDRSEHKAKLVGADPRSDVAVLKIEA--KNLPTLKLGDSNKLKVGEWVLAI 175

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G+PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I
Sbjct: 176 GSPFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLEGEVVGINSQI 235

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+
Sbjct: 236 FTRSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGA 295

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + 
Sbjct: 296 LVAQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRK 355

Query: 369 SVAVVLGSSP 378
           S+++ +G+ P
Sbjct: 356 SLSMAVGNLP 365


>gi|78224627|ref|YP_386374.1| peptidase S1C, Do [Geobacter metallireducens GS-15]
 gi|78195882|gb|ABB33649.1| Peptidase S1C, Do [Geobacter metallireducens GS-15]
          Length = 472

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 147/452 (32%), Positives = 242/452 (53%), Gaps = 42/452 (9%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYG--FGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
           ++ +V+PS+V++    +KKV  EQ F  +   FG+L  D   +  +R+D           
Sbjct: 55  LVKKVTPSVVNISTISRKKV--EQPFFEFSPLFGDLFGDG--RPRYRRDKS--------- 101

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF I   GYI+T++H+V D  +  V LS++     ++VG+D   D+AV
Sbjct: 102 ---------LGSGFIINKSGYIVTNDHVVRDAETIKVRLSNENVYDGRVVGSDPKTDIAV 152

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTF 218
           +K+ +          D++ ++VG+    IGNPF L  TV+ G+VSA  R     +    F
Sbjct: 153 IKIDAKEDLPVAVLADSDKLQVGQWAIAIGNPFGLDRTVTVGVVSATGRSNMGIETYEDF 212

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            Q DA IN GNSGGP  N  G VIG+N  IV +GQ   G+G  IP+++ K+ +  L++KG
Sbjct: 213 IQTDASINPGNSGGPLLNVHGEVIGINTAIVAAGQ---GIGFAIPVNMAKQIVTQLVTKG 269

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
            V  GW G+  Q +T E+A   GL+  +G L+  VV+ SPA K G+K GD+I    G  I
Sbjct: 270 SVSRGWLGVSIQPVTDEIAREFGLKKARGVLVADVVEGSPAAKGGIKQGDIILDFAGTEI 329

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-ELLGMV 397
           K  Q     +A+ +P + V++++ + G +  +++   S+ +A        G++ +LLG++
Sbjct: 330 KDAQHLQRVVAATAPGKTVQVTVFRGGREVKLSLTSASADSAGARQARPQGEEPDLLGLM 389

Query: 398 LQDI-NDGNKKLVRIVALNPNREREVEAK-GIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
           +++I +D  ++ V  V +    E  + A+ GIQ+G  IVSVN   V+   + ER + +A 
Sbjct: 390 VEEIPSDLRRRGVSGVVVAEVDEEGIAAEAGIQRGDIIVSVNRKGVATRAEYERAMAEA- 448

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             +R + +L ++          N S F SL++
Sbjct: 449 -GRRGTAILLVR--------RGNASIFFSLRL 471


>gi|299131888|ref|ZP_07025083.1| protease Do [Afipia sp. 1NLS2]
 gi|298592025|gb|EFI52225.1| protease Do [Afipia sp. 1NLS2]
          Length = 502

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 155/510 (30%), Positives = 251/510 (49%), Gaps = 56/510 (10%)

Query: 17  LTCVIFSSTYLVLEAKLP-PSSVDLPPVIARVSPSIVSVMV------------EPKKKVS 63
           L  +  +  +L++ A  P P+    P  IA V+  ++  +V            E  ++ +
Sbjct: 11  LLPLAVAGGFLMMAASAPQPAFARGPDSIADVAEKVIDAVVNISTSQTVNGRDEKGEEAT 70

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS---GEEPILSDTVERLMFGSGFFITDDG 120
            ++         LP D P   +F  DF K      G+  + S        GSGF I   G
Sbjct: 71  PQKEGRNKANPKLPPDSPFNEFF-DDFFKNRRADRGQHKVNS-------LGSGFIIDASG 122

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
            ++T+NH++ D    +VIL+D T++ A+LVG D   DLAVLK Q  ++K   V+F +++ 
Sbjct: 123 IVVTNNHVIADADEINVILNDGTKIKAELVGRDKKSDLAVLKFQPPEKKLTAVKFGNSDK 182

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
           +R+GE V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP FN  
Sbjct: 183 LRLGEWVIAIGNPFSLGGTVTAGIVSARNRDINSGPYDNYIQTDAAINRGNSGGPLFNLD 242

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIGVN  I++     +G+G  +P + +   +  L     V  GW G+  Q +T E+A 
Sbjct: 243 GEVIGVNTAIISPSGGSIGIGFAVPSNTVVGIVNQLRQYKEVRRGWLGVRIQQVTDEIAD 302

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LG++  +G+L+  V  + PA  AG++ GDVI   DG+ I+  +D    +A     + V 
Sbjct: 303 SLGVKPPRGALVAGVDDKGPAKPAGIEAGDVITSFDGKTIREMKDLPRAVADTPVGKTVD 362

Query: 359 ISLCKEGSKHSVAVVLG-------------SSPTAKNDMHLEVGDKELLGMVLQDINDGN 405
           + L ++G + +  V LG              +P  + D  +    ++ LG+ L  I+   
Sbjct: 363 VVLIRKGKEETHKVTLGRLDDGDKPVEASLKTPAPEPDKTVT---QKALGLDLAAISKDL 419

Query: 406 KKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           +   +I       V +  +R  +   + +  G  IV V    V+   DV++ I + K+  
Sbjct: 420 RTRYKIKDKVKGVVIVGVDRNSDAAERRLSAGDVIVEVAQEAVNSPADVKKRIDQLKKDG 479

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           + S+LL +       S  +   RFV++ ++
Sbjct: 480 KKSILLLV-------SNTEGELRFVAIAVN 502


>gi|294084285|ref|YP_003551043.1| peptidase S1C, Do [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663858|gb|ADE38959.1| Peptidase S1C, Do [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 511

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 142/418 (33%), Positives = 220/418 (52%), Gaps = 37/418 (8%)

Query: 15  VALTCVIFSSTYL---VLEAKLPPSSVDLPPVIARVSPSIVSV----MVEPKKKVSVEQM 67
           VA+  VIF S      +  A   P S      + R+SP++V++    +V   +++ + Q 
Sbjct: 37  VAVFVVIFMSISFAGGIAGASERPDS--FADQVERLSPAVVNISTTTIVNDGQRMEMPQ- 93

Query: 68  FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFITDDGYILTSN 126
                    P   P + +F K+F           ++   R    GSGF I D G ++T++
Sbjct: 94  --------FPPGSPFEEFF-KNFGD---------NNRQRRAQSLGSGFIIDDAGIVVTNH 135

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEA 185
           H++E+     VIL+D+T   AK++G D   D+AVLK+   D + + V+F D++ +RVG+ 
Sbjct: 136 HVIENAEEIRVILADETSFTAKVLGQDKKTDIAVLKIDPGDTELVSVKFGDSDALRVGDW 195

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  IGNPF L GTV+AGIVSA  RDI + P   F Q DA IN+GNSGGP FN  G VIG+
Sbjct: 196 VLAIGNPFGLGGTVTAGIVSARGRDIGNGPYDDFIQTDASINRGNSGGPLFNVEGEVIGI 255

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I +     +G+G  I  ++  +    L   G+   GW G+  Q +T ++A  LGL  
Sbjct: 256 NTAIFSQSGGSVGIGFAISSNLASRVADQLTEFGKTRRGWLGVFIQEVTTDIAESLGLDE 315

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
             G+L++ V + SPA  AG++ GDVI   DG+ I+  +D    +A      +VK+ L ++
Sbjct: 316 AVGALVSTVNENSPAFVAGVEPGDVILKFDGKAIERMRDLPRIVAETDIGSKVKVELFRQ 375

Query: 365 GSKHSVAVVLGSSPTAK------NDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNP 416
           G K +V V LG    A+      +D   E G+K+  G +   + D + KL   + ++P
Sbjct: 376 GKKMTVTVELGELEKAELVGLVDSDSSSEPGNKQSFGSLGMSVQDIDAKLAEELGIDP 433


>gi|17986896|ref|NP_539530.1| protease DO [Brucella melitensis bv. 1 str. 16M]
 gi|256045026|ref|ZP_05447927.1| protease DO [Brucella melitensis bv. 1 str. Rev.1]
 gi|265991453|ref|ZP_06104010.1| protease [Brucella melitensis bv. 1 str. Rev.1]
 gi|17982537|gb|AAL51794.1| protease do [Brucella melitensis bv. 1 str. 16M]
 gi|263002237|gb|EEZ14812.1| protease [Brucella melitensis bv. 1 str. Rev.1]
          Length = 524

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 164/532 (30%), Positives = 251/532 (47%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A R   ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAERPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 362 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 479

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 480 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|229588997|ref|YP_002871116.1| putative exported heat-shock adaptation serine protease
           [Pseudomonas fluorescens SBW25]
 gi|229360863|emb|CAY47722.1| putative exported heat-shock adaptation serine protease
           [Pseudomonas fluorescens SBW25]
          Length = 478

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 147/457 (32%), Positives = 232/457 (50%), Gaps = 34/457 (7%)

Query: 24  STYLVLEAKLPPSSVDLP---PVIARVSPSIVSVMVE---PKKKVSVEQMFNAYGFGNLP 77
           +T LVL   LP  +V+LP    ++ + SP++V++      P +KVS +QM         P
Sbjct: 14  ATVLVLGQALPAQAVELPDFTQLVEQASPAVVNISTTQKLPDRKVSNQQM---------P 64

Query: 78  EDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVEDGASF 135
           +   L    R+ F +    +        +R     GSGF I+ DGYILT+NH++ D    
Sbjct: 65  DLEGLPPMLREFFERGMPQQRAPRGGGGQREAQSLGSGFIISPDGYILTNNHVIADADEI 124

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFR 194
            V L+D +EL AKLVGTD   D+A+LK++   K +PV +   + +++ G+ V  IG+PF 
Sbjct: 125 LVRLADRSELKAKLVGTDPRSDVALLKIEG--KDLPVLKLGKSQDLKAGQWVVAIGSPFG 182

Query: 195 LRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
              TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN  G V+G+N+ I T   
Sbjct: 183 FDHTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAGEVVGINSQIYTRSG 242

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             MGV   IP+ +       L S G+V  GW G++ Q + ++LA   GL    G+L+  +
Sbjct: 243 GFMGVSFAIPIDVAMDVSNQLKSGGKVSRGWLGVVIQEVNKDLAESFGLDKPAGALVAQI 302

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             + PA K G++VGDVI  ++G+ I    D    + +     + K+ + +EG + +V + 
Sbjct: 303 QDDGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGALKAGSKAKLEVIREGKRQNVELT 362

Query: 374 LGSSPTAKNDMHLEVGDKE--------LLGMVLQDINDGNKK---LVRIVALNPNREREV 422
           +G+ P     +   +G+ +         LG+ + ++ D  KK   L   V +   ++   
Sbjct: 363 VGAIPEEGATLD-ALGNAKPGAERSSNRLGIAVAELTDEQKKSFDLKSGVVIKEVQDGPA 421

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
              G+Q G  I  +N   +   K +   I KA  K R
Sbjct: 422 SLIGLQPGDVITHLNNQAIDNTKQLTD-IAKALPKNR 457


>gi|294651027|ref|ZP_06728367.1| serine protease [Acinetobacter haemolyticus ATCC 19194]
 gi|292823128|gb|EFF81991.1| serine protease [Acinetobacter haemolyticus ATCC 19194]
          Length = 458

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 133/389 (34%), Positives = 212/389 (54%), Gaps = 29/389 (7%)

Query: 21  IFSSTYLVLEAKLPPSS-VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
           ++++ + V  A +  +S VD   ++ +VSP++VSV V   KK++ E++        +PE 
Sbjct: 10  MYAAVFTVAAAHVNAASPVDFSNLVEQVSPAVVSVNV--VKKMTQEELLQQ----QVPEI 63

Query: 80  HPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV 137
                       +FF  +   P      E+  FGS FFI+ DGY++T++H++ + +  S+
Sbjct: 64  ----------LRRFFGNQVIIPQRQGPQEKTAFGSAFFISKDGYLVTNHHVIANASRISI 113

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRG 197
            L+D  E  A LVG+D   D+AVLKV+    F  +   D N +RVGE V  IG+PF    
Sbjct: 114 TLNDRREFDATLVGSDERTDVAVLKVEGA-NFPELRVGDVNQLRVGEPVLAIGSPFGFDY 172

Query: 198 TVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHM 256
           + SAGIVSA  R++       F Q DA +N GNSGGP FN  G V+GVN+ I +    +M
Sbjct: 173 SASAGIVSAKSRNMSGETSVPFIQTDAALNPGNSGGPLFNQRGEVVGVNSRIFSGTGGYM 232

Query: 257 GVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKE 316
           G+   IP+ +    +  L + G+V   + GIM Q++ + LA    L   +GSLIT V  +
Sbjct: 233 GLSFSIPIDVAMDVVQQLKANGKVTRSYLGIMLQDIDRNLAEAYKLPKPEGSLITQVAPK 292

Query: 317 SPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           SPA+KAG+K GDVI  ++G  I    D ++ +   SP + +++ + ++    +V+  LG+
Sbjct: 293 SPAEKAGLKSGDVILKINGAPISRTSDLLYTLNRISPNQTIRLEILRDERVRTVSATLGT 352

Query: 377 SPTAKNDMHLEVGDKEL----LGMVLQDI 401
           +P    D     GDK      LGM ++++
Sbjct: 353 AP----DDTPATGDKNSPTSGLGMSIRNL 377


>gi|302342161|ref|YP_003806690.1| protease Do [Desulfarculus baarsii DSM 2075]
 gi|301638774|gb|ADK84096.1| protease Do [Desulfarculus baarsii DSM 2075]
          Length = 478

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 230/463 (49%), Gaps = 26/463 (5%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M KR +    ++C  AL  V+     L   A+  P       +  RVSP++V++ +   K
Sbjct: 1   MQKRAV--TLALCW-ALALVLIGPPRLAQAAEAGPQLPSFADLAERVSPAVVNIRI--VK 55

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE--RLMFGSGFFITD 118
            V+   +   +G     + HP        F +FF G         E      GSG  I  
Sbjct: 56  TVTGRPLMGLFGR-ERGQGHPSPEEL---FERFFRGPGGGGDQPREFKERSLGSGVIIDP 111

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           +GY+LT+NH+++D     V L  + ELPAK++G DA  DLA++K+  ++    +   D++
Sbjct: 112 EGYVLTNNHVIDDADEIVVRLKGEKELPAKIIGRDAKTDLALIKIDGEKNLPVLPLGDSD 171

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNA 237
            +RVG+ V  +GNPF L  TV+AGI+SA  RDI   P   F Q DA IN GNSGGP  + 
Sbjct: 172 KLRVGDWVLAVGNPFGLEHTVTAGIISAKGRDIGAGPYDDFLQTDASINPGNSGGPLIDL 231

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+GVN  I   GQ   G+G  IP+++ KK +  L  KGRV  G+ G+  Q +T ELA
Sbjct: 232 GGAVVGVNTAIAAQGQ---GIGFAIPVNLAKKIVGQLREKGRVVRGYLGVYFQPVTPELA 288

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
              GL+   G+L+  V+ + PA + G+K GDVI   +GR +    +    +A     ++V
Sbjct: 289 QQFGLKKPGGALVAEVIADGPAAEGGVKPGDVIVRFNGREVNDWHELPAMVADTPVGQEV 348

Query: 358 KISLCKEGSKHSVAVVLG---------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKL 408
           ++++ + G +  + + +G          +P  +++  L +  +EL   + Q +  G  K 
Sbjct: 349 EMTVMRGGDEKDLEITVGELKDGEAQAQAPQRQSEDKLGLSLQELTPDLAQQLGVGASK- 407

Query: 409 VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
             +V             G++KG  IV  +   V  +KD + L+
Sbjct: 408 -GLVVTGAREGGPAAEAGLRKGDVIVEADRKAVETLKDFQGLV 449



 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 45/81 (55%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  Q LT +LA  LG+  +KG ++T   +  PA +AG++ GDVI   D + +++ +DF
Sbjct: 386 LGLSLQELTPDLAQQLGVGASKGLVVTGAREGGPAAEAGLRKGDVIVEADRKAVETLKDF 445

Query: 345 VWQIASRSPKEQVKISLCKEG 365
              +    P + + +   +EG
Sbjct: 446 QGLVDGLKPGDGLLVLYQREG 466


>gi|77920673|ref|YP_358488.1| trypsin-like serine protease [Pelobacter carbinolicus DSM 2380]
 gi|77546756|gb|ABA90318.1| trypsin-like serine protease [Pelobacter carbinolicus DSM 2380]
          Length = 462

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 126/301 (41%), Positives = 174/301 (57%), Gaps = 12/301 (3%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I+ DGYILT++H+V+      V L+D  E    + G D   DLA++K+   ++ 
Sbjct: 85  LGSGFIISADGYILTNDHVVDGADVIKVRLADGREFSGTVQGLDPKLDLALVKIDVGQEQ 144

Query: 170 IPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQ 227
           +PV E  D+  +RVGE V  IGNPF L  TV+ GIVSA  R I   P   F Q DA IN 
Sbjct: 145 LPVAELGDSEKLRVGEWVMAIGNPFGLEQTVTVGIVSAKGRVIGAGPYDDFIQTDASINP 204

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP FN  G VIG+N  IV  GQ   G+G  IP++  K  IP L   G V  GW G+
Sbjct: 205 GNSGGPLFNESGQVIGINTAIVAGGQ---GIGFAIPVNAAKSIIPQLRDTGHVVRGWIGV 261

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +TQELA   GL+  +G+L+T V K+SPA+KAG+  GD++  L+G+ +K+  D    
Sbjct: 262 TVQEVTQELAESFGLKKARGALVTDVQKDSPAEKAGLLRGDILLALNGKELKTLGDLPKM 321

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLG------SSPTAKNDMHLEVGDKELLGMVLQDI 401
           +AS    ++ K++L +EG   +V + +G      SS  A     +E  +K  LG+ + DI
Sbjct: 322 VASLPVGKKAKLTLFREGRDKTVHITIGTQDKAQSSSKATKPAKVENAEKA-LGLSVLDI 380

Query: 402 N 402
            
Sbjct: 381 T 381


>gi|85704877|ref|ZP_01035978.1| Putative trypsin-like serine protease [Roseovarius sp. 217]
 gi|85670695|gb|EAQ25555.1| Putative trypsin-like serine protease [Roseovarius sp. 217]
          Length = 384

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/335 (34%), Positives = 192/335 (57%), Gaps = 14/335 (4%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++A VSP++V + V  K + +          G LPED P +   R+ F +      P  +
Sbjct: 57  LVAAVSPAVVYIEVTTKAQPTNMS-------GQLPEDLPEE--LRRQFERMM----PPTA 103

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
           +   R   GSGF I++DG I+T+NH+VE   + +V L+D  E  A ++G+D L D+AVL+
Sbjct: 104 EMPARQGLGSGFIISEDGKIVTNNHVVEGAETVTVKLADGREFDAAVIGSDPLTDVAVLQ 163

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQI 221
           + ++ K   V F D++ +R G+ V  +GNP+ L GTV++GIVSAL R+I   P   + Q 
Sbjct: 164 LDTEEKLPFVHFGDSDVMRAGDEVVAVGNPYGLGGTVTSGIVSALSRNINSGPYDDYIQT 223

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DA IN+GNSGGP FN  G VIG+N  I +     +G+G  +P  +++  +  L   G + 
Sbjct: 224 DAAINRGNSGGPLFNNDGEVIGMNTAIFSPDGGSVGIGFAVPSELVQHIVADLSDDGTIT 283

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            GW G+  + + +++A  LG    +G++I  V  +SPA KAG+K GD+I   +   I   
Sbjct: 284 RGWLGVQIKPMPEDIAQVLGYDTPRGAVIENVTPDSPAAKAGLKQGDIILSFNETAITEL 343

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           +D    +A+  P+  V +++  +G++ ++ V +G+
Sbjct: 344 RDLTRAVAATDPEATVPVTVLHKGAEKTITVTIGT 378


>gi|307945909|ref|ZP_07661245.1| protease Do [Roseibium sp. TrichSKD4]
 gi|307771782|gb|EFO31007.1| protease Do [Roseibium sp. TrichSKD4]
          Length = 496

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 168/512 (32%), Positives = 261/512 (50%), Gaps = 45/512 (8%)

Query: 1   MFKRQILSVKSICTVALT--CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSI-VSVMVE 57
            F+R+  SV S+   A+    V+ +       A+ P S  DL   +     +I  S  VE
Sbjct: 5   FFRRRFKSVVSLTAAAMIGGLVVLNPAQPSF-AQGPVSVADLAEELGDAVVNISTSQKVE 63

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT 117
            ++ V + Q         +PE  P + +F + F++   G+E      V+ L  GSGF I 
Sbjct: 64  GRRSVPMPQ---------VPEGSPFQEFFEEFFNRQNRGDEDRQPRRVQSL--GSGFVID 112

Query: 118 -DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
            ++G I+T+NH++E     +   +D T+L A+L+GTD   D+AVLKV+ +     V+F D
Sbjct: 113 GEEGIIITNNHVIEGADEITANFNDGTKLKAELIGTDEKTDIAVLKVEPETPLKAVDFGD 172

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCF 235
           ++ IRVG+ V  IGNPF L GTV+ GIVSA +RDI   P   F Q DA IN+GNSGGP F
Sbjct: 173 SDAIRVGDWVMAIGNPFGLGGTVTVGIVSAQNRDINSGPYDNFIQTDASINRGNSGGPLF 232

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           +  G+VIG+N  I++     +G+G  IP     + I  L   G    GW G+  Q +T E
Sbjct: 233 DMEGNVIGINTAIISPSGGSIGIGFAIPAKTATRVISQLREFGETRRGWLGVRIQEVTDE 292

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           +A  LG+    G+L+  V  + PA  A ++ GDVI   DG+ I S ++    +A  +  +
Sbjct: 293 IAESLGMDEAMGALVAGVSDDGPAAGADIQPGDVIVEFDGKPIDSMRELPRIVAETAIGK 352

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD------------KELLGMVLQDIND 403
           +V + + ++  + +V V LG    A  D   + G+             E+LGM+L +++D
Sbjct: 353 EVAVVVFRKAERVTVPVTLGRLEEA--DARTDEGEDDSVDPLPADEPSEILGMMLVELDD 410

Query: 404 GNKKLVRIVA-LNPNREREV------EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
             ++   I A ++    +EV      E K +Q G  I  V    V+  +DV+  + K KE
Sbjct: 411 ALREEFNIEADVDGVLVKEVIPGSSAEEKRVQAGDVIKEVAQEPVNTPEDVKAEVKKLKE 470

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             R S LL +      Q+G     RFV ++I+
Sbjct: 471 ADRRSALLLLSN----QTGE---LRFVPVRIE 495


>gi|331001462|ref|ZP_08325080.1| serine protease MucD [Parasutterella excrementihominis YIT 11859]
 gi|329568191|gb|EGG50008.1| serine protease MucD [Parasutterella excrementihominis YIT 11859]
          Length = 481

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 129/356 (36%), Positives = 196/356 (55%), Gaps = 6/356 (1%)

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
           T ER   GSGF I  +G ILT+NH+V+     +V L+D  E  AK++GTD   D+AV+K+
Sbjct: 102 TPERRGQGSGFIIDPNGIILTNNHVVDGADEVTVHLTDKREFKAKVIGTDPKTDIAVIKI 161

Query: 164 QSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQI 221
           +   K +PV +   +++++VGE V  IG PF L  TV+AGIVSA  R++PD     F Q 
Sbjct: 162 EG--KNLPVVKLGKSDDVKVGEWVAAIGAPFGLDNTVTAGIVSAKSRNLPDEQFVPFIQT 219

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           D  +N GNSGGP FN  G VIG+N+ I ++    MG+   IP+ +  +    L+  G+V 
Sbjct: 220 DVAVNPGNSGGPLFNMKGEVIGINSQIFSTSGGFMGLSFAIPIDLAVQIKDELMKNGKVS 279

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            G  GI+ Q LT ELA    L+  KG+LI  + K+ PADKAG++ GD++   +G+ I   
Sbjct: 280 RGRLGILMQQLTPELAKSFNLKDAKGALIAQIEKDGPADKAGLRDGDIVIEYNGKPIADI 339

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK--NDMHLEVGDKELLGMVLQ 399
           ++    +AS  P  +VK+   +EG   ++ +V+G  PT    N           LG  ++
Sbjct: 340 RELSQAVASTKPGAKVKVKAMREGKPVNLVIVVGEMPTDGKLNFKKPAASQNNALGANVR 399

Query: 400 DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
            +ND  KK V       +        G+++G  I+S    ++   KD+  ++ KAK
Sbjct: 400 PLNDKEKKRVSNGLFVESVYGAAAEAGMRRGDIIISAGGKKIRTEKDLNEVVSKAK 455


>gi|146342413|ref|YP_001207461.1| putative Serine protease do-like [Bradyrhizobium sp. ORS278]
 gi|146195219|emb|CAL79244.1| Putative Serine protease do-like precursor [Bradyrhizobium sp.
           ORS278]
          Length = 499

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 147/494 (29%), Positives = 247/494 (50%), Gaps = 33/494 (6%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ----MFNAYG 72
           LT  + ++ + ++ A   P+S   P  IA V+  ++  +V      +VE           
Sbjct: 15  LTAAVLAAGWALVPA---PASARGPEGIADVAEKVIDAVVNISTSQTVEAKGGGGEGRGA 71

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVE 130
              +P   P + +F   F           +D   R     GSGF + D G ++T+NH++ 
Sbjct: 72  NPQVPPGSPFEEFFDDFFKNRRGPGGRGGADNSPRRTNSLGSGFIVDDSGIVVTNNHVIA 131

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
           D    +VI++D T++ A+LVG D   DLAVLK +  R+   V+F D++ +R+G+ V  IG
Sbjct: 132 DADEINVIMNDGTKIKAELVGVDKKTDLAVLKFKPPRQLTVVKFGDSDKLRLGDWVVAIG 191

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           NPF L GTV+AGIVSA +RDI   P  ++ Q DA IN+GNSGGP FN  G VIGVN +I+
Sbjct: 192 NPFSLGGTVTAGIVSAKNRDISSGPYDSYIQTDAAINRGNSGGPLFNLDGEVIGVNTLII 251

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +     +G+G  +P   +   +  L   G +  GW G+  Q +T E+A  L ++  +G+L
Sbjct: 252 SPSGGSIGIGFAVPSKTVAGVVDQLRQFGELRRGWLGVRIQGVTDEIAESLNIKPARGAL 311

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +  V  + PA  AG++ GDV+   DG  IK  +D    +A  +  ++V + + ++G + +
Sbjct: 312 VAGVDDKGPAKPAGIEPGDVVVKFDGHDIKEPKDLSRIVADTAVGKEVDVVVIRKGQEQT 371

Query: 370 VAVVLG---------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI-------VA 413
           + V LG          +   K++   +   ++ LG+ L  ++   +   +I       V 
Sbjct: 372 LKVKLGRLEDNEKVQQAAIKKDEPAEKPVTQKALGLDLAALSKDLRTRYKIKDSVKGVVV 431

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
              ++  +   K +  G  IV V    V+   D+++ + + K+  + SVLL +       
Sbjct: 432 TGVDQASDAAEKRLSPGDVIVEVAQEAVTSGADIKKRVDQLKKDGKKSVLLLV------- 484

Query: 474 SGNDNMSRFVSLKI 487
           S  D   RFV+L +
Sbjct: 485 SNADGELRFVALSL 498


>gi|226952165|ref|ZP_03822629.1| serine protease [Acinetobacter sp. ATCC 27244]
 gi|226837091|gb|EEH69474.1| serine protease [Acinetobacter sp. ATCC 27244]
          Length = 458

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 131/389 (33%), Positives = 213/389 (54%), Gaps = 29/389 (7%)

Query: 21  IFSSTYLVLEAKLPPSS-VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
           ++++ + +  A++  ++ VD   ++ +VSP++VSV V   KK++ E++        +PE 
Sbjct: 10  MYAAVFTIAAAQVNAATPVDFSNLVEQVSPAVVSVNV--VKKMTQEELLQQ----QVPEI 63

Query: 80  HPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV 137
                       +FF  +   P      E+  FGS FFI+ DGY++T++H++ + +  S+
Sbjct: 64  ----------LRRFFGNQVIIPQRQGPQEKTAFGSAFFISKDGYLVTNHHVIANASRISI 113

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRG 197
            L+D  E  A LVG+D   D+AVLKV+    F  +   D N +RVGE V  IG+PF    
Sbjct: 114 TLNDRREFDATLVGSDERTDVAVLKVEGA-NFPELRVGDVNQLRVGEPVLAIGSPFGFDY 172

Query: 198 TVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHM 256
           + SAGIVSA  R++       F Q DA +N GNSGGP FN  G V+GVN+ I +    +M
Sbjct: 173 SASAGIVSAKSRNMSGETSVPFIQTDAALNPGNSGGPLFNQRGEVVGVNSRIFSGTGGYM 232

Query: 257 GVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKE 316
           G+   IP+ +    +  L + G+V   + GIM Q++ + LA    L   +GSLIT V  +
Sbjct: 233 GLSFSIPIDVAMDVVQQLKANGKVTRSYLGIMLQDIDRNLAEAYKLPKPEGSLITQVAPK 292

Query: 317 SPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           SPA+KAG+K GDVI  ++G  I    D ++ +   SP + +++ + ++    +V+  LG+
Sbjct: 293 SPAEKAGLKSGDVILKINGAPISRTSDLLYTLNRISPNQTIRLEILRDERVRTVSATLGT 352

Query: 377 SPTAKNDMHLEVGDKEL----LGMVLQDI 401
           +P    D     GDK      LGM ++++
Sbjct: 353 AP----DDTPATGDKNSPTSGLGMSIRNL 377


>gi|70728830|ref|YP_258579.1| protease Do [Pseudomonas fluorescens Pf-5]
 gi|68343129|gb|AAY90735.1| S1C (protease Do) subfamily peptidase MucD [Pseudomonas fluorescens
           Pf-5]
          Length = 476

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 146/468 (31%), Positives = 236/468 (50%), Gaps = 29/468 (6%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKKKV 62
           I  +KS  T+  T ++         A+LP    D   ++ + SP++V++      P ++V
Sbjct: 3   IPRLKSYFTILATVLVLGQAVSAQAAELP----DFTQLVEQASPAVVNISTTQKLPDRRV 58

Query: 63  S-VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
           S   QM +  G   +     L+ +F +   +  S   P      E    GSGF I+ DGY
Sbjct: 59  SNSAQMPDLEGLPPM-----LREFFERGMPQPRS---PRGDRQREAQSLGSGFIISADGY 110

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNI 180
           ILT+NH++ D     V L+D +EL AKL+GTD   D+A+LK+  D K +PV +   + ++
Sbjct: 111 ILTNNHVIADADEILVRLADRSELKAKLIGTDPRSDVALLKI--DGKDLPVLKLGKSQDL 168

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
           + G+ V  IG+PF    TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN  G
Sbjct: 169 KAGQWVVAIGSPFGFDHTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAG 228

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+G+N+ I T     MGV   IP+ +       L + G+V  GW G++ Q + ++LA  
Sbjct: 229 EVVGINSQIYTRSGGFMGVSFAIPIDVAMDVSNQLKTGGKVSRGWLGVVIQEVNKDLAES 288

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL    G+L+  +  + PA K G++VGDVI  L+G+ I    D    + +     +  +
Sbjct: 289 FGLEKPAGALVAQIQDDGPAAKGGLQVGDVILSLNGQPIVMSADLPHLVGALKAGAKANL 348

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHL--EVG---DKELLGMVLQDINDGNKKLVRI--- 411
            + ++G + +V + +G+ P    D+ +  + G       LG+ + ++ND  KK   +   
Sbjct: 349 EVIRDGKRKNVELTVGAIPEEDKDLSMLPKSGVERSSNRLGVAVVELNDEQKKAFDLKGG 408

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
           V +   ++      G+Q G  I  +N   ++  K+    I KA  K R
Sbjct: 409 VVIKEVQDGPAALIGLQPGDVITHLNNQAITSAKEFTE-IAKALPKNR 455


>gi|148560219|ref|YP_001259289.1| putative serine protease Do [Brucella ovis ATCC 25840]
 gi|148371476|gb|ABQ61455.1| putative serine protease Do [Brucella ovis ATCC 25840]
          Length = 524

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 251/532 (47%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 362 IVVIRQGAEKTLKVKLGRLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 479

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V  ++DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 480 GQVTVKTLEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|119713598|gb|ABL97649.1| serine protease [uncultured marine bacterium EB0_39H12]
          Length = 462

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 148/461 (32%), Positives = 239/461 (51%), Gaps = 41/461 (8%)

Query: 19  CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
            +I  S Y   +++  P+  DL       SP +V++     K V+    +   GFG+   
Sbjct: 9   ALIVMSFYGYAQSRDLPNFSDLA---EEASPGVVNIT--SSKTVNNRNSY-GRGFGD--- 59

Query: 79  DHPLKNYFRKDFHKFFSGEEPILSDTVER----LMFGSGFFITDDGYILTSNHIVEDGAS 134
             P  + F   F +FF G++P  S   E     +  GSGFFI+DDG++LT+NH+VED   
Sbjct: 60  --PRYDEF---FERFF-GQQPRPSTPRENSRPVVSTGSGFFISDDGFLLTNNHVVEDADE 113

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPF 193
            +V L D  E  A+++GTD   D+A+LK+  D + +P ++   +  ++VGE V  IG+PF
Sbjct: 114 ITVSLGDRREFKAEVIGTDERSDVALLKI--DAENLPFLKIGKSKQLKVGEWVVAIGSPF 171

Query: 194 RLRGTVSAGIVSALDRDIPDRPGT----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           +LR +V++GIVSA  R IP+   +    F Q D  IN GNSGGP FN  G VIG+N+ I 
Sbjct: 172 QLRFSVTSGIVSAKGRSIPNGSDSTYVPFIQTDVAINPGNSGGPLFNLEGEVIGINSQIY 231

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           T    +MGV   IP+         L   G V  GW G+  Q +  +LA  L +   KG+L
Sbjct: 232 TRSGGYMGVSFAIPIDYAMDVADQLKENGYVARGWLGVSIQEINSQLAEALDMDVPKGAL 291

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           I+ +++ SPA+K+G++  DVI   DG  I    D    + S  P  +V   + ++G   +
Sbjct: 292 ISQIIEGSPAEKSGLEEEDVILFFDGEEIFYSSDLPLTVGSIRPGSEVNAMVLRDGKNKT 351

Query: 370 VAVVLGSSPT----AKNDMHLEVGDKELLGMVLQDINDGNKKL----VRIVALNPNRERE 421
           + V +G  P     A ND       K  LG+ +++ ND ++K     VR+ +++P  E  
Sbjct: 352 IQVTVGELPKDPSIAFNDTK-----KNALGITVENQNDEDQKPFVKGVRVTSVDP--EGI 404

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
               GI++G  I ++    ++ + +   ++ K   ++  ++
Sbjct: 405 AYTSGIRRGDVIYALARTRINNVSEFRDVLSKLDMERNTTI 445


>gi|83312591|ref|YP_422855.1| trypsin-like serine protease [Magnetospirillum magneticum AMB-1]
 gi|82947432|dbj|BAE52296.1| Trypsin-like serine protease [Magnetospirillum magneticum AMB-1]
          Length = 503

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 137/438 (31%), Positives = 220/438 (50%), Gaps = 36/438 (8%)

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
             P   PL+ +F++   +   G+ P  + + +    GSGF I   GYI+T+NH++ D   
Sbjct: 71  QFPPGSPLEEFFKEFMERQQGGKSPD-APSRKATSLGSGFIIDAAGYIVTNNHVIADADE 129

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK-FIPVEFEDANNIRVGEAVFTIGNPF 193
            SV L DDT   A LVG D   DLA+LK++  +K  +PV F ++++ RVG+ V  IGNPF
Sbjct: 130 ISVKLHDDTVFQATLVGRDPKVDLALLKIEPGKKPLVPVPFGNSDDARVGDWVLAIGNPF 189

Query: 194 RLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
              GTV+AGIVSA  RDI   P   F Q DA IN+GNSGGP FN  G VIG+N+ I++  
Sbjct: 190 GFGGTVTAGIVSARARDINAGPYDDFLQTDAAINRGNSGGPMFNMRGEVIGINSAIISPS 249

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              +G+G  +P S+    +  L   G+V  GW GI  Q+L  ++A  +GL   KG+L+  
Sbjct: 250 GGSIGIGFAVPASLAVPVLDDLRKFGKVRRGWLGIRIQSLDTDMAENIGLPDQKGALVAK 309

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           V    P  KAG+K GDV+   DG+ I   +     +AS    ++V++ + ++G + ++  
Sbjct: 310 VDPNGPGVKAGLKDGDVVLKFDGKDITEMRRLPRYVASTPIGKKVEVVIWRDGKRQTITA 369

Query: 373 VLGSSPTAKNDMHL---------EVGDKELL-----GMVLQDIN---------DGNKKLV 409
            +G  P    +  +         + G   +L     G+ +             D   K +
Sbjct: 370 SVGEMPEDPAEQQVKGKPETPKPQAGKDGILTIPGAGLTVSSPTPQLRERFGLDDEAKGI 429

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +  + P+       KG++ G  I+  +   V    D+ +LI + +     S+LL+++  
Sbjct: 430 VVTEVKPD--SPAAEKGMRPGDMIIEADHKPVRSPADLGKLIEEGRRAGAKSLLLRVE-- 485

Query: 470 PDMQSGNDNMSRFVSLKI 487
                 N    R+++L +
Sbjct: 486 ------NPQQLRYIALPL 497


>gi|162146706|ref|YP_001601165.1| serine protease do-like [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543304|ref|YP_002275533.1| protease Do [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785281|emb|CAP54827.1| putative serine protease do-like precursor [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530981|gb|ACI50918.1| protease Do [Gluconacetobacter diazotrophicus PAl 5]
          Length = 535

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 150/436 (34%), Positives = 219/436 (50%), Gaps = 43/436 (9%)

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVEDG 132
           N PE  P + +F  DF    +G E        R M   GSGF I   G ++T+NH+V   
Sbjct: 114 NFPEGSPFEKFFH-DFMNRQTGPE-----AAPRKMQALGSGFIIDPSGIVVTNNHVVRHA 167

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
              +V L D+T L A L+G D   DLAVLKV +      V F D+++ RVG+ V  IGNP
Sbjct: 168 DQITVTLQDNTVLKAHLLGHDDRTDLAVLKVDAPHPLPAVPFGDSDHARVGDWVLAIGNP 227

Query: 193 FRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L GTV+AGI+S+  R+I   P   F Q DAPIN+GNSGGP F+  G VIG+N  I + 
Sbjct: 228 FGLSGTVTAGIISSRGRNIEQGPYDDFIQTDAPINKGNSGGPLFDMQGQVIGINTAIYSP 287

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+G  IP +  +  I  L   G+V  GW G+  Q++TQ++A  LGL+  +G+LI 
Sbjct: 288 SGGSIGIGFSIPSAEARGIIDQLRRTGKVSRGWIGVRIQDVTQDIADGLGLKVARGALIA 347

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            +  + PA  A ++ GDVI  LDG+ I         +A  SP   V + + + G   +V 
Sbjct: 348 GIEPKGPAAAAKLQTGDVIQTLDGKEIDGRA-LPRLMADESPGRVVSLGVWRHGHVLTVP 406

Query: 372 VVLGSSPTAKNDMHLEV------GDKELLGM-----VLQDI-------NDGNKKLV--RI 411
           V +G+ P    +           G+ +L GM      + D+        +G K +V   +
Sbjct: 407 VTVGALPEEAAEAPAPKPAATAQGNVQLQGMGFTVGAIDDVARQKYSLAEGQKGVVVTAV 466

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
            A  P  +R     G++ G  I  V   EV+   D+ RL+  A+ + R SVL  ++    
Sbjct: 467 AADGPAADR-----GLRPGDVITEVQQSEVASPADLRRLVEAARAQHRRSVLFLVQ---- 517

Query: 472 MQSGNDNMSRFVSLKI 487
               N +  R+V L +
Sbjct: 518 ----NGDGLRWVPLPL 529


>gi|163740765|ref|ZP_02148158.1| periplasmic serine protease, DO/DeqQ family protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161385756|gb|EDQ10132.1| periplasmic serine protease, DO/DeqQ family protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 499

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/437 (31%), Positives = 233/437 (53%), Gaps = 35/437 (8%)

Query: 74  GNLPEDHPLKNYFRK-DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
           G +PE  P +++FR+        G+ P  S        GSGF I++DGYI+T+NH++E+ 
Sbjct: 77  GIVPEGSPFEDFFREFQDRNGGQGDRPRRSSA-----LGSGFVISEDGYIVTNNHVIEEA 131

Query: 133 ASFSVIL-----SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
               +            LPAK+VGTD   D+A+LKV++      V+F D++  RVG+ V 
Sbjct: 132 DEIEIEFFPGEGQPAQPLPAKVVGTDPNTDIALLKVEAPMPLTFVKFGDSDLARVGDWVV 191

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
            +GNP     ++SAGIVSA +R++      + Q DA IN+GNSGGP FN  G V+GVN  
Sbjct: 192 AMGNPLGQGFSLSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMDGQVVGVNTA 251

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  +GL   KG
Sbjct: 252 ILSPNGGSIGIGFSMASNVVSKVVNQLKEFGETRRGWLGVRIQDVTKDVAEAMGLDSAKG 311

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+T  V E PA  AG+  GDVI   DG  +K  +  V Q+ +    + V++ + +EG  
Sbjct: 312 ALVTD-VPEGPAKAAGLLAGDVILSFDGVDVKDTRALVRQVGNTEVGKAVRVRVFREGKT 370

Query: 368 HSVAVVLG--------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI-------V 412
            ++ V LG        S+P + +D   ++ +K+LLG+ +  +++  +  + +       V
Sbjct: 371 ETLRVTLGRREDAQRQSTPASGDDNAPDMTEKQLLGLTVSRLSEDQRSELNVPDGMDGLV 430

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
             + +   E   KG++ G  I      +++ I ++E  I +AKE  R S+LL ++     
Sbjct: 431 ITSVDETSEAWEKGMRAGDLITEAGQQKLTSISELEARIDEAKEAGRKSLLLLVR----- 485

Query: 473 QSGNDNMSRFVSLKIDK 489
           ++G     RFV+L + +
Sbjct: 486 RAGE---PRFVALNLSE 499


>gi|163737662|ref|ZP_02145079.1| Peptidase S1C, Do [Phaeobacter gallaeciensis BS107]
 gi|161389188|gb|EDQ13540.1| protease do precursor [Phaeobacter gallaeciensis BS107]
          Length = 499

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/437 (31%), Positives = 233/437 (53%), Gaps = 35/437 (8%)

Query: 74  GNLPEDHPLKNYFRK-DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
           G +PE  P +++FR+        G+ P  S        GSGF I++DGYI+T+NH++E+ 
Sbjct: 77  GIVPEGSPFEDFFREFQDRNGGQGDRPRRSSA-----LGSGFVISEDGYIVTNNHVIEEA 131

Query: 133 ASFSVIL-----SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
               +            LPAK+VGTD   D+A+LKV++      V+F D++  RVG+ V 
Sbjct: 132 DEIEIEFFPGEGQPAQPLPAKVVGTDPNTDIALLKVEAPMPLTFVKFGDSDLARVGDWVV 191

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
            +GNP     ++SAGIVSA +R++      + Q DA IN+GNSGGP FN  G V+GVN  
Sbjct: 192 AMGNPLGQGFSLSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMDGQVVGVNTA 251

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  +GL   KG
Sbjct: 252 ILSPNGGSIGIGFSMASNVVSKVVNQLKEFGETRRGWLGVRIQDVTKDVAEAMGLDSAKG 311

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+T  V E PA  AG+  GDVI   DG  +K  +  V Q+ +    + V++ + +EG  
Sbjct: 312 ALVTD-VPEGPAKAAGLLAGDVILSFDGVDVKDTRALVRQVGNTEVGKAVRVRVFREGKT 370

Query: 368 HSVAVVLG--------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI-------V 412
            ++ V LG        S+P + +D   ++ +K+LLG+ +  +++  +  + +       V
Sbjct: 371 ETLRVTLGRREDAQRQSTPVSGDDNAPDMTEKQLLGLTVSRLSEDQRSELNVPDGMDGLV 430

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
             + +   E   KG++ G  I      +++ I ++E  I +AKE  R S+LL ++     
Sbjct: 431 ITSVDETSEAWEKGMRAGDLITEAGQQKLTSISELEARIDEAKEAGRKSLLLLVR----- 485

Query: 473 QSGNDNMSRFVSLKIDK 489
           ++G     RFV+L + +
Sbjct: 486 RAGE---PRFVALNLSE 499


>gi|146306503|ref|YP_001186968.1| protease Do [Pseudomonas mendocina ymp]
 gi|145574704|gb|ABP84236.1| protease Do [Pseudomonas mendocina ymp]
          Length = 474

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 130/387 (33%), Positives = 208/387 (53%), Gaps = 29/387 (7%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKKKVSV 64
           ++KS+  + +  +++  + L  +A LP    D   ++   SP++V++      P++ V+ 
Sbjct: 3   NLKSVTPLLMAALLWGQSLLA-QASLP----DFTALVEEASPAVVNISTRQKMPERSVAA 57

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL-----SDTVERLMFGSGFFITDD 119
           +          LP+   L   FR+    FF    P +         E    GSGF I+ D
Sbjct: 58  QP--------GLPDLEGLPPMFRE----FFERSIPQMPRNPGGRQREAQSLGSGFIISAD 105

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDAN 178
           GY+LT+NH+V D     V LSD +EL AKL+G D   D+A+LKV+   K +P V    ++
Sbjct: 106 GYVLTNNHVVADADEIIVRLSDRSELEAKLIGADPRSDVALLKVEG--KGLPTVRLGKSD 163

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNA 237
            ++VGE V  IG+PF    +V+AGIVSA  R++P D    F Q D  IN GNSGGP FN 
Sbjct: 164 ELKVGEWVLAIGSPFGFDHSVTAGIVSAKGRNLPSDSYVPFIQTDVAINPGNSGGPLFNL 223

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+G+N+ I T     MG+   IP+ +  +    L + G+V  GW G++ Q + ++LA
Sbjct: 224 KGEVVGINSQIFTRSGGFMGLSFAIPMEVALQVSEQLKADGKVTRGWLGVVIQEVNKDLA 283

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
              GL    G+L+  V+++ PADK G++VGDVI  L+G+ I    D    +    P E+ 
Sbjct: 284 ESFGLDRPAGALVAQVLEDGPADKGGLQVGDVILSLNGKPIVMSADLPHLVGGLKPGEKA 343

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDM 384
           ++ + ++GS+  + V +G+ P    ++
Sbjct: 344 EMDVVRDGSRKKLKVTIGTLPEEGQEL 370


>gi|146329692|ref|YP_001209794.1| serine protease [Dichelobacter nodosus VCS1703A]
 gi|146233162|gb|ABQ14140.1| serine protease [Dichelobacter nodosus VCS1703A]
          Length = 467

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 147/462 (31%), Positives = 243/462 (52%), Gaps = 41/462 (8%)

Query: 10  KSICTVALTC-VIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           K++ T+     ++FSS   ++ A LPP+  +L   + + SP++VS+         V+ + 
Sbjct: 3   KTLVTLIFAINLLFSS---LIHADLPPNFTEL---VEKASPAVVSI--------EVQSLV 48

Query: 69  NAYGFGNLPEDHP--LKNYFRKD---FHKFFSGEEPILSDTVERLMFGSGFFITDDGYIL 123
               F  L    P   +++F +    F + F  E+P   +   R   GSGF I  +GY+L
Sbjct: 49  TQPKFSRLTPPFPDLFEHFFGEQGSPFSEPFPEEQP---EKELRKGNGSGFIIDAEGYVL 105

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+ H+++   S SV+L+D  E  A++VG D   D+A+LK+ + +K   V+  D++ ++VG
Sbjct: 106 TNAHVIDGADSVSVLLTDQREYSAEIVGVDKRTDIALLKIAA-QKLPTVQLGDSDAVKVG 164

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGH 240
           + V  IG+PF    T + GIVSAL R +P   GT+T   Q DA IN GNSGGP FN  G 
Sbjct: 165 DWVLAIGSPFGFDTTATKGIVSALGRSLPS--GTYTPFIQTDAAINPGNSGGPLFNGKGE 222

Query: 241 VIGVNAMIVT-SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
           VIG+ + I T SG F+ GVG  IP+++ K     L + G V+ GW G+  Q + Q+LA  
Sbjct: 223 VIGITSQIYTRSGAFN-GVGFAIPINLAKTIAEQLKTTGSVNRGWLGVSIQAVDQKLAES 281

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            G+   +G+LI  +VK++PA+KA +KVGD++   +G  I    D    +A     + V+I
Sbjct: 282 FGMEKPEGALIAQIVKDAPAEKAQLKVGDILLSFNGHTINKASDLPPLVAMAPLGKDVEI 341

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDG--------NKKLVRI 411
              ++G K +  V + +  TA         +    G+ L+ ++D         +K+ V I
Sbjct: 342 EYLRDGKKQTTTVKIENLETADTSSAATSREMRNWGIELKALDDDTRNALEYEDKEGVLI 401

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
             + PN        G++ G  +++V    ++  K+  +L+ K
Sbjct: 402 ARVEPN--SAAAKSGLRAGDILIAVGDSIINTPKEASKLLAK 441


>gi|329113251|ref|ZP_08242034.1| Putative serine protease do-like protein [Acetobacter pomorum
           DM001]
 gi|326697392|gb|EGE49050.1| Putative serine protease do-like protein [Acetobacter pomorum
           DM001]
          Length = 510

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 154/507 (30%), Positives = 249/507 (49%), Gaps = 57/507 (11%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVI-------------ARVSPSIVS 53
           +S +     +L+ ++ +       A+   +S   PPV+             A++ P++V+
Sbjct: 3   ISARFARVFSLSGLLLAGASFAYPAQADQASTTAPPVMVAQRVPESFADLAAKLLPAVVN 62

Query: 54  VMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE-EPILSDTVERLM--F 110
           V      +   +          +P + P  + F K FH F + + EP   D   R M   
Sbjct: 63  VSTTQTVRADSDDDDEDDQLPQMP-NFPQGSPFEKFFHDFMNRQTEP---DAPPRRMQAL 118

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I   GYI+T+NH++      +V L D+T L AK VG D   DLA+LKV+S +   
Sbjct: 119 GSGFIIDPTGYIVTNNHVIRKADRITVTLQDNTVLTAKAVGHDDRTDLALLKVESKKPLP 178

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            V+F ++++ RVG+ V  IGNPF L GTV+AGI+S+  R+I   P   F Q DAPIN+GN
Sbjct: 179 FVQFGNSDSHRVGDWVLAIGNPFGLSGTVTAGIISSRGRNIDQGPYDDFIQTDAPINKGN 238

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F+  G VIGVN  I +     +G+G  IP +  +  +  L   G+V  GW G+  
Sbjct: 239 SGGPLFDMNGQVIGVNTAIYSPSGGSVGIGFAIPSNEARNVVEQLRKTGKVSRGWLGVRI 298

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           QN+TQ++A  LGL   +G+L+  V K  PA KAG++ GDVI  L+ + I+     + +++
Sbjct: 299 QNVTQDIADGLGLTPARGALVAGVEKNGPAAKAGLQTGDVIQALNAQPIEGKA--LPRLS 356

Query: 350 SRSPKEQVK-ISLCKEGSKHSVAVVLGSSPTAKNDMH----------------------- 385
           ++ P   V  + + + G    + V + + P    D                         
Sbjct: 357 AQLPVGSVAHLGVWRHGKILDLPVTIAALPEPAADTPQKPAAPSKTKETVSFADFGFSVG 416

Query: 386 -LEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
            ++   ++  G+        N+K V + ++    +     +G++ G  I  V   EV+  
Sbjct: 417 VIDTAARQKYGL------SANQKGVLVTSV--QDDGLAADRGLKPGDVITEVQQAEVNTP 468

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPD 471
            D+++ I  AK+ K+ SVLL + +D D
Sbjct: 469 ADLKKRIEAAKKDKKRSVLLLV-HDSD 494


>gi|259416296|ref|ZP_05740216.1| protease Do [Silicibacter sp. TrichCH4B]
 gi|259347735|gb|EEW59512.1| protease Do [Silicibacter sp. TrichCH4B]
          Length = 498

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 148/480 (30%), Positives = 240/480 (50%), Gaps = 42/480 (8%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
           L A   P S  L P+  +VSP++V++         VE      G   +PE  P +++FR+
Sbjct: 41  LSAAARPES--LAPLAEKVSPAVVNITT----STVVEGRTGPQGI--VPEGSPFEDFFRE 92

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV-ILSDDTE--- 144
              +   G+ P  S        GSGF I++DGYI+T+NH+++      +     D +   
Sbjct: 93  FQDRNGGGDRPRRSSA-----LGSGFVISEDGYIVTNNHVIDGADEIEIEFFPGDGQPAD 147

Query: 145 -LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
            LPA +VGTD   D+A+LKV +      V+F +++  RVG+ V  +GNP     ++SAGI
Sbjct: 148 LLPATVVGTDPNTDIALLKVDAPMPLKFVKFGNSDTARVGDWVVAMGNPLGQGFSLSAGI 207

Query: 204 VSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           VSA +R +      + Q DA IN+GNSGGP FN  G V+GVN  I++     +G+G  + 
Sbjct: 208 VSARNRALSGSYDDYIQTDAAINRGNSGGPLFNMDGEVVGVNTAILSPNGGSIGIGFSMA 267

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
            +++ K +  L   G    GW G+  Q++T +LA  +GL   +G LIT  V E PA +AG
Sbjct: 268 SNVVTKVVGQLKEFGETRRGWLGVRIQDVTDDLAEAIGLANDEGVLITD-VPEGPAKEAG 326

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND 383
           +   DVI   DG  +K  +D V ++      + V++ + ++G   ++ V LG    A  D
Sbjct: 327 LLARDVITSFDGFEVKDTRDLVRRVGDTEVGKTVRVVVFRDGKTETLRVTLGRREDAVGD 386

Query: 384 MH--------LEVGDKELLGMVLQDINDGNKK-------LVRIVALNPNREREVEAKGIQ 428
                      + G+KELLG+ +  + D  ++          +V L+ +       KG++
Sbjct: 387 NAGAESGEAIPDEGEKELLGLTVGVVRDDMREDLNLDAGTTGLVILSVDETSGAWEKGLR 446

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            G  I     +++S I D+E  I  A+E  R S+ L ++   +         RFV+L ++
Sbjct: 447 AGDVITEAGQNKLSSIADLEAQIAAAEEGGRKSIFLMVRRGGE--------PRFVALNLE 498


>gi|104783266|ref|YP_609764.1| serine protease MucD [Pseudomonas entomophila L48]
 gi|95112253|emb|CAK16980.1| serine protease MucD [Pseudomonas entomophila L48]
          Length = 479

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 141/454 (31%), Positives = 228/454 (50%), Gaps = 29/454 (6%)

Query: 11  SICTVALTCVIFSSTYL---VLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKKKVSV 64
           SI  +     +F++  +   VL A+   S  D   ++ + SP++V++  +   P ++++ 
Sbjct: 2   SIPRLKTYLSMFAAVLMLGQVLSAQAEESLPDFTTLVEQASPAVVNISTKQKLPDRRIAA 61

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE--EPILSDTVERLMFGSGFFITDDGYI 122
            QM         P+   L   FR+ F +    +   P      E    GSGF I+DDGY+
Sbjct: 62  GQM---------PDLEGLPPMFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISDDGYV 112

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           LT+NH+V D     V LSD +EL AKLVGTD   D+A+LKV+  +    V+  D+  ++V
Sbjct: 113 LTNNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKVEG-KNLPTVKLGDSEKLKV 171

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHV 241
           GE V  IG+PF    +V+ GIVSA  R +P D    F Q D  IN GNSGGP FN  G V
Sbjct: 172 GEWVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGEV 231

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   G
Sbjct: 232 VGINSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFG 291

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L    G+L+  V++  PA K G++VGDVI  ++G+ I    D    + S    E+ K+ +
Sbjct: 292 LDKPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIIMSADLPHLVGSLKDGEKAKLEI 351

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVG-------DKELLGMVLQDINDGNKKLVRI--- 411
            + G + ++ + +G+ P    D+   +G           LG+ + D++   KK + +   
Sbjct: 352 IRNGKRQNLDITIGALPEDDADIGAGLGADGSAERSSNRLGVSVADLSAEQKKTLELKGG 411

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
           V +   ++      G++ G  I  +N   ++  K
Sbjct: 412 VVIKEVQDGPAALIGLRPGDVISHLNNQAIASAK 445


>gi|146276936|ref|YP_001167095.1| protease Do [Rhodobacter sphaeroides ATCC 17025]
 gi|145555177|gb|ABP69790.1| protease Do [Rhodobacter sphaeroides ATCC 17025]
          Length = 493

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 142/431 (32%), Positives = 223/431 (51%), Gaps = 37/431 (8%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           +PE  P +++FR DF    + E  P  S+       GSGF I++DG+I+T+NH++E    
Sbjct: 79  VPEGSPFEDFFR-DFMDPQNREGGPRRSEA-----LGSGFVISEDGFIVTNNHVIEGADD 132

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             +      +L AKLVGTD   D+A+LKV S++    V F +++  RVG+ V  +GNP  
Sbjct: 133 IQIEFFSGNKLEAKLVGTDPKTDIALLKVSSNQPLPFVSFGNSDLARVGDWVVAMGNPLG 192

Query: 195 LRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
              +VSAGI+SA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++    
Sbjct: 193 QGFSVSAGIISARNRALSGTYDDYIQTDAAINRGNSGGPLFNLDGQVIGVNTAILSPNGG 252

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+G  +  +++ K +  L   G    GW G+  Q++T ++A  +GL   KG+L+T  V
Sbjct: 253 SIGIGFSMASNVVVKVVQQLREFGETRRGWLGVRIQDVTPDVAEAMGLAEAKGALVTD-V 311

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            + PA +AGM+ GDVI   D   +   +D V ++A     E V++ + +EG   +++VVL
Sbjct: 312 PDGPAKEAGMQSGDVIVTFDKAPVADTRDLVRRVADAPIGEAVRVVVMREGKTRTLSVVL 371

Query: 375 GSSPTAKND--------MHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE------- 419
           G    A+ +           E     LLG+ +  +     +    + L P  E       
Sbjct: 372 GRREEAEGEGPAASVESAPTEPSTANLLGLTVAPL---TAEQAAELGLPPGTEGLAVTDV 428

Query: 420 ---REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
               E  +KG+++G  I      +V  IKD++  + +A+E  R S+LL I+   D     
Sbjct: 429 DTASEAYSKGLREGDVITEAGQQKVMTIKDLQDRVDEAREAGRKSLLLLIRRGGD----- 483

Query: 477 DNMSRFVSLKI 487
               RFV+L I
Sbjct: 484 ---PRFVALTI 491


>gi|303256411|ref|ZP_07342425.1| S1C (protease Do) subfamily peptidase MucD [Burkholderiales
           bacterium 1_1_47]
 gi|302859902|gb|EFL82979.1| S1C (protease Do) subfamily peptidase MucD [Burkholderiales
           bacterium 1_1_47]
          Length = 481

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 129/356 (36%), Positives = 196/356 (55%), Gaps = 6/356 (1%)

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
           T ER   GSGF I  +G ILT+NH+V+     +V L+D  E  AK++GTD   D+AV+K+
Sbjct: 102 TPERRGQGSGFIIDPNGIILTNNHVVDGADEVTVHLTDKREFKAKVIGTDPKTDIAVIKI 161

Query: 164 QSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQI 221
           +   K +PV +   +++++VGE V  IG PF L  TV+AGIVSA  R++PD     F Q 
Sbjct: 162 EG--KNLPVVKLGKSDDVKVGEWVAAIGAPFGLDNTVTAGIVSAKSRNLPDEQFVPFIQT 219

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           D  +N GNSGGP FN  G VIG+N+ I ++    MG+   IP+ +  +    L+  G+V 
Sbjct: 220 DVAVNPGNSGGPLFNMKGEVIGINSQIFSTSGGFMGLSFAIPIDLAVQIKDELMKNGKVS 279

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            G  GI+ Q LT ELA    L+  KG+LI  + K+ PADKAG++ GD++   +G+ I   
Sbjct: 280 RGRLGILMQQLTPELAKSFNLKDAKGALIAQIEKDGPADKAGLRDGDIVIEYNGKPIVDI 339

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK--NDMHLEVGDKELLGMVLQ 399
           ++    +AS  P  +VK+   +EG   ++ +V+G  PT    N           LG  ++
Sbjct: 340 RELSQAVASTKPGAKVKVKAMREGKPVNLVIVVGEMPTDGKLNFKKPAASQNNALGANVR 399

Query: 400 DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
            +ND  KK V       +        G+++G  I+S    ++   KD+  ++ KAK
Sbjct: 400 PLNDKEKKRVSNGLFVESVYGAAAEAGMRRGDIIISAGGKKIRTEKDLNEVVSKAK 455


>gi|253997004|ref|YP_003049068.1| protease Do [Methylotenera mobilis JLW8]
 gi|253983683|gb|ACT48541.1| protease Do [Methylotenera mobilis JLW8]
          Length = 469

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 141/449 (31%), Positives = 226/449 (50%), Gaps = 32/449 (7%)

Query: 17  LTCVIF--SSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           L  VIF   S   V    LP    D   +  +  P++V++ +    + S  Q+    G  
Sbjct: 5   LAAVIFVLCSAVNVHAKDLP----DFTELAEKQGPAVVNISITQNMRASPTQLPGMLG-- 58

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSD-TVERLMFGSGFFITDDGYILTSNHIVEDGA 133
               D  L+ +F++     F G+    +    +    GSGF I+ DGYILT+ H+V D  
Sbjct: 59  ----DEQLQEFFKRFGIPNFPGQNGGGAQPEYKSQSLGSGFVISSDGYILTNAHVVSDAD 114

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
              V L D  E  AK++G D   D+A++K+++      V   D N ++VGE V  IG+PF
Sbjct: 115 EVIVKLFDKREFKAKIIGADKRTDVALVKIEA-TGLPKVVIGDPNKLKVGEWVAAIGSPF 173

Query: 194 RLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
            L  T++AGIVSA  R +P      F Q D  IN GNSGGP FN  G V+G+N+ I +  
Sbjct: 174 GLENTMTAGIVSAKGRALPQENFVPFIQTDVAINPGNSGGPLFNLAGEVVGINSQIYSRS 233

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              MG+   IP+ +  +    L + G+V  GW G++ Q L++ELA   G++ T G+L+  
Sbjct: 234 GGSMGLSFSIPIDVALEVTNQLKASGKVTRGWLGVVIQELSKELAESFGMKNTNGALVAG 293

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           V K  PADK G++ GDVI   DG+ I S  D    + +  P + V + + ++GS  +++V
Sbjct: 294 VEKGGPADKGGVEAGDVIIKFDGKPINSSTDLPRAVGAARPGKAVPVEVLRKGSDKTLSV 353

Query: 373 VLGSSP-----TAKNDMHLEVGDKELLGMVLQDIN-------DGNKKLVRIVALNPNRER 420
            +G  P     +A+ +      D + +G++L+++        +G   L+ + AL      
Sbjct: 354 AIGEMPSDPSESAQANKPAVKQDADRVGLILKELTPQQKKKLNGKNGLLVMDALG----- 408

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
            V   GI++G  I+ +N  EV  ++   +
Sbjct: 409 AVAQAGIRRGDVILGLNNTEVQSLEQFNK 437


>gi|326539124|gb|ADZ87339.1| protease Do [Brucella melitensis M5-90]
          Length = 538

 Score =  210 bits (535), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 250/532 (46%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 29  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 78

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 79  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 135

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 136 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 195

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 196 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 255

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 256 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPMTEDIAQ 315

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 316 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 375

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 376 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 435

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 436 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 493

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 494 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 538


>gi|254468861|ref|ZP_05082267.1| peptidase S1C, Do [beta proteobacterium KB13]
 gi|207087671|gb|EDZ64954.1| peptidase S1C, Do [beta proteobacterium KB13]
          Length = 468

 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 132/402 (32%), Positives = 220/402 (54%), Gaps = 19/402 (4%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFG--SGFFITDDGYILTSNHIVEDGA 133
            P D  L+ +F++       G  P  +   E+ + G  SGF I   G ++T+ H+V D  
Sbjct: 58  FPYDEQLQEFFKRFGIPGLPGMPPNGNAPREKQVMGTGSGFIINSKGIVITNAHVVNDAD 117

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNP 192
           +  V L+D  E+ A+++G D   D+AVLK+++D   +P V+  D   ++VGE V  IG+P
Sbjct: 118 TVIVKLNDQKEIQAEVLGIDKRTDVAVLKIKADN--LPQVKIGDPGKLKVGEWVAAIGSP 175

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L  T++ G+VSAL R++P      F Q D  IN GNSGGP FN  G V+G+N+ I + 
Sbjct: 176 FGLESTMTVGVVSALGRNLPQENYVPFIQTDVAINPGNSGGPLFNTSGEVVGINSQIYSR 235

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
              +MG+   IP+ +       L S G+V  GW GI  Q +++EL+    ++ T+G+L+ 
Sbjct: 236 TGGYMGLSFAIPIDVAINVAEQLESDGKVSRGWLGIAIQEISKELSESFNMKSTQGALVA 295

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V KESPADK G+K GDVI       IK   D    ++S  P  ++ +++ ++G +  + 
Sbjct: 296 GVEKESPADKGGLKPGDVILKFGENDIKISSDLPKFVSSTKPGSKIPLNILRQGKEKQLE 355

Query: 372 VVLGSSPTAKNDM-----HLEVGDKELLGMVLQDINDGNKKLVR----IVALNPNREREV 422
           + +G  PT   DM     + E   K  +G++++D+    KK ++    ++ L+   E  +
Sbjct: 356 ITIGEMPT--EDMVVARKNNEQTQKNRIGLIVKDLTPQQKKQIKENAGVLVLDV-AEAAL 412

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
            A GI+KG  I+ +N + VS ++   + + K K+ K  ++L+
Sbjct: 413 NA-GIRKGDVILGLNNNPVSSVQSFNQDLKKVKKGKTIALLI 453


>gi|91775212|ref|YP_544968.1| peptidase S1C, Do [Methylobacillus flagellatus KT]
 gi|91775356|ref|YP_545112.1| peptidase S1C, Do [Methylobacillus flagellatus KT]
 gi|91709199|gb|ABE49127.1| Peptidase S1C, Do [Methylobacillus flagellatus KT]
 gi|91709343|gb|ABE49271.1| Peptidase S1C, Do [Methylobacillus flagellatus KT]
          Length = 477

 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 151/505 (29%), Positives = 247/505 (48%), Gaps = 44/505 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MFK+ ++++ +IC      V  +    VL  +LP    D   +  +   ++V++ V    
Sbjct: 1   MFKK-LIAMSAICL----FVGMAGATPVLAKELP----DFTELAEKQGAAVVNISVTQ-- 49

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRK----DFHKFFSGEEPILSDTVERLMFGSGFFI 116
              V+       F   PED  L  +FR+     F     G+        +    GSGF I
Sbjct: 50  --VVQSGIGGSPFPGFPEDEALNEFFRRFGIPGFPGVPRGQGGPQQPEFKSQSLGSGFII 107

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFE 175
           + DGYILT+ H+V +     V L+D  E  AK+VG D   D+A+LK+  D   +P V   
Sbjct: 108 SSDGYILTNAHVVREADEVIVKLNDKREFQAKIVGVDRRTDVALLKI--DATGLPKVTIG 165

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPC 234
           +   ++VGE V  IG+PF L  T++AG+VSA  R +P      F Q D  IN GNSGGP 
Sbjct: 166 NPEQLKVGEWVVAIGSPFGLESTLTAGVVSAKGRALPQENFVPFIQTDVAINPGNSGGPL 225

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
           FN  G V+G+N+ I +    +MG+   IP+ +       L   GRV  GW GI  Q +T+
Sbjct: 226 FNLKGEVVGINSQIYSRTGGYMGLSFAIPIDVAMDVANQLKISGRVARGWLGIGIQEMTK 285

Query: 295 ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK 354
           ELA   G++ TKG+L+  V K SPA+K G++ GDV+   DG+ +    D    + S  P 
Sbjct: 286 ELAESFGMKNTKGALVAGVEKGSPAEKGGLEPGDVVIKFDGKDVNVSSDLPRIVGSTKPG 345

Query: 355 EQVKISLCKEGSKHSVAVVLGSS--------PTAKNDMHLEVGDKELLGMVLQDINDGNK 406
           ++V++ + + G+  ++ + LG          PTA+ D   E      LG+ L+++    +
Sbjct: 346 KKVQVEVLRRGASKTLNITLGEMPADKDEVVPTAQPDAKPE---SNRLGLTLRELTPQQR 402

Query: 407 KLV--RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
           + +  R   +  + +      GI++G  I+++N  EV  ++   + +      K  ++L+
Sbjct: 403 RSLNGRNALVVVDAQGAAAQAGIRRGDLILALNNTEVQSLEQFTKQVNAVPAGKTVALLV 462

Query: 465 QIKYDPDMQSGNDNMSRFVSLKIDK 489
           Q           +N + +V +K+ K
Sbjct: 463 Q----------RENNTLYVPVKVGK 477


>gi|15602599|ref|NP_245671.1| hypothetical protein PM0734 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721029|gb|AAK02818.1| HtrA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 459

 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 145/464 (31%), Positives = 241/464 (51%), Gaps = 41/464 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD------LPPVIARVSPSIVSV 54
           M KR+ L    + ++AL   I S T ++ +A LP + VD      L P++ +V P++VS+
Sbjct: 1   MRKRRFL----LTSIALGLSILS-TPMISQASLP-TQVDGQQVPSLAPMLEKVLPAVVSI 54

Query: 55  MVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGS 112
            VE K K        +  F  +PE+      FR     FF G + + +D   R     GS
Sbjct: 55  SVEGKAK-----NHGSTPFQGIPEE------FR-----FFFGPD-LFNDRAPRNFRGIGS 97

Query: 113 GFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           G  I  + GY+LT+NH+++     +V L D  EL AK++GTD L D+A+++++  +    
Sbjct: 98  GVIINAEKGYVLTNNHVIDSADKITVQLQDGRELSAKVIGTDELSDVALIQIEKPKNLTA 157

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQG 228
           +   D++ +RVG+    IGNPF L  TV++GIVSAL R      GT+    Q DA +N+G
Sbjct: 158 LTIADSDKLRVGDFTVAIGNPFGLGQTVTSGIVSALGRSTGSDNGTYENYIQTDAAVNRG 217

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP  N  G +IG+N  I++    + G+   IP ++    +  ++  G V  G  GI 
Sbjct: 218 NSGGPLINLQGELIGINTAIISPSGGNAGIAFAIPSNMANNLVQQILEFGEVRRGMLGIK 277

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
              L  +LA    +   +G+ ++ V+  S A+KAG+K GDVI  ++G+ I S  +   +I
Sbjct: 278 GGELNADLAKAFDIEAQQGAFVSEVLPNSAAEKAGLKAGDVIVAMNGQKISSFAEMRAKI 337

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM-HLEVGDKELLGMVLQDINDGNKK 407
           A+    +++ ++  ++G  H   V L S    + D  HL      L G  + + +D   K
Sbjct: 338 ATSGAGKEIALTYLRDGKTHQTKVTLQSDDQTQADASHLL---PALAGAEMSNHDDKGVK 394

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
            V I ++ P  +   E +G++KG  I+ VN  +V  +  + +++
Sbjct: 395 GVLITSVTP--KSLAEQRGLKKGDVIIGVNRQKVENLGQLRKIL 436


>gi|95928483|ref|ZP_01311230.1| Peptidase S1C, Do [Desulfuromonas acetoxidans DSM 684]
 gi|95135273|gb|EAT16925.1| Peptidase S1C, Do [Desulfuromonas acetoxidans DSM 684]
          Length = 459

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 193/365 (52%), Gaps = 15/365 (4%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I+ DGYILT++H+V+D    +V L+     PA + G D   DLA+LK+ SD   
Sbjct: 87  LGSGFIISSDGYILTNDHVVDDADEITVQLAGGKTYPATVKGIDQKLDLALLKIDSDETL 146

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
             V+  +++ + +GE V  IGNPF L  TV+ GIVSA  R I   P   F Q DA IN G
Sbjct: 147 PTVKLGNSDRLEIGEWVMAIGNPFGLEQTVTVGIVSAKGRVIGAGPYDNFIQTDASINPG 206

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G V+G+N  IV  GQ   G+G  IP++  K  +P L   G V  GW G+ 
Sbjct: 207 NSGGPLFNTRGEVVGINTAIVAGGQ---GIGFAIPINAAKNILPQLKETGHVTRGWLGVT 263

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q+++ ELA   GL   +G+LI++V   SPA+KAG++ GD+I  L+ + I S  D    +
Sbjct: 264 IQHVSDELADSFGLDTAEGALISSVAGNSPAEKAGLERGDIILRLNDKKIVSMTDLPRLV 323

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDI------- 401
           A     E   +++ ++G + +  V +G      N + +       LG+ + +I       
Sbjct: 324 AEIPVGETADVTVFRDGKEETFEVEVGKMSDDGNPVKV-TSRTNALGLTVMEITPELRRR 382

Query: 402 -NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
            N   K  V I A+ PN        G++ G  I+  N  E++  ++ +  + K+  K   
Sbjct: 383 LNIQAKHGVVITAVEPNSAS--AESGLRPGDVIIEFNNQEIATAQEFKTTLEKSDNKTIQ 440

Query: 461 SVLLQ 465
            +L+Q
Sbjct: 441 RLLIQ 445


>gi|220904478|ref|YP_002479790.1| protease Do [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868777|gb|ACL49112.1| protease Do [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 475

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 147/477 (30%), Positives = 242/477 (50%), Gaps = 33/477 (6%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C   L  V F       +A   P   D   + A+  P++V++  E        + F    
Sbjct: 6   CLSGLLAVTFVVAAQFAQAGNLP---DFSELAAKSGPAVVNINTEKMAASGGSEEFFGEM 62

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
           F N+P        F K F +F  G+         +   GSGF ++ DG+I+T+NH+V D 
Sbjct: 63  FRNMPPG------FEKFFDQF-GGKRDGKRPQSRQKSLGSGFLVSADGFIVTNNHVVADA 115

Query: 133 ASFSVILSDDT----ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
               V L  +        A L+G D   DLA+LKV++ +    + F +++ ++VGE +  
Sbjct: 116 DVIRVTLDQENGKSESFTATLIGADEETDLALLKVETKKNLPFLVFGNSDELKVGEWLLA 175

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L  TV+AGI+SA +R+I   P   F Q DA IN GNSGGP  N  G V+G+N  
Sbjct: 176 IGNPFGLDHTVTAGILSAKNRNIHAGPFDNFLQTDASINPGNSGGPLLNMQGQVVGINTA 235

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I+ SGQ   G+G  IP ++  K I  + S  +V  GW G+  Q++ +  A  LG++  KG
Sbjct: 236 IIASGQ---GIGFAIPSNMAAKIIDQIKSGKKVSRGWIGVTIQDVEENTAKALGMKDAKG 292

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+ +V++  PA K GMK GD+I  +DG+ I      +  IA ++P  +  I + ++G  
Sbjct: 293 ALVGSVMENEPAGKGGMKDGDIILAVDGKDIDDASALLRAIAEKTPGSKAVIKVWRDGKV 352

Query: 368 HSVAVVLGS-SPTAKNDMHLEVGDKE---LLGMVLQDINDGNKKLVR--------IVALN 415
             + V LG    T++     + G K+   LLG+ ++ +ND  ++ ++        IV + 
Sbjct: 353 LDLTVTLGERQSTSQASASGKGGPKQNEGLLGIAVRPLNDTERRDMKIDKNEGLLIVDVT 412

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
           P++    EA  ++ G  I+  N   V+  + + +++ + +  KR +++LQI    D+
Sbjct: 413 PSKP-AAEAD-LRPGDVILKANLKPVNTSEALSKIVNE-EGAKRGAIMLQISRRGDV 466


>gi|83954155|ref|ZP_00962875.1| periplasmic serine protease, DO/DeqQ family [Sulfitobacter sp.
           NAS-14.1]
 gi|83841192|gb|EAP80362.1| periplasmic serine protease, DO/DeqQ family [Sulfitobacter sp.
           NAS-14.1]
          Length = 494

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 144/466 (30%), Positives = 237/466 (50%), Gaps = 36/466 (7%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           L P+  ++SPS+V++        +VE      G   +PE  P +++F++   +   GE P
Sbjct: 45  LAPLAEKISPSVVNITT----STTVEGRTGPRGI--VPEGSPFEDFFKEFRDRNNGGEAP 98

Query: 100 ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
               +      GSGF I++DG+++T+NH++E     ++      EL A+++GTD   D+A
Sbjct: 99  APRKSS---ALGSGFVISEDGFVVTNNHVIEGADEITIEFFTGLELKAEVIGTDPNTDIA 155

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT 219
           +LKV++      V F D+N  RVG+ V  +GNP     +VSAGIVSA +R +      + 
Sbjct: 156 LLKVEAPSALPFVSFGDSNAARVGDWVLAMGNPLGQGFSVSAGIVSARNRALSGTYDDYI 215

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++ + +  L   G 
Sbjct: 216 QTDAAINRGNSGGPLFNMDGEVIGVNTAILSPNGGSIGIGFSMASNVVTRVVNQLKEFGE 275

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
              GW G+  Q++TQ++A  +GL    G+LIT  V + PA  AG+K GDVI    G  ++
Sbjct: 276 TRRGWLGVRIQDVTQDVADAMGLAKASGALITD-VPDGPAKDAGLKTGDVILSFAGVEVE 334

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG----------SSPTAKNDMHLEV- 388
             +  V Q+ + +    V++++ +EG   ++ V LG          S+   +++   E  
Sbjct: 335 DTRGLVRQVGNSTVGASVRVTVLREGKSQTLKVKLGRREDAEGAGASASAPEDEAEPEAP 394

Query: 389 GDKELLGMVLQDIND------GNKKLVRIVALNPNRE-REVEAKGIQKGMTIVSVNTHEV 441
             K +LG+ +  + D      G    V  +A+    E  E   KG++ G  I       +
Sbjct: 395 ASKSVLGLTITPLTDDLRTELGADDSVEGLAVTEVDEMSEAFEKGLRVGDIITEAGQQPI 454

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             I D+E  I +AK+  R S+LL ++   D         RFV+L +
Sbjct: 455 LSITDLEDRITEAKDGGRKSLLLLVRRAGD--------PRFVALGL 492


>gi|310815312|ref|YP_003963276.1| possible serine protease [Ketogulonicigenium vulgare Y25]
 gi|308754047|gb|ADO41976.1| possible serine protease [Ketogulonicigenium vulgare Y25]
          Length = 473

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 148/461 (32%), Positives = 229/461 (49%), Gaps = 45/461 (9%)

Query: 46  RVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV 105
           +VSP++V         ++   +  A G  N  E  P +++FR+   +  SGE+   + T 
Sbjct: 40  QVSPAVV--------NITTSMLVAAPGGNNPAEGTPFEDFFRQFGPR--SGEQ---APTQ 86

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ- 164
                GSGF I+ DGYI+T+NH++ D     +       LPA +VGTD   D+A+LKV+ 
Sbjct: 87  RANALGSGFVISADGYIVTNNHVIADADQIQIEFFSGDSLPATVVGTDPNTDIALLKVEA 146

Query: 165 SDRKFIPVEFEDANNI--RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQID 222
           SD  +  VEF D++    RVG+ V  +GNP     +VSAGI+SA +R +      + Q D
Sbjct: 147 SDLPY--VEFGDSSETAARVGDWVMAMGNPLGQGFSVSAGIISARNRALSGTYDDYIQTD 204

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
           A IN+GNSGGP FN  G VIGVN  I++     +G+G  +   ++   +  L   G    
Sbjct: 205 AAINRGNSGGPLFNMEGQVIGVNTAILSPNGGSIGIGFAMSSEVVSGVVGQLREFGETRR 264

Query: 283 GWFGIMTQNLTQEL--AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
           GW G   Q +TQ++  A+P GL   +G+LI+  V E PA +AG++ GDV+   DG  +  
Sbjct: 265 GWLGARVQAVTQDMVGALP-GLENARGALISD-VPEGPAREAGLQAGDVVLTFDGATVTD 322

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH-----LEVGDKELLG 395
            + FV  I +    + V + + ++G    +AV LG    A+  +       E    E LG
Sbjct: 323 SRGFVQMIGAAGADQTVTLGVLRDGETFDLAVTLGRREEAEGQLTPQGLPTEQSQYEGLG 382

Query: 396 MVL--------QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
           + L        Q  N G    + I  ++P    E  A+G+  G  +  V    V+    V
Sbjct: 383 LTLSQITPQIAQQFNLGTDTGLVITEIDP--ASEAAARGLAVGDVVSDVANTPVATPAQV 440

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           E ++  A+E  R SV+L ++   D         RFV+L ++
Sbjct: 441 EEIVTAARESGRTSVMLLVRRGGD--------PRFVALPLE 473


>gi|99081793|ref|YP_613947.1| peptidase S1C, Do [Ruegeria sp. TM1040]
 gi|99038073|gb|ABF64685.1| Peptidase S1C Do [Ruegeria sp. TM1040]
          Length = 499

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 149/480 (31%), Positives = 241/480 (50%), Gaps = 42/480 (8%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
           L A   P S  L P+  +VSP++V++         VE      G   +PE  P +++FR+
Sbjct: 41  LSAAARPES--LAPLAEKVSPAVVNITT----STVVEGRTGPQGI--VPEGSPFEDFFRE 92

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV-ILSDDTE--- 144
              +   G  P  S        GSGF I++DGYI+T+NH++E      +     + +   
Sbjct: 93  FQDRNGGGTRPRRSSA-----LGSGFVISEDGYIVTNNHVIEGADEIEIEFFPGEGQPAD 147

Query: 145 -LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
            LPA +VGTD   D+A+LKV +      V+F D++  RVG+ V  +GNP     ++SAGI
Sbjct: 148 LLPATVVGTDPNTDIALLKVDAPMPLSFVKFGDSDKARVGDWVVAMGNPLGQGFSLSAGI 207

Query: 204 VSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           VSA +R +      + Q DA IN+GNSGGP FN  G V+GVN  I++     +G+G  + 
Sbjct: 208 VSARNRALSGSYDDYIQTDAAINRGNSGGPLFNMDGEVVGVNTAILSPNGGSIGIGFSMA 267

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
            +++ K +  L   G    GW G+  Q++T +LA  +GL   +G LIT  V E PA +AG
Sbjct: 268 SNVVTKVVSQLKEFGETRRGWLGVRIQDVTDDLAEAIGLASDEGVLITD-VPEGPAKEAG 326

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND 383
           +   DVI   DG  +K  +D V ++      + V++ + ++G   ++ V LG    A  +
Sbjct: 327 LLARDVITSFDGFEVKDTRDLVRRVGDTEVGKTVRVVVFRDGKTETIRVTLGRREDAVGN 386

Query: 384 MHL--------EVGDKELLGMVLQDINDGNKK-------LVRIVALNPNREREVEAKGIQ 428
                      + G+KELLG+ +  + D  ++          +V L+ +       KG++
Sbjct: 387 GTEGGGAEAVPDEGEKELLGLTVGVVRDDMREDLNLDAGTTGLVILSVDETSGAWEKGLR 446

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            G  I     +++S I D+E  I  A+E  R S+ L ++     ++G     RFV+L ++
Sbjct: 447 AGDVITEAGQNKLSSIADLEAQIAAAEEGGRKSIFLMVR-----RAGE---PRFVALNLE 498


>gi|108759344|ref|YP_634764.1| S1C family peptidase [Myxococcus xanthus DK 1622]
 gi|108463224|gb|ABF88409.1| peptidase, S1C (protease DO) family [Myxococcus xanthus DK 1622]
          Length = 531

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 151/450 (33%), Positives = 228/450 (50%), Gaps = 35/450 (7%)

Query: 42  PVIARVSPSIVSVMVEPKKKVSVEQMFNAYG------FGNLPEDHPLKNYFRKDFHKFFS 95
           P++A VSP++V+V V        E     +G      FG LP D P  +   +D    F 
Sbjct: 75  PLVASVSPAVVNVEVRLGAPTPGETKDTPWGGDGPSPFGGLPFDGPPFDDAPEDPLSPFE 134

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
              P      E +  GSGF I   G +LT++H+VED  +  V L+D  +L A+++G+D L
Sbjct: 135 APSPFAPPVREGI--GSGFIIDARGLVLTNHHLVEDAEAIQVQLADGRDLEARVLGSDPL 192

Query: 156 FDLAVLKVQ--SDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
            D+AVL+++     K +PV    D++ +RVG+ V  IGNPF L  + S GI++A +RDI 
Sbjct: 193 TDVAVLQLERLDGGKPLPVVRLGDSDALRVGDWVLAIGNPFGLTSSTSLGILAAKERDIA 252

Query: 213 DRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
             P   F Q DA IN GNSGGP FN  G V+G+N  I   G    G+G  +P +++K  +
Sbjct: 253 AGPFDDFLQTDAAINPGNSGGPLFNLNGEVVGINTAIAGEGS---GIGFAVPSNLVKSLL 309

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
           P L  KG V  GW G+M Q++T +L   LG    +G+++T V  E+ A +AG++  D+I 
Sbjct: 310 PQLEKKGAVTRGWLGLMVQDMTPDLGEALGAPVKEGAVVTDVTAETAAARAGLRPDDIIV 369

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE--VG 389
             DG+ I S       +A + P  ++ ++L ++  K  V   LG+ P  +     E  VG
Sbjct: 370 AADGQPIDSAGALTRLVAQKPPGAELTLALYRDAKKRDVKAKLGTRPDLEGVAEKEPAVG 429

Query: 390 DKE-----LLGMVLQDINDGNKKLVRIVALNPNRE--REV------EAKGIQKGMTIVSV 436
             +      +G+ L D+   +  L     L P+     EV      E  G+  GM +V  
Sbjct: 430 GSQRPAEHRVGLSLMDM---DPALAESQELPPSGALVTEVAPASMAEHAGLLPGMVVVEA 486

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               V   KDV  +    K K  +SVLL++
Sbjct: 487 ANKPVRGAKDV--VTALRKTKPGESVLLRV 514


>gi|83942980|ref|ZP_00955440.1| periplasmic serine protease, DO/DeqQ family protein [Sulfitobacter
           sp. EE-36]
 gi|83845988|gb|EAP83865.1| periplasmic serine protease, DO/DeqQ family protein [Sulfitobacter
           sp. EE-36]
          Length = 494

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 144/466 (30%), Positives = 237/466 (50%), Gaps = 36/466 (7%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           L P+  ++SPS+V++        +VE      G   +PE  P +++F++   +   GE P
Sbjct: 45  LAPLAEKISPSVVNITT----STTVEGRTGPRGI--VPEGSPFEDFFKEFRDRNNGGEAP 98

Query: 100 ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
               +      GSGF I++DG+++T+NH++E     ++      EL A+++GTD   D+A
Sbjct: 99  APRKSS---ALGSGFVISEDGFVVTNNHVIEGADEITIEFFTGLELKAEVIGTDPNTDIA 155

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT 219
           +LKV++      V F D+N  RVG+ V  +GNP     +VSAGIVSA +R +      + 
Sbjct: 156 LLKVEAPSALPFVSFGDSNAARVGDWVLAMGNPLGQGFSVSAGIVSARNRALSGTYDDYI 215

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++ + +  L   G 
Sbjct: 216 QTDAAINRGNSGGPLFNMDGEVIGVNTAILSPNGGSIGIGFSMASNVVTRVVNQLKEFGE 275

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
              GW G+  Q++TQ++A  +GL    G+LIT  V + PA  AG+K GDVI    G  ++
Sbjct: 276 TRRGWLGVRIQDVTQDVADAMGLAKASGALITD-VPDGPAKDAGLKTGDVILSFAGVEVE 334

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG----------SSPTAKNDMHLEV- 388
             +  V Q+ + +    V++++ +EG   ++ V LG          S+   +++   E  
Sbjct: 335 DTRGLVRQVGNSTVGASVRVTVLREGKSQTLKVKLGRREDAEGAGASASAPEDEAEPEAP 394

Query: 389 GDKELLGMVLQDIND------GNKKLVRIVALNPNRE-REVEAKGIQKGMTIVSVNTHEV 441
             K +LG+ +  + D      G    V  +A+    E  E   KG++ G  I       +
Sbjct: 395 ASKSVLGLTITPLTDDLRTELGADDSVEGLAVTEVDEMSEAFEKGLRVGDIITEAEQQPI 454

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             I D+E  I +AK+  R S+LL ++   D         RFV+L +
Sbjct: 455 LSITDLEDRITEAKDGGRKSLLLLVRRAGD--------PRFVALGL 492


>gi|163733305|ref|ZP_02140748.1| serine protease DO-like precursor, putative [Roseobacter litoralis
           Och 149]
 gi|161393093|gb|EDQ17419.1| serine protease DO-like precursor, putative [Roseobacter litoralis
           Och 149]
          Length = 487

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 247/488 (50%), Gaps = 40/488 (8%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           +A+  + F+    V     P S   L P+  ++SPS+V++                   G
Sbjct: 23  IAILAMAFALVAPVTVLAQPAS---LAPLAEKISPSVVNITTSTTVSRRTGPQ------G 73

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            +PE  P +++FR D +    G  P  S        GSGF I++DGY++T+NH++E    
Sbjct: 74  IVPEGSPFEDFFR-DRNNGPEGA-PRRSSA-----LGSGFVISEDGYVVTNNHVIEGADE 126

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             +   D  EL A+++GTD   D+A+LKV+++     V F D+++ RVG+ V  +GNP  
Sbjct: 127 ILIEFFDGGELVAEVMGTDPNTDIALLKVETNEPLPFVSFGDSDSSRVGDWVIAMGNPLG 186

Query: 195 LRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
              +VSAGIVSA +R++  R   + Q DA IN+GNSGGP FN  G VIGVN  I++    
Sbjct: 187 QGFSVSAGIVSARNRELSGRYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPTGG 246

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+G  +  +++ + +  L   G    GW G+  Q++T+++A  +GL  T G+ +  V+
Sbjct: 247 SIGLGFSMASNVVTRVVDQLQEFGETRRGWLGVQIQDVTEDMAEAMGLASTDGAAVNGVL 306

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            E PA  AG+++GDVI   DGR ++  +  V Q+ +    E V++ + +     ++ V L
Sbjct: 307 -EGPALDAGIEIGDVIISFDGRDVEDTRGLVRQVGNTPVGEAVRVVVRRGDETKTLLVTL 365

Query: 375 -------GSSPT-AKNDMHLEVGDKELLGMVLQDIND------GNKKLVRIVA-LNPNRE 419
                  G++P  A+          E++G+ L  + D      G K     +A +  +  
Sbjct: 366 GRREEAEGATPAVAQAPQEDAPTSAEMMGLTLMVLTDELREQLGAKPETEGLAVMEVDEA 425

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNM 479
            E   KG++ G  I      +V+ I D+E  + +AK+  R S+LL ++   D        
Sbjct: 426 SEAFEKGLRSGDVITEAGQKKVTSIADLETRVEEAKDAGRKSLLLLVRRAGD-------- 477

Query: 480 SRFVSLKI 487
            RFV+L +
Sbjct: 478 PRFVALSL 485


>gi|27381617|ref|NP_773146.1| DO-like serine protease [Bradyrhizobium japonicum USDA 110]
 gi|27354785|dbj|BAC51771.1| serine protease DO-like precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 507

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 132/395 (33%), Positives = 211/395 (53%), Gaps = 24/395 (6%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I   G ++T+NH++ D    +VIL+D T++ A+LVG D   DLAVLK +  +  
Sbjct: 119 LGSGFIIDTSGVVVTNNHVIADADEINVILNDGTKIKAELVGVDKKTDLAVLKFKPTKPL 178

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
           + V+F D++ +R+G+ V  IGNPF L GTV+AGIVSA +RDI   P  ++ Q DA IN+G
Sbjct: 179 VAVKFGDSDKLRLGDWVVAIGNPFSLGGTVTAGIVSAKNRDISSGPYDSYIQTDAAINRG 238

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G VIGVN +I++     +G+G  +P   +   +  L   G +  GW G+ 
Sbjct: 239 NSGGPLFNLDGDVIGVNTLIISPSGGSIGIGFAVPSKTVMGVVDQLRQFGELRRGWLGVR 298

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q++T E+A  L ++  +G+L+  V  + PA  AG++ GDV+   DG+ +K  +D    +
Sbjct: 299 IQSVTDEIAESLNIKPPRGALVAGVDDKGPAKPAGIEPGDVVVKFDGKDVKDPKDLSRVV 358

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGS-------SPTAKNDMHL--EVGDKELLGMVLQ 399
           A  +  ++V + + ++G + +  V LG            K D     +   ++ LG+ L 
Sbjct: 359 ADTAVGKEVDVIIIRKGQEETKKVTLGRLQDPDKVQAAVKTDEPAPEKPVTQKALGLDLA 418

Query: 400 DINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
            +N   +   +I       V  N +   +   K +  G  IV V    VS   D+++ + 
Sbjct: 419 VLNKDLRTRYKIKDSVKGVVVTNVDANSDAAEKRLSAGDVIVEVAQEVVSSGADIQKRVD 478

Query: 453 KAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           + K+  + SVLL +       S  D   RFV+L +
Sbjct: 479 QLKKDGKKSVLLLV-------SNADGELRFVALSV 506


>gi|237815795|ref|ZP_04594792.1| protease Do [Brucella abortus str. 2308 A]
 gi|237789093|gb|EEP63304.1| protease Do [Brucella abortus str. 2308 A]
          Length = 538

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 250/532 (46%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 29  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 78

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 79  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 135

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 136 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 195

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 196 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 255

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 256 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 315

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 316 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 375

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 376 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 435

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 436 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 493

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 494 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 538


>gi|225627846|ref|ZP_03785883.1| protease Do [Brucella ceti str. Cudo]
 gi|225617851|gb|EEH14896.1| protease Do [Brucella ceti str. Cudo]
          Length = 538

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 250/532 (46%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 29  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 78

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 79  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 135

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 136 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 195

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 196 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 255

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 256 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 315

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 316 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 375

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 376 IVVIRQGAEKTLKVKLGRLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 435

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 436 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 493

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 494 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 538


>gi|163749289|ref|ZP_02156538.1| serine protease, HtrA/DegQ/DegS family protein [Shewanella benthica
           KT99]
 gi|161331008|gb|EDQ01934.1| serine protease, HtrA/DegQ/DegS family protein [Shewanella benthica
           KT99]
          Length = 450

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 148/436 (33%), Positives = 229/436 (52%), Gaps = 40/436 (9%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNA--YGFG-NLPEDHPLKNYFRKDFHKFFSG 96
           L P++AR +P++V+V V     VS +++ +A  Y FG N P +   +  FR         
Sbjct: 40  LAPMLARTTPAVVAVAVT-GTHVSKQKLPDAFRYFFGPNAPREQVQERPFRG-------- 90

Query: 97  EEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
                         GSG  I  D GYI+T+NH++E      + L D  E+ A L+GTD  
Sbjct: 91  -------------LGSGVIIDADKGYIVTNNHVIEGADEILIGLHDGREVEAILIGTDPE 137

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--D 213
            D+A+L++++D   + ++  D++ +RVG+    IGNPF L  TV++GIVSA+ R     +
Sbjct: 138 SDIALLQIKAD-NLVALKRADSDKLRVGDFAVAIGNPFGLGQTVTSGIVSAMGRSGLGIE 196

Query: 214 RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
               F Q DA IN GNSGG   N  G +IG+N  IV  G  ++G+G  IP +++   I  
Sbjct: 197 MLENFIQTDAAINSGNSGGALVNLNGDLIGINTAIVAPGGGNVGIGFAIPSNMVNNLIDQ 256

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           +I  G V  G  G+  ++LT ELA   GL    G  +  V+ +S ADKAG+K GD+I  +
Sbjct: 257 IIEYGEVRRGVLGVSGRDLTHELAKGFGLNTQHGGFVDQVMADSAADKAGIKAGDIIVSV 316

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL 393
           +GR IKS Q+   ++A+     +V+  L ++G K +V  +LG     +N   +E     +
Sbjct: 317 NGRNIKSFQELRAKVATMGAGAEVEFGLIRDGDKQTVTAILG-----ENSQTIETAAGAI 371

Query: 394 LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
             M+     + +K+ V I  +  N    V   G+ KG  IV VN    S IKD++ L  K
Sbjct: 372 HPMLAGAALENSKQGVEITNVAQNSPAAVS--GLHKGDVIVGVNR---SLIKDIKSLKAK 426

Query: 454 AKEKKRDSVLLQIKYD 469
             +++ D V L+I+ D
Sbjct: 427 LADQQGD-VALKIRRD 441


>gi|153009127|ref|YP_001370342.1| protease Do [Ochrobactrum anthropi ATCC 49188]
 gi|151561015|gb|ABS14513.1| protease Do [Ochrobactrum anthropi ATCC 49188]
          Length = 520

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 165/528 (31%), Positives = 251/528 (47%), Gaps = 74/528 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           SV  PP IA   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMTVAGTL----------SVGTPPAIAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + YF KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KEDGEGDGAVPMPQVPEGSPFQEYF-KDFFGDKGGAQGDESRKVQSL--GSGFVIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           +I+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   VEF ++  
Sbjct: 122 FIVTNNHVIADADEIEVNFNDGSKLKAELVGKDIKTDLAILKVDPSKHKLKAVEFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAVGVIDQLKEFGEVRRGWLGVRIQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+  KG+LI  +++ S  D   ++ GDV+   +G+ + + +D    +A     + V+
Sbjct: 302 SLGLKEAKGALIAGLIENSGVDNKAIEAGDVVIRYEGKPVDTARDLPRLVAETPVGKDVE 361

Query: 359 ISLCKEGSKHSVAVVLG-------SSPTAKNDMH--------------LEVGDKE----- 392
           I + ++G + +V V LG       S+  A  D                 +   KE     
Sbjct: 362 IVVVRQGEEKTVKVKLGRLVEDDKSTEAATEDQAPLPEGEGGDEGAETPDTSKKEQKSDA 421

Query: 393 ---LLGMVLQDINDGNK---------KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
              +LGM L ++ND  +         + V ++ + P        K I+ G  IV +    
Sbjct: 422 APSVLGMKLSELNDDVRGEFGIAEDVEGVAVLYVAPG--SAAGEKRIETGDVIVDIGQVN 479

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           V   +DV++ I   + + R + L+       M +      RFV+++I+
Sbjct: 480 VKTPEDVKKRIDALRREGRKNALM-------MLASRSGELRFVTVRIN 520


>gi|225852876|ref|YP_002733109.1| protease Do [Brucella melitensis ATCC 23457]
 gi|256263641|ref|ZP_05466173.1| protease [Brucella melitensis bv. 2 str. 63/9]
 gi|225641241|gb|ACO01155.1| protease Do [Brucella melitensis ATCC 23457]
 gi|263093694|gb|EEZ17699.1| protease [Brucella melitensis bv. 2 str. 63/9]
 gi|326409417|gb|ADZ66482.1| protease Do [Brucella melitensis M28]
          Length = 524

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 250/532 (46%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPMTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 362 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 479

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 480 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|319425081|gb|ADV53155.1| protease Do [Shewanella putrefaciens 200]
          Length = 451

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 152/478 (31%), Positives = 242/478 (50%), Gaps = 54/478 (11%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVD------LPPVIARVSPSIVSVMVEPK--KKV 62
           S+ + A+     +    + +A +P  +VD      L P++ R +P++VSV V      K 
Sbjct: 6   SVLSAAMLAATLTMMPAISQAAIP-QTVDGQSMPSLAPMLERATPAVVSVAVTGTHVSKQ 64

Query: 63  SVEQMFNAYGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
            V  +F  Y FG N+P++   +  FR                       GSG  I  D G
Sbjct: 65  RVPDVFR-YFFGPNVPQEQIQERPFRG---------------------LGSGVIIDADKG 102

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YI+T+NH++       V L D  E+ AKL+G DA  D+A+L++++ +  + ++  D++++
Sbjct: 103 YIVTNNHVINGADDIQVGLHDGREVKAKLIGADAESDIALLQIEA-KNLVAIKSSDSDDL 161

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNAL 238
           RVG+    IGNPF L  TV++GIVSAL R     +    F Q DA IN GNSGG   N  
Sbjct: 162 RVGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLN 221

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G +IG+N  IV  G  ++G+G  IP +++K  +  ++  G V  G  GI  ++L  +LA 
Sbjct: 222 GELIGINTAIVAPGGGNVGIGFAIPANMVKNLVAQIVEHGEVRRGVLGISGRDLDSQLAQ 281

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G  +  V   S A+KAG+K GD+I  +DGR IKS Q+   ++A+     +V+
Sbjct: 282 GFGLDTQHGGFVNEVTAGSAAEKAGIKAGDIIVSVDGRGIKSFQELRAKVATMGAGAKVE 341

Query: 359 ISLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVAL 414
           + + ++G K +V V LG    +S +A   +H       L G  L++   G   +  +   
Sbjct: 342 LGIIRDGDKKTVKVTLGEASQTSDSAAGAVH-----PMLQGAALENAAKGGVTITDVAQG 396

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
           +P         G+QKG  IV +N    + IKD++ L    K+++  +V L+I  D  M
Sbjct: 397 SP-----AAMSGLQKGDIIVGINR---TAIKDLKALKAHLKDQE-GAVALKILRDKSM 445


>gi|262373083|ref|ZP_06066362.1| periplasmic serine peptidase DegS [Acinetobacter junii SH205]
 gi|262313108|gb|EEY94193.1| periplasmic serine peptidase DegS [Acinetobacter junii SH205]
          Length = 458

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 124/362 (34%), Positives = 203/362 (56%), Gaps = 21/362 (5%)

Query: 21  IFSSTYLVLEAKLPPSS-VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
           +F++ + V  A++  +S VD   ++ +VSP++VSV V   KK++ E++            
Sbjct: 10  LFTAVFTVAAAQVNAASPVDFSNLVEQVSPAVVSVNV--VKKMTQEEL------------ 55

Query: 80  HPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV 137
             L+    +   +FF  +   P      E+  +GS FFI+ DGY++T++H++E+ +  S+
Sbjct: 56  --LQQQVPEILRRFFGNQIIIPQQQGPQEKTAYGSAFFISKDGYLVTNHHVIENASRISI 113

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRG 197
            L+D  EL A LVG+D   D+AVLKV  +  F  ++  D N ++VGE V  IG+PF    
Sbjct: 114 TLNDRRELDATLVGSDERTDVAVLKVNGN-NFPELKIGDVNRLKVGEPVLAIGSPFGFDY 172

Query: 198 TVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHM 256
           + SAGIVSA  R++       F Q DA +N GNSGGP FN  G VIGVN+ I +    +M
Sbjct: 173 SASAGIVSAKSRNMSGETSVPFIQTDAALNPGNSGGPLFNQQGEVIGVNSRIFSGTGGYM 232

Query: 257 GVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKE 316
           G+   IP+ +    +  L   G+V   + G+M Q++ + LA    L   +GSLIT V  +
Sbjct: 233 GLSFSIPIDVAMDVVQQLKVNGKVTRSYLGVMLQDIDRNLAEAYKLPKPEGSLITQVTPK 292

Query: 317 SPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           SPA+KAG+K GDVI  ++G  I    D +  +   +P + +++ + ++    +++  LG+
Sbjct: 293 SPAEKAGLKSGDVILKINGNSILRTSDLLNVLNRVAPNQTIQLDVLRDDRTRTISATLGT 352

Query: 377 SP 378
           +P
Sbjct: 353 AP 354


>gi|23502265|ref|NP_698392.1| serine protease Do [Brucella suis 1330]
 gi|161619341|ref|YP_001593228.1| protease Do [Brucella canis ATCC 23365]
 gi|163843649|ref|YP_001628053.1| protease Do [Brucella suis ATCC 23445]
 gi|254702116|ref|ZP_05163944.1| protease Do [Brucella suis bv. 5 str. 513]
 gi|254704653|ref|ZP_05166481.1| protease Do [Brucella suis bv. 3 str. 686]
 gi|254708068|ref|ZP_05169896.1| protease Do [Brucella pinnipedialis M163/99/10]
 gi|254710438|ref|ZP_05172249.1| protease Do [Brucella pinnipedialis B2/94]
 gi|254714431|ref|ZP_05176242.1| protease Do [Brucella ceti M644/93/1]
 gi|254717328|ref|ZP_05179139.1| protease Do [Brucella ceti M13/05/1]
 gi|256031932|ref|ZP_05445546.1| protease Do [Brucella pinnipedialis M292/94/1]
 gi|256061453|ref|ZP_05451597.1| protease Do [Brucella neotomae 5K33]
 gi|256160130|ref|ZP_05457824.1| protease Do [Brucella ceti M490/95/1]
 gi|256255336|ref|ZP_05460872.1| protease Do [Brucella ceti B1/94]
 gi|256369810|ref|YP_003107321.1| serine protease Do, putative [Brucella microti CCM 4915]
 gi|260169068|ref|ZP_05755879.1| serine protease Do, putative [Brucella sp. F5/99]
 gi|260566101|ref|ZP_05836571.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261219157|ref|ZP_05933438.1| protease Do [Brucella ceti M13/05/1]
 gi|261222537|ref|ZP_05936818.1| protease [Brucella ceti B1/94]
 gi|261315569|ref|ZP_05954766.1| protease Do [Brucella pinnipedialis M163/99/10]
 gi|261318008|ref|ZP_05957205.1| protease Do [Brucella pinnipedialis B2/94]
 gi|261322219|ref|ZP_05961416.1| protease Do [Brucella ceti M644/93/1]
 gi|261325459|ref|ZP_05964656.1| protease [Brucella neotomae 5K33]
 gi|261752686|ref|ZP_05996395.1| serine endoprotease [Brucella suis bv. 5 str. 513]
 gi|261755346|ref|ZP_05999055.1| serine endoprotease [Brucella suis bv. 3 str. 686]
 gi|261758572|ref|ZP_06002281.1| serine endoprotease [Brucella sp. F5/99]
 gi|265989038|ref|ZP_06101595.1| protease [Brucella pinnipedialis M292/94/1]
 gi|265998502|ref|ZP_06111059.1| protease [Brucella ceti M490/95/1]
 gi|23348238|gb|AAN30307.1| serine protease Do, putative [Brucella suis 1330]
 gi|161336152|gb|ABX62457.1| protease Do [Brucella canis ATCC 23365]
 gi|163674372|gb|ABY38483.1| protease Do [Brucella suis ATCC 23445]
 gi|255999973|gb|ACU48372.1| serine protease Do, putative [Brucella microti CCM 4915]
 gi|260155619|gb|EEW90699.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260921121|gb|EEX87774.1| protease [Brucella ceti B1/94]
 gi|260924246|gb|EEX90814.1| protease Do [Brucella ceti M13/05/1]
 gi|261294909|gb|EEX98405.1| protease Do [Brucella ceti M644/93/1]
 gi|261297231|gb|EEY00728.1| protease Do [Brucella pinnipedialis B2/94]
 gi|261301439|gb|EEY04936.1| protease [Brucella neotomae 5K33]
 gi|261304595|gb|EEY08092.1| protease Do [Brucella pinnipedialis M163/99/10]
 gi|261738556|gb|EEY26552.1| serine endoprotease [Brucella sp. F5/99]
 gi|261742439|gb|EEY30365.1| serine endoprotease [Brucella suis bv. 5 str. 513]
 gi|261745099|gb|EEY33025.1| serine endoprotease [Brucella suis bv. 3 str. 686]
 gi|262553126|gb|EEZ08960.1| protease [Brucella ceti M490/95/1]
 gi|264661235|gb|EEZ31496.1| protease [Brucella pinnipedialis M292/94/1]
          Length = 524

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 250/532 (46%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 362 IVVIRQGAEKTLKVKLGRLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 479

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 480 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|254694080|ref|ZP_05155908.1| serine protease Do, hypothetical [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214378|ref|ZP_05928659.1| serine protease [Brucella abortus bv. 3 str. Tulya]
 gi|260915985|gb|EEX82846.1| serine protease [Brucella abortus bv. 3 str. Tulya]
          Length = 524

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 250/532 (46%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 362 IVVIRQGAEKALKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 479

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 480 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|209965272|ref|YP_002298187.1| periplasmic serine protease, Do [Rhodospirillum centenum SW]
 gi|209958738|gb|ACI99374.1| periplasmic serine protease, Do [Rhodospirillum centenum SW]
          Length = 516

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 140/382 (36%), Positives = 202/382 (52%), Gaps = 27/382 (7%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDD--TELPAKLVGTDALFDLAVLKVQSDR 167
            GSGF I   GY++T+NH+++      VIL D   TEL A+++G D   DLA+LKV + R
Sbjct: 123 LGSGFIIDPAGYVVTNNHVIDGADEIRVILHDQEGTELKAEVIGVDKETDLALLKVDAGR 182

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPIN 226
           K   + + D+  IRVG+ V  IGNPF L G+V+AGI+SA  RDI   R   F Q DA IN
Sbjct: 183 KLPALSWGDSEKIRVGDWVVAIGNPFGLGGSVTAGIISARARDIGAGRYDDFLQTDASIN 242

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
           +GNSGGP  N  G VIG+N  I +     +G+G  IP ++ K  I  L   G+V  GW G
Sbjct: 243 RGNSGGPLVNLSGDVIGINTAIFSQTGGSIGIGFAIPSAMAKNVIAQLRESGKVRRGWLG 302

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  QN++ E A  L L   KG+L+  V    PA+KAG++ GDVI   DGR + + +    
Sbjct: 303 VQIQNISPEEAEALRLPEAKGALVGMVNPGGPAEKAGLQPGDVILSFDGREVTNSRSLPR 362

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE----VGDK--------ELL 394
            +A     ++V + L + G + +V VVLG       D+ L      GD         E +
Sbjct: 363 MVADTPVGKKVPVELIRRGKRETVQVVLGE--LQPQDVQLANAPGQGDAAPGKPETIEGV 420

Query: 395 GMVLQDIN---------DGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
           G+ +  I+         D + K V I  + PN    V  + ++ G  IV V+  EV    
Sbjct: 421 GIAVTSISPEVRRQFELDDDVKGVVITQVAPNSPAAVRQQ-LRAGDVIVEVSQEEVGSPA 479

Query: 446 DVERLIGKAKEKKRDSVLLQIK 467
           DV   + KA++  + ++LL I+
Sbjct: 480 DVVARVKKARDAGQKALLLLIE 501


>gi|330502441|ref|YP_004379310.1| protease Do [Pseudomonas mendocina NK-01]
 gi|328916727|gb|AEB57558.1| protease Do [Pseudomonas mendocina NK-01]
          Length = 474

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 134/388 (34%), Positives = 208/388 (53%), Gaps = 26/388 (6%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKK 60
           R++ S+  +  VAL         L+ +A LP    D   ++   SP++V++      P++
Sbjct: 2   RKLKSIAPLLAVALLW----GQSLLAQASLP----DFTDLVEEASPAVVNISTRQKMPER 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITD 118
            V+        G   LP+   L   FR+ F +    + P      +R     GSGF I+ 
Sbjct: 54  AVA--------GQPGLPDLEGLPPMFREFFERSIP-QVPRNPGGRQREAQSLGSGFIISP 104

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDA 177
           DGYI+T+NH+V D     V LSD +EL AKL+G D   D+A+LKV+   K +PV     A
Sbjct: 105 DGYIMTNNHVVADADEIIVRLSDRSELEAKLIGADPRSDVALLKVEG--KDLPVVRLGKA 162

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFN 236
           ++++VGE V  IG+PF    +V+AGIVSA  R++P D    F Q D  IN GNSGGP FN
Sbjct: 163 DDLKVGEWVLAIGSPFGFDHSVTAGIVSAKGRNLPSDSYVPFIQTDVAINPGNSGGPLFN 222

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N+ I T     MG+   IP+ +  +    L + G+V  GW G++ Q + ++L
Sbjct: 223 LQGEVVGINSQIFTRSGGFMGLSFAIPMEVAMQVADQLKADGKVTRGWLGVVIQEVNKDL 282

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL    G+L+  V+++ PADK G+ VGDVI  L+G+ I    D    +    P E+
Sbjct: 283 AESFGLEKPAGALVAQVLEDGPADKGGLLVGDVILSLNGKPIIMSADLPHLVGGLKPGEK 342

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDM 384
            ++ + ++GS+  + V +G+ P    ++
Sbjct: 343 AELDVVRDGSRKKLDVTVGTLPEEGQEL 370


>gi|306843269|ref|ZP_07475878.1| protease Do [Brucella sp. BO2]
 gi|306286535|gb|EFM58118.1| protease Do [Brucella sp. BO2]
          Length = 497

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 158/508 (31%), Positives = 244/508 (48%), Gaps = 68/508 (13%)

Query: 37  SVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMFNAYGFGN-------LPEDHPLKNY 85
           S+ +PP +A   P+ V+ + E        +S  Q     G G+       +PE  P + +
Sbjct: 2   SMGMPPALAAQGPASVADLAEGLLDAVVNISTSQTVKDDGEGDGPVPMPQVPEGSPFQEF 61

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTE 144
           F KDF     G +   S  V+ L  GSGF I  + GYI+T+NH++ D     V  +D ++
Sbjct: 62  F-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKGYIVTNNHVIADADEIEVNFNDGSK 118

Query: 145 LPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
           L A+LVG D   DLA+LKV  S  K   V F ++   R+G+ V  IGNPF L GTV+AGI
Sbjct: 119 LKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEKARIGDWVLAIGNPFGLGGTVTAGI 178

Query: 204 VSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           +SA  RDI   P   F Q DA IN+GNSGGP F+  G VIG+N  I++     +G+G  I
Sbjct: 179 ISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMDGKVIGINTAIISPSGGSIGIGFAI 238

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P  +    I  L   G V  GW G+  Q +T+++A  LGL+ TKG+LI  +++ S  D  
Sbjct: 239 PAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQSLGLKETKGALIAGLIENSGVDNK 298

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL-------- 374
            ++ GDV+   DG+ + + +D    +A     ++V+I + ++G++ ++ V L        
Sbjct: 299 AIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVEIVVIRQGAEKTLKVKLGRLVEDDK 358

Query: 375 ---------------GSSPTAKNDM----------HLEVGDKELLGMVLQDINDG----- 404
                          G  P A+ +           H       +LGM L  ++D      
Sbjct: 359 STEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEHKSDAAPSVLGMKLSTLDDDIRGEF 418

Query: 405 ----NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
               + + V I+ + P        K I+ G  IV +    V   +DV++ I   + + R 
Sbjct: 419 GIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDIGQVTVKTPEDVKKRIDALRREGRK 476

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           + LL       M +      RFV+++ID
Sbjct: 477 NALL-------MLASRSGELRFVTIRID 497


>gi|39995191|ref|NP_951142.1| protease degQ [Geobacter sulfurreducens PCA]
 gi|39981953|gb|AAR33415.1| protease degQ [Geobacter sulfurreducens PCA]
          Length = 471

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 147/485 (30%), Positives = 249/485 (51%), Gaps = 45/485 (9%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPP------------VIARVS 48
           MF R++L +  +    LT        L  E+    + V   P            ++ +V+
Sbjct: 1   MFVRRLLLISLVFVTTLTACSKKEEKLFYESGRADAPVKEVPRDILATQQAFVELVKKVT 60

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERL 108
           PS+V++    ++K+  EQ F  +         P  N F  +  +F   +           
Sbjct: 61  PSVVNISTVSRRKI--EQPFFEF--------SPFFNDFFDNRPRFRREQS---------- 100

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF I  +GYI+T++H+V D  S  V LS++      +VG+D   D+AV+K+ S R+
Sbjct: 101 -LGSGFIINREGYIVTNDHVVRDAESIKVKLSNENVYDGHIVGSDPKTDIAVIKIDS-RE 158

Query: 169 FIPVE-FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPI 225
            +PV    D++ ++VG+    IGNPF L  TV+ G+VSA  R     +    F Q DA I
Sbjct: 159 ELPVAVLADSDKLQVGQWAVAIGNPFGLDRTVTVGVVSATGRSNMGIETYEDFIQTDASI 218

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N GNSGGP  N  G VIG+N  IV +GQ   G+G  IP+++ K+ +  LI+KG+V  GW 
Sbjct: 219 NPGNSGGPLLNVHGEVIGINTAIVAAGQ---GIGFAIPVNMAKQIVTQLITKGKVTRGWL 275

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q +T +LA   GL+  +G L++ VVK SPA  AG++ GD+I    G+ IK  Q   
Sbjct: 276 GVTIQPVTDDLAKEFGLKKAQGVLVSDVVKGSPAAGAGIRQGDIILRFAGKEIKDAQHLQ 335

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLGMVLQDINDG 404
             +   +P  +V + + +EG +  +++   SS +A+      + G  + LG+ ++++   
Sbjct: 336 RVVGDTAPGTKVPVVVFREGKEVQLSLATASSDSAQARQARPQGGAPDTLGLAVEELPRE 395

Query: 405 NKK--LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
            ++     ++ +  +        GI++G  IV+VN   V+ + + +R++ +A   +R SV
Sbjct: 396 YRQEGFTGVLVVQVDDGSAAGEAGIREGDVIVAVNRRPVANLAEYDRVMREA--ARRGSV 453

Query: 463 LLQIK 467
           +L ++
Sbjct: 454 VLLVR 458


>gi|296390884|ref|ZP_06880359.1| serine protease MucD precursor [Pseudomonas aeruginosa PAb1]
          Length = 467

 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 128/368 (34%), Positives = 204/368 (55%), Gaps = 15/368 (4%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
            A+  ++  S  +   A+LP    D  P++ + SP++V++    ++K+    M  A G  
Sbjct: 2   AAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNIST--RQKLPDRAM--ARGQL 53

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVEDG 132
           ++P+   L   FR DF +    + P      +R     GSGF I++DGYILT+NH+V D 
Sbjct: 54  SIPDLEGLPPMFR-DFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVADA 112

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGN 191
               V LSD +E  AKL+G D   D+AVLK+++  K +P ++  D+N ++VGE V  IG+
Sbjct: 113 DEILVRLSDRSEHKAKLIGADPRSDVAVLKIEA--KNLPTLKLGDSNKLKVGEWVLAIGS 170

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T
Sbjct: 171 PFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQIFT 230

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+
Sbjct: 231 RSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALV 290

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+
Sbjct: 291 AQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSL 350

Query: 371 AVVLGSSP 378
           ++ +GS P
Sbjct: 351 SMAVGSLP 358


>gi|115524194|ref|YP_781105.1| peptidase S1C, Do [Rhodopseudomonas palustris BisA53]
 gi|115518141|gb|ABJ06125.1| protease Do [Rhodopseudomonas palustris BisA53]
          Length = 499

 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 153/500 (30%), Positives = 250/500 (50%), Gaps = 49/500 (9%)

Query: 18  TCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGN-- 75
            CV+ +S  +     + P++   P  IA V+  ++  +V     +S  Q   A   G+  
Sbjct: 18  ACVVVASLSVACALSMAPAAARGPDGIADVAEKVIDAVVN----ISTTQTVVAKAGGDSK 73

Query: 76  -----LPEDHPLKNYFRKDF--HKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                LP   P + +F   F   +   G  P  +++      GSGF +   G  +T+NH+
Sbjct: 74  GAAPQLPPGSPFEEFFEDFFKNRRGDKGGGPRKTNS-----LGSGFIVDTAGIAVTNNHV 128

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK-FIPVEFEDANNIRVGEAVF 187
           + D    ++I++D T++ A+LVG D   DLAVLK +   K  + V+F D++ +R+GE V 
Sbjct: 129 IADADEINIIMNDGTKIKAELVGVDKKTDLAVLKFKPPAKPLVAVKFGDSDKLRLGEWVV 188

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IGNPF L GTV+AGIVSA +RDI   P  ++ Q DA IN+GNSGGP FN  G V+GVN 
Sbjct: 189 AIGNPFSLGGTVTAGIVSARNRDINSGPYDSYIQTDAAINRGNSGGPLFNLNGEVVGVNT 248

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
           +I++     +G+G  +P   +   + SL   G +  GW G+  Q +T E+A  L ++  +
Sbjct: 249 LIISPSGGSIGIGFAVPSKTVVGVVDSLRQFGELRRGWLGVRIQQVTDEIAESLNIKPAR 308

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+LI  V  + PA  AG++ GDV+   DG+ IK  +D    +A  +  + V + + ++G 
Sbjct: 309 GALIAGVEDKGPAKPAGIEPGDVVVKFDGKDIKEPKDLSRVVADTAVGKSVDVVIIRKGE 368

Query: 367 KHSVAVVLG--------------SSPTAKNDMHLEVGDKELLGMVLQ-----DINDGNKK 407
           + +  V LG              S P A+  +  +    +L G+  +      I D + K
Sbjct: 369 EQTKQVTLGKLEDTDKPQPASVKSQPEAEKPVTQKALGLDLAGLSKELRAKYKIKD-SVK 427

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            V + +++P    +   K +  G  IV V    V+   D+++ I   K+  + SVLL + 
Sbjct: 428 GVLVTSVDPG--SDAAEKRLSAGDVIVEVAQEAVASAADIKKRIEAIKKDGKKSVLLLV- 484

Query: 468 YDPDMQSGNDNMSRFVSLKI 487
                 S  D   RFV++ +
Sbjct: 485 ------SNGDGELRFVAVGV 498


>gi|94497744|ref|ZP_01304311.1| Peptidase S1C, Do [Sphingomonas sp. SKA58]
 gi|94422793|gb|EAT07827.1| Peptidase S1C, Do [Sphingomonas sp. SKA58]
          Length = 499

 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 143/454 (31%), Positives = 226/454 (49%), Gaps = 52/454 (11%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ ++ P++V++    K++V V+  F    FGNL                 F   +P   
Sbjct: 51  MVEKLQPAVVNIST--KQRVQVQNPFAGTPFGNL-----------------FGQGQP--- 88

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGA------SFSVILSDDTELPAKLVGTDALF 156
            T +    GSGF I+ DGYI+T+NH+V  GA        +V +++  E  AKLVG DA  
Sbjct: 89  QTRQAQSLGSGFIISADGYIVTNNHVVSAGAEGASVEQITVTMTNREEYTAKLVGRDAAT 148

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG 216
           D+AVLK++  +    V+F D++  RVG+ V  IGNPF L GTV+AGI+SAL R       
Sbjct: 149 DIAVLKIEPKKALPFVKFGDSSKARVGDWVVAIGNPFALSGTVTAGIISALHRGTGGTYD 208

Query: 217 TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q DA INQGNSGGP F+  G+VIG+N+ I++    ++G+G  IP    +  + +L+ 
Sbjct: 209 KFIQTDASINQGNSGGPMFDMRGNVIGINSQILSPSGGNVGIGFAIPSEQAEPIVRTLMK 268

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
              V  G+ G+    L ++LA  LGL    G  I  V     ADKAG+K GDVI  ++G+
Sbjct: 269 GQTVKRGYLGVQISPLGEDLAESLGLAKNSGEFIQGVEPGKGADKAGIKAGDVIVSVNGQ 328

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK--NDMHLEVGDKELL 394
            +   Q+    +A++    +V I L + G + +V  V+G  P     N       D++  
Sbjct: 329 EVNPDQNLSSIVANQPIGSKVPIVLIRNGQRMTVTAVVGERPPEDELNSFAQSQDDEDFS 388

Query: 395 GMVLQDINDGNKKLVRIVA--LNPNREREV--------------------EAKGIQKGMT 432
               Q      ++ + I A  L P   R++                     AKG+++G  
Sbjct: 389 QQQQQTPGKAAEQSLGIAAIPLTPGIIRQLGIPTDTRGIVITGVDGSTDAGAKGLRRGDV 448

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           I+S N   V+   +++  +     + R+++LLQ+
Sbjct: 449 IISANNRPVTSQAELDAQVKAVAGQGRNAILLQV 482


>gi|62290288|ref|YP_222081.1| serine protease Do [Brucella abortus bv. 1 str. 9-941]
 gi|82700211|ref|YP_414785.1| serine protease family protein [Brucella melitensis biovar Abortus
           2308]
 gi|189024521|ref|YP_001935289.1| serine protease Do, hypothetical [Brucella abortus S19]
 gi|254689590|ref|ZP_05152844.1| serine protease Do, hypothetical [Brucella abortus bv. 6 str. 870]
 gi|254697732|ref|ZP_05159560.1| serine protease Do, hypothetical [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730621|ref|ZP_05189199.1| serine protease Do, hypothetical [Brucella abortus bv. 4 str. 292]
 gi|256113943|ref|ZP_05454731.1| serine protease Do, hypothetical [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257839|ref|ZP_05463375.1| serine protease Do, hypothetical [Brucella abortus bv. 9 str. C68]
 gi|260546830|ref|ZP_05822569.1| protease [Brucella abortus NCTC 8038]
 gi|260755117|ref|ZP_05867465.1| serine protease [Brucella abortus bv. 6 str. 870]
 gi|260758336|ref|ZP_05870684.1| serine protease [Brucella abortus bv. 4 str. 292]
 gi|260762162|ref|ZP_05874505.1| serine protease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884129|ref|ZP_05895743.1| protease [Brucella abortus bv. 9 str. C68]
 gi|265995290|ref|ZP_06107847.1| protease [Brucella melitensis bv. 3 str. Ether]
 gi|297248676|ref|ZP_06932394.1| serine protease Do [Brucella abortus bv. 5 str. B3196]
 gi|62196420|gb|AAX74720.1| serine protease Do, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82616312|emb|CAJ11369.1| Serine proteases, V8 family:Serine protease, trypsin
           family:PDZ/DHR/GLGF domain:HtrA/DegQ
           protease:Glucose/ribitol dehydrogenase [Brucella
           melitensis biovar Abortus 2308]
 gi|189020093|gb|ACD72815.1| serine protease Do, hypothetical [Brucella abortus S19]
 gi|260095880|gb|EEW79757.1| protease [Brucella abortus NCTC 8038]
 gi|260668654|gb|EEX55594.1| serine protease [Brucella abortus bv. 4 str. 292]
 gi|260672594|gb|EEX59415.1| serine protease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675225|gb|EEX62046.1| serine protease [Brucella abortus bv. 6 str. 870]
 gi|260873657|gb|EEX80726.1| protease [Brucella abortus bv. 9 str. C68]
 gi|262766403|gb|EEZ12192.1| protease [Brucella melitensis bv. 3 str. Ether]
 gi|297175845|gb|EFH35192.1| serine protease Do [Brucella abortus bv. 5 str. B3196]
          Length = 524

 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 250/532 (46%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 362 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 479

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 480 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|254719428|ref|ZP_05181239.1| protease Do [Brucella sp. 83/13]
 gi|265984432|ref|ZP_06097167.1| protease Do [Brucella sp. 83/13]
 gi|306839204|ref|ZP_07472021.1| protease Do [Brucella sp. NF 2653]
 gi|306844292|ref|ZP_07476884.1| protease Do [Brucella sp. BO1]
 gi|264663024|gb|EEZ33285.1| protease Do [Brucella sp. 83/13]
 gi|306275364|gb|EFM57105.1| protease Do [Brucella sp. BO1]
 gi|306405751|gb|EFM62013.1| protease Do [Brucella sp. NF 2653]
          Length = 524

 Score =  209 bits (532), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 250/532 (46%), Gaps = 78/532 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVL-----------------------GSSPTAKNDM----------H 385
           I + ++G++ ++ V L                       G  P A+ +           H
Sbjct: 362 IVVIRQGAEKTLKVKLGRLVEDDKSTDPAVEDQVPAPDDGEQPGARQETPDKSDQPKKEH 421

Query: 386 LEVGDKELLGMVLQDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
                  +LGM L  ++D          + + V I+ + P        K I+ G  IV +
Sbjct: 422 KSDAAPSVLGMKLSTLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDI 479

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 480 GQVTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|330808072|ref|YP_004352534.1| serine protease precursor [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376180|gb|AEA67530.1| serine protease precursor [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 476

 Score =  209 bits (532), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 140/453 (30%), Positives = 233/453 (51%), Gaps = 28/453 (6%)

Query: 24  STYLVLEAKLPPSSVDLP---PVIARVSPSIVSVMVE---PKKKVSVEQMFNAYGFGNLP 77
           +T LVL   +P  +V+LP    ++ + SP++V++      P ++VS +QM +  G   + 
Sbjct: 14  ATVLVLGQAVPAVAVELPDFTQLVEQASPAVVNISTTQKLPDRRVSDQQMPDLEGLPPM- 72

Query: 78  EDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV 137
               L+ +F +   +      P      E    GSGF I+ DGYILT+NH++ D     V
Sbjct: 73  ----LREFFERGMPQ--QPRSPGGGRQREAQSLGSGFIISPDGYILTNNHVIADADEILV 126

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLR 196
            L+D +EL AKL+GTD   D+A+LK++   K +PV +   + +++ G+ V  IG+PF   
Sbjct: 127 RLADRSELKAKLIGTDPRSDVALLKIEG--KDLPVLKLGKSQDLKAGQWVVAIGSPFGFD 184

Query: 197 GTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
            TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN  G V+G+N+ I T     
Sbjct: 185 HTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAGEVVGINSQIYTRSGGF 244

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           MGV   IP+ +       L S+G+V  GW G++ Q + ++LA   GL    G+L+  + +
Sbjct: 245 MGVSFAIPIDVAMDVSNQLKSEGKVSRGWLGVVIQEVNKDLAESFGLEKPAGALVAQIQE 304

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             PA K G++VGDVI  ++G+ I    D    + +     +  + + +EG + +V + +G
Sbjct: 305 GGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGALKAGAKANLEVIREGKRKNVELTVG 364

Query: 376 SSPTAKNDMH------LEVGDKELLGMVLQDINDGNKKLVRI---VALNPNREREVEAKG 426
           + P    ++       +E      LG+ + ++ +  K+ + +   V +   ++      G
Sbjct: 365 AIPEEGKELDSLPKSGVERSSNR-LGVAVAELTEEQKRTLELQGGVVIKEVQDGPAALIG 423

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
           +Q G  I  +N   +   K+    I KA  K R
Sbjct: 424 LQPGDIITHLNNQAIGSAKEFTD-IAKALPKNR 455


>gi|83644628|ref|YP_433063.1| serine protease MucD precursor [Hahella chejuensis KCTC 2396]
 gi|83632671|gb|ABC28638.1| serine protease MucD precursor [Hahella chejuensis KCTC 2396]
          Length = 469

 Score =  209 bits (532), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 151/468 (32%), Positives = 231/468 (49%), Gaps = 28/468 (5%)

Query: 19  CVIFSSTYLVLEA---KLPPSSVDLPP---VIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  +++  LV  +    +   +VDLP    ++ R SP++V++    K      Q    Y 
Sbjct: 4   CQKYTAVLLVWLSAVVSMRAGAVDLPDFTGLVERTSPAVVNISTVRKVGDDSAQ----YY 59

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
           FG  PE   +  +FR  F   +    P  + +      GSGF ++ DGYILT+NH+V   
Sbjct: 60  FGG-PEQDQIPEFFRHFFGDPYRRRGPQEAQST-----GSGFIVSKDGYILTNNHVVAGA 113

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGN 191
               V L D  EL AKL+G+D   DLAVLKV++D   +PV     ++ ++VGE V  IG+
Sbjct: 114 DEIFVRLMDRRELTAKLIGSDEKSDLAVLKVEADD--LPVLNLGKSSELKVGEWVVAIGS 171

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    TV+AGIVSA  R +P+     F Q D  IN GNSGGP FN  G V+G+N+ I T
Sbjct: 172 PFGFEYTVTAGIVSAKGRSLPNENYVPFIQTDVAINPGNSGGPLFNLEGEVVGINSQIYT 231

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MGV   IP+ +    +  L   G V  GW G++ Q + ++LA    L   +G+L+
Sbjct: 232 RSGGFMGVSFAIPIDVALDVMNQLKDTGAVKRGWLGVLIQEVNKDLAESFNLNKPRGALV 291

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             V+K SPADKAG++ GDVI   +G  I    +    +   SP ++  + + + G +  V
Sbjct: 292 AQVMKGSPADKAGLQPGDVIVSYNGNEIGLSSELPHLVGRTSPGQKASMKVVRRGDEMDV 351

Query: 371 AVVLGSSPTAKNDM-HLEVG----DKELLGMVLQDINDGNKKLVRI---VALNPNREREV 422
           AV +G  P   N +  +  G        L + ++D+ D  K+ +++   V +        
Sbjct: 352 AVEIGQLPADDNGVASVPAGQTAPQNNALNLQVRDLTDEEKESMQVAGGVMVAQVFPGPA 411

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
              GIQ    I S+N  +V  +     ++ K    K   VL+  + +P
Sbjct: 412 ATAGIQPNDVISSINNKDVETVAQFHEVVEKLPVGKSLPVLIIRQGNP 459


>gi|298504195|gb|ADI82918.1| protease lipoprotein DegQ [Geobacter sulfurreducens KN400]
          Length = 468

 Score =  209 bits (532), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 147/484 (30%), Positives = 249/484 (51%), Gaps = 46/484 (9%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPP------------VIARVS 48
           MF R++L +  +    LT        L  E+    + V   P            ++ +V+
Sbjct: 1   MFVRRLLLISLVFVTTLTACSKKEEKLFYESGRADAPVKEVPRDILATQQAFVELVKKVT 60

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERL 108
           PS+V++    ++K+  EQ F  +         P  N F  +  +F   +           
Sbjct: 61  PSVVNISTVSRRKI--EQPFFEF--------SPFFNDFFDNRPRFRREQS---------- 100

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF I  +GYI+T++H+V D  S  V LS++      +VG+D   D+AV+K+ S R+
Sbjct: 101 -LGSGFIINREGYIVTNDHVVRDAESIKVKLSNENVYDGHIVGSDPKTDIAVIKIDS-RE 158

Query: 169 FIPVE-FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPI 225
            +PV    D++ ++VG+    IGNPF L  TV+ G+VSA  R     +    F Q DA I
Sbjct: 159 ELPVAVLADSDKLQVGQWAVAIGNPFGLDRTVTVGVVSATGRSNMGIETYEDFIQTDASI 218

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N GNSGGP  N  G VIG+N  IV +GQ   G+G  IP+++ K+ +  LI+KG+V  GW 
Sbjct: 219 NPGNSGGPLLNVHGEVIGINTAIVAAGQ---GIGFAIPVNMAKQIVTQLITKGKVTRGWL 275

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q +T +LA   GL+  +G L++ VVK SPA  AG++ GD+I    G+ IK  Q   
Sbjct: 276 GVTIQPVTDDLAKEFGLKKAQGVLVSDVVKGSPAAGAGIRQGDIILRFAGKEIKDAQHLQ 335

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGN 405
             +   +P  +V + + +EG +  +++   SS +A+     + G  + LG+ ++++    
Sbjct: 336 RVVGDTAPGTKVPVVVFREGKEVQLSLATASSDSAQ--ARPQGGAPDTLGLAVEELPREY 393

Query: 406 KK--LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
           ++     ++ +  +        GI++G  IV+VN   V+ + + +R++ +A   +R SV+
Sbjct: 394 RQEGFTGVLVVQVDDGSAAGEAGIREGDVIVAVNRRPVANLAEYDRVMREA--ARRGSVV 451

Query: 464 LQIK 467
           L ++
Sbjct: 452 LLVR 455


>gi|239907577|ref|YP_002954318.1| putative protease Do [Desulfovibrio magneticus RS-1]
 gi|239797443|dbj|BAH76432.1| putative protease Do [Desulfovibrio magneticus RS-1]
          Length = 489

 Score =  209 bits (532), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 150/485 (30%), Positives = 247/485 (50%), Gaps = 36/485 (7%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEP--KKKVSV 64
           ++ + + T   T  + + T +  +A++P    D+  ++ +  P++V++      K +  +
Sbjct: 1   MARRLLATTIATLSLIAWTAMA-QARVPLP--DITELVDKDGPAVVNISTTKTVKAQEGM 57

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS---GEEPILSDTVERLMFGSGFFITDDGY 121
            ++F   G     +  P+ ++F + F K F              ++   GSGF I+ DGY
Sbjct: 58  RELFQRRG----GQGGPMDDFFEQ-FEKHFGPQGRGGGQGGKGQKQRSMGSGFVISADGY 112

Query: 122 ILTSNHIVEDGASFSVILSDDTE-LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           I+T+NH+V+      V   ++ + LPAK++G DA  DLA+LK++       +EF D+  +
Sbjct: 113 IVTNNHVVDGADEVKVQFKNNEKPLPAKIIGRDAETDLALLKIEGKSGLPYLEFGDSGKL 172

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALG 239
           +VGE V  IGNPF L  TV+ GIVSA  R I   P   F Q DA IN GNSGGP  +  G
Sbjct: 173 KVGEWVLAIGNPFGLENTVTLGIVSAKGRIIGAGPFDNFIQTDASINPGNSGGPLIDLDG 232

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIG+N  IV SGQ   G+G  IP ++ K  I  L    +V  GW G+  Q++ +  A  
Sbjct: 233 KVIGINTAIVASGQ---GIGFAIPSNMAKDVISQLRDGKKVQRGWLGVSIQDIDENTAKA 289

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           LGL  TKG+LI++V++  PA KAG+K GDVI  + G+ + +  D + ++A+  P E  + 
Sbjct: 290 LGLDSTKGALISSVMEGQPAAKAGIKTGDVITSVGGQKVDNANDLLRRVAAIRPGESAEF 349

Query: 360 SLCKEGSKHSVAVVLGSSPTAK-----------NDMHLEVGDKELLGMVLQDIND----- 403
            + ++GS  +V+V LG     K           +D   E      LG+ ++ +       
Sbjct: 350 VVMRKGSPVTVSVTLGERDAKKLAQSGRGQEGEDDAAGEDASASALGLSVRALAPKEAKA 409

Query: 404 -GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
            G  K   ++        E E   ++ G  I+ VN    +  ++ ++++G+   KK+  V
Sbjct: 410 IGMDKAQGVLITEVADGSEAEQADVRPGDVILEVNQRPATSPEEFKKIVGE-DGKKKGVV 468

Query: 463 LLQIK 467
           +L IK
Sbjct: 469 MLLIK 473


>gi|296532848|ref|ZP_06895517.1| HtrA/DegQ/DegS family serine protease [Roseomonas cervicalis ATCC
           49957]
 gi|296266804|gb|EFH12760.1| HtrA/DegQ/DegS family serine protease [Roseomonas cervicalis ATCC
           49957]
          Length = 516

 Score =  209 bits (532), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 143/475 (30%), Positives = 235/475 (49%), Gaps = 46/475 (9%)

Query: 42  PVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK-------FF 94
           P+  R+ PS+V++      +    +  +A      P   P +  FR  F +         
Sbjct: 51  PLARRLLPSVVNIQTSQTLQARANRP-DAPEMPQAPPGSPFEELFRDFFERNRPPGGGAR 109

Query: 95  SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
            G+ P  + +      GSGF I   G I+T+NH+++     +V+L D+T L A+L+GTD+
Sbjct: 110 PGQPPRRAQSQ-----GSGFIIDASGIIVTNNHVIDGADEINVVLQDNTTLRAELIGTDS 164

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             DLAVL+V+SD+    V F D+++  VG+ V  IGNP    G+V++GIVSA  R+I   
Sbjct: 165 RTDLAVLRVRSDKPLPVVPFGDSDSAEVGDWVLAIGNPLGFGGSVTSGIVSARGRNINAG 224

Query: 215 P-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
           P   F Q DA IN+GNSGGP FN  G VIG+N  IV+     +G+G  IP ++ K  +  
Sbjct: 225 PYDDFIQTDAAINRGNSGGPLFNVRGEVIGINTAIVSPSGGSIGIGFAIPSNLAKNIVAQ 284

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTKGSLITAVVKESPADKAGMKVGDVICM 332
           L   GRV  GW G+  Q +T E+A  LGL+ G +G+L+    ++ PA K G++ GDVI  
Sbjct: 285 LRDGGRVRRGWLGVNIQQVTDEIAESLGLQGGARGALVARAQEDGPAAKGGIQNGDVILK 344

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK- 391
            + + ++  ++    +A      +V +++ + G + ++ V +   P  +         + 
Sbjct: 345 FNNQDVREMRNLPRIVAETQVGSKVPVTVWRGGREQNLEVTVAELPVDQQQAAAGSAPQQ 404

Query: 392 -------ELLGMVLQ------------DINDGNKKLVRIVALNPNREREVEAKGIQKGMT 432
                  EL G+ L+             + D  + +V +  + PN       +GI  G  
Sbjct: 405 ARPGAVVELSGLGLKVAPISPETKERFSLRDDARGVV-VTEVAPN--SSAAERGISAGDL 461

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           IV V  + VS  ++V+  + + + + R S L+ I+        N    RFV L++
Sbjct: 462 IVEVQQNRVSNPQEVQEQLARLRRQNRPSALMLIE--------NAQGQRFVPLRL 508


>gi|182678706|ref|YP_001832852.1| protease Do [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634589|gb|ACB95363.1| protease Do [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 522

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 154/492 (31%), Positives = 233/492 (47%), Gaps = 48/492 (9%)

Query: 25  TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKN 84
           T +  +A+ P S  DL    A VS ++V++        S  Q  +    GN P+  P   
Sbjct: 49  TLVEAQARGPESLADLS---AAVSDAVVNI--------SATQTVDEKRPGNGPQLEP-GT 96

Query: 85  YFRKDFHKFFSGEEPILSDTVERLM----------FGSGFFITDDGYILTSNHIVEDGAS 134
            F   F +FF   +          +           GSGF I   G I+T+NH++ D   
Sbjct: 97  PFDDLFEEFFRRRQQRGGGGGGGAVPRPHERRSNSLGSGFVIDPAGIIITNNHVIADANE 156

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
            +VI +D  +L A+++G DA  D+AVLKV+ ++    V+F D+  +RVG+ V  +GNPF 
Sbjct: 157 VTVIFTDGQKLKAQVLGKDAKVDVAVLKVKPEKPLKAVKFGDSEVMRVGDWVIAVGNPFG 216

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           L GTV+AGIVSA +R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  I++   
Sbjct: 217 LGGTVTAGIVSARNRNIDSGPYDNYIQTDAAINKGNSGGPLFNMAGEVIGINTAILSPSG 276

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +G+G   P S++   +  L   G    GW G+  QN+   +A  L L   +G+LI  V
Sbjct: 277 GSIGIGFATPASMVVPIVEQLQKFGETRRGWLGVRIQNVDDTIAESLNLGTARGALIAGV 336

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             + PA  AG+  GDVI   DG  IK  +D    +A  +  + V + L ++G + +  V 
Sbjct: 337 DDKGPAKSAGLSAGDVIVKFDGTAIKESRDLPKLVAMAAVGKDVPVVLIRQGKEITKNVK 396

Query: 374 LGSSPTAKNDMHLEVGDKE----------LLGMVLQDINDGNKKLVRI--------VALN 415
           LG     +    L   D++          +LGM L  + D  ++   I        V  +
Sbjct: 397 LGRLEDNEKQASLNTPDRDESALGSASQRVLGMSLSALTDEARQKFAIRDTVASGVVITD 456

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
            + E     K IQ G  +V +N   V    ++ + +   KE+ + S LL +       S 
Sbjct: 457 VDPESAAAEKHIQPGELVVEINQDAVKTPAEINKKLQSLKEQGKKSALLLV-------SN 509

Query: 476 NDNMSRFVSLKI 487
                RFV+L I
Sbjct: 510 GQGEVRFVALAI 521


>gi|39995440|ref|NP_951391.1| trypsin domain/PDZ domain-containing protein [Geobacter
           sulfurreducens PCA]
 gi|39982203|gb|AAR33664.1| trypsin domain/PDZ domain protein [Geobacter sulfurreducens PCA]
 gi|307634686|gb|ADI83162.2| periplasmic trypsin-like serine protease [Geobacter sulfurreducens
           KN400]
          Length = 464

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 128/354 (36%), Positives = 189/354 (53%), Gaps = 11/354 (3%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I+D G+I+T+NH+V       V LSD  E  A+L G D   DLA++K++S  + 
Sbjct: 93  LGSGFIISDQGFIITNNHVVAGADEIKVRLSDGREFKAELKGADEKLDLALIKIESKDQL 152

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
                 +++ I+VGE V  IGNPF L  TV+AGIVSA  R I   P   F Q DA IN G
Sbjct: 153 PVAILGNSDEIKVGEWVMAIGNPFGLAQTVTAGIVSATGRVIGSGPYDDFIQTDASINPG 212

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP F+A G VIG+N  I+  GQ   G+G  IP+++ K  IP L  KG+V  GW G+ 
Sbjct: 213 NSGGPLFSAEGKVIGINTAIIAGGQ---GIGFAIPINMAKDVIPQLEEKGKVIRGWLGVT 269

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +T +LA   GL G +G+LI  VVK+ PA KAG+K GD++   DG+ I+   +    +
Sbjct: 270 VQPITPDLARSFGLEGERGALIADVVKDGPAAKAGLKSGDIVLEFDGKKIREMNELPRIV 329

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIND----- 403
           A+    +   + + ++G    V V +G      ++   + G+ + LGM ++++       
Sbjct: 330 AATPVGKAALVKVLRDGKMQDVEVSVGRLADTGDESDQKNGEDK-LGMAVRELTRDLAAR 388

Query: 404 -GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
            G K+   +V          E  GI  G  +  +    ++ + D E  I   K+
Sbjct: 389 MGLKETQGVVVTGVKSGSLAEEAGILPGDIVREIGGRSITTMADYETAIRAVKK 442



 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 50/88 (56%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  + LT++LA  +GL+ T+G ++T V   S A++AG+  GD++  + GR I +  D+
Sbjct: 374 LGMAVRELTRDLAARMGLKETQGVVVTGVKSGSLAEEAGILPGDIVREIGGRSITTMADY 433

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAV 372
              I +    + V+  L + G  H +A+
Sbjct: 434 ETAIRAVKKGDVVRFLLRRGGGNHFLAI 461


>gi|239617971|ref|YP_002941293.1| protease Do [Kosmotoga olearia TBF 19.5.1]
 gi|239506802|gb|ACR80289.1| protease Do [Kosmotoga olearia TBF 19.5.1]
          Length = 462

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 136/383 (35%), Positives = 213/383 (55%), Gaps = 21/383 (5%)

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           F  +F + F GE P      E L  GSGF    +GYILT+ H+V +     V L D ++ 
Sbjct: 57  FTDEFFRKFFGEIPFGERKAEAL--GSGFIFDKEGYILTNEHVVHNADKIMVTLLDGSKY 114

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
           PAK +G D   D+AV+K+  D K +PV E  D++ +++GE    IGNP   + TV+ G+V
Sbjct: 115 PAKYIGGDEELDIAVIKIDPDGKDLPVLEIGDSDKLQIGEWAIAIGNPLGFQHTVTVGVV 174

Query: 205 SALDRDIPDRPGT-----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVG 259
           SA+ R IP   G        Q DA IN GNSGGP  N  G VIG+N  IV S Q+   +G
Sbjct: 175 SAVGRQIPKPEGNGYYSNLIQTDAAINPGNSGGPLLNIHGQVIGINTAIV-SPQYGTTLG 233

Query: 260 LIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPA 319
             IP+++  + + S+I  G V   + G+    +T+  A  LGL+  +G+L+T V K+SPA
Sbjct: 234 FAIPINMAMRFVDSIIKTGTVQKAFLGVYVTTVTESTAKSLGLKVDEGALVTDVFKDSPA 293

Query: 320 DKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT 379
           +KAG+K  DVI  L+G  I+S  + V  + +     +V I++ + G + +  VVLG    
Sbjct: 294 EKAGIKPQDVIIKLNGLDIRSSSELVAAVHNYPAGARVTITVDRFGKRITFDVVLGYQDN 353

Query: 380 AKNDMHLEVGDKELLGMVLQDINDGNKKLVRI-VALNPNREREVEAK------GIQKGMT 432
           A  + + +  D + LG+VL ++  G+++ + I   +N    R+V+AK      GI+K   
Sbjct: 354 ASGESNAQYSDDK-LGLVLGNLLPGDRERLSIPEEINGVIVRDVKAKAYAAQLGIKKDDV 412

Query: 433 IVSVNTH----EVSCIKDVERLI 451
           I+ ++ +    E+S ++D E++I
Sbjct: 413 IIRISINGKQKEISSLEDYEKVI 435


>gi|154245605|ref|YP_001416563.1| protease Do [Xanthobacter autotrophicus Py2]
 gi|154159690|gb|ABS66906.1| protease Do [Xanthobacter autotrophicus Py2]
          Length = 498

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 198/372 (53%), Gaps = 15/372 (4%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I   G I+T+NH++ D        +D ++L A+L+G D   DLA+L+V+ D+  
Sbjct: 112 LGSGFVIDPSGLIVTNNHVIADADEIFANFNDGSKLKAELIGRDTKTDLALLRVKPDKPL 171

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
           + V+F D+  +RVG+ V  IGNPF L GT++ G+VSA +RDI   P   F Q DA IN+G
Sbjct: 172 VAVKFGDSEKLRVGDWVMAIGNPFGLGGTLTVGVVSARNRDINSGPYDNFIQTDAAINRG 231

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G VIG+N  I++     +G+G  +P +  K  I  L     V  GW G+ 
Sbjct: 232 NSGGPLFNMDGEVIGINTAIISPSGGSIGIGFAVPSATAKPVIAQLGEFKEVRRGWIGVR 291

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +T ++A  LGL   +G+LI  V + SPA + G+K GDVI   +GR IK  +D    +
Sbjct: 292 IQPVTDDIAESLGLGKPRGALIGVVSENSPAARGGIKAGDVIVKFNGRDIKEVRDLTRTV 351

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSP------TAKNDMHLE-VGDKELLGMVLQDI 401
           A      +V++ + ++G + ++ + +   P      T K     + V  K+ LG+ L  +
Sbjct: 352 ADAMADTEVEVVVVRKGKEETLHLKVARMPEDDKPETPKPAAESQKVAPKKALGIELSAM 411

Query: 402 NDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           +D  +K   I       V    +       KG++ G  IV V    V+   DVE+ +   
Sbjct: 412 SDELRKRYSIKSEINGVVITGVDASTPASDKGLKAGQVIVQVGQEAVASPSDVEKQVDAL 471

Query: 455 KEKKRDSVLLQI 466
           +++ + S LL +
Sbjct: 472 RKQGKRSALLLV 483


>gi|170288166|ref|YP_001738404.1| protease Do [Thermotoga sp. RQ2]
 gi|170175669|gb|ACB08721.1| protease Do [Thermotoga sp. RQ2]
          Length = 459

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 131/378 (34%), Positives = 215/378 (56%), Gaps = 16/378 (4%)

Query: 85  YFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
           YF + F K+F    P     V  L  GSGF    +GYILT+ H+V    + +V + D ++
Sbjct: 57  YFEQFFKKWFGELPPGFERQVASL--GSGFIFDPEGYILTNYHVVGGADNITVTMLDGSK 114

Query: 145 LPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
             A+ +G D   D+AV+K++ SD+KF  +EF D++ +++GE    IGNP   + TV+ G+
Sbjct: 115 YDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGV 174

Query: 204 VSALDRDIPDRPGT-----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           VSA +R IP   G+       Q DA IN GNSGGP  N  G VIG+N  IV   Q  + +
Sbjct: 175 VSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNP-QEAVNL 233

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  IP++ +KK + +++++ +V+  + G+    LT+E A  LGL  T G+LIT+V K SP
Sbjct: 234 GFAIPINTVKKFLDTILTQKKVEKAYLGVTVMTLTEETAKALGLESTSGALITSVQKGSP 293

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A+KAG+K GDVI  +D + ++SH++ V  I +  P +   +++ ++G    V V  GSS 
Sbjct: 294 AEKAGLKEGDVILKVDDQDVRSHEELVSIIHTYKPGDTAVLTIERKGKIMKVQVTFGSS- 352

Query: 379 TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI-VALNPNREREVEAK-GIQKG--MTIV 434
           + +          + LG+ + +I   +++   I   +N    +E   K G+QKG  +T V
Sbjct: 353 SEEEKTTTGEEKIDALGITVSNITPADRETYSIPEEINGVIVKESTGKFGLQKGDVITTV 412

Query: 435 SVN--THEVSCIKDVERL 450
            VN   ++++ + D++++
Sbjct: 413 YVNGKRYDINSVGDLKKV 430


>gi|222054294|ref|YP_002536656.1| protease Do [Geobacter sp. FRC-32]
 gi|221563583|gb|ACM19555.1| protease Do [Geobacter sp. FRC-32]
          Length = 476

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 184/327 (56%), Gaps = 15/327 (4%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           +  +V P++V++      KV    +    G  +   D PL  +F+++F +  +GE     
Sbjct: 47  IAEKVKPAVVNISTTSTVKVPANPLEQFLGPND---DSPLSEFFKRNFGE--NGER---- 97

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
             +++   GSG  I  DG ILT+NH+V++     V LSD  E  AK++G DA  DLA++K
Sbjct: 98  -EMKQQSLGSGSIINKDGLILTTNHVVDNAEEIKVKLSDGREFKAKVIGRDAKTDLALIK 156

Query: 163 VQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQ 220
           + S  + +PV    D++ +RVG+ V  +GNPF L  TV+ GI+S   R I   P   F Q
Sbjct: 157 IASPFENLPVLSLGDSDRMRVGDWVIAVGNPFGLEETVTHGIISGTARVIGSGPYDNFLQ 216

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
            DAPIN GNSGGP  N  G VIG+N +IV+ GQ   G+G  +P ++    +  L  KG+V
Sbjct: 217 TDAPINPGNSGGPLVNVTGEVIGINTIIVSGGQ---GLGFAVPSTLASSVVDQLKEKGKV 273

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             GW G+  QN++  +A   GL+  KG+LI  V+   PADK GMK GD+I   DG+ IK+
Sbjct: 274 VRGWMGVSIQNVSPPIAKAFGLKEPKGALIADVIAGGPADKGGMKSGDIITSFDGKEIKT 333

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSK 367
             D    +A  +  +++K +  ++G +
Sbjct: 334 ANDLSRVVAGTAVGKEIKGTAIRDGKE 360


>gi|15643337|ref|NP_228381.1| heat shock serine protease, periplasmic [Thermotoga maritima MSB8]
 gi|281411790|ref|YP_003345869.1| protease Do [Thermotoga naphthophila RKU-10]
 gi|4981088|gb|AAD35656.1|AE001732_1 heat shock serine protease, periplasmic [Thermotoga maritima MSB8]
 gi|281372893|gb|ADA66455.1| protease Do [Thermotoga naphthophila RKU-10]
          Length = 459

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 131/378 (34%), Positives = 215/378 (56%), Gaps = 16/378 (4%)

Query: 85  YFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
           YF + F K+F    P     V  L  GSGF    +GYILT+ H+V    + +V + D ++
Sbjct: 57  YFEQFFKKWFGELPPGFERQVASL--GSGFIFDPEGYILTNYHVVGGADNITVTMLDGSK 114

Query: 145 LPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
             A+ +G D   D+AV+K++ SD+KF  +EF D++ +++GE    IGNP   + TV+ G+
Sbjct: 115 YDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGV 174

Query: 204 VSALDRDIPDRPGT-----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           VSA +R IP   G+       Q DA IN GNSGGP  N  G VIG+N  IV   Q  + +
Sbjct: 175 VSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNP-QEAVNL 233

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  IP++ +KK + +++++ +V+  + G+    LT+E A  LGL  T G+LIT+V K SP
Sbjct: 234 GFAIPINTVKKFLDTILTQKKVEKAYLGVTVMTLTEETAKALGLESTSGALITSVQKGSP 293

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A+KAG+K GDVI  +D + ++SH++ V  I +  P +   +++ ++G    V V  GSS 
Sbjct: 294 AEKAGLKEGDVILKVDDQDVRSHEELVSIIHTYKPGDTAVLTIERKGKIMKVQVTFGSS- 352

Query: 379 TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI-VALNPNREREVEAK-GIQKG--MTIV 434
           + +          + LG+ + +I   +++   I   +N    +E   K G+QKG  +T V
Sbjct: 353 SEEEKTTTGEEKIDALGITVSNITPADRETYSIPEEINGVIVKESTGKFGLQKGDVITTV 412

Query: 435 SVN--THEVSCIKDVERL 450
            VN   ++++ + D++++
Sbjct: 413 YVNGKRYDINSVGDLKKV 430


>gi|71907529|ref|YP_285116.1| peptidase S1C, Do [Dechloromonas aromatica RCB]
 gi|71847150|gb|AAZ46646.1| Peptidase S1C, Do [Dechloromonas aromatica RCB]
          Length = 489

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 143/446 (32%), Positives = 225/446 (50%), Gaps = 48/446 (10%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D+  ++A  + ++V++ V   +K       N  G   L  D PL  +FR+     F G+ 
Sbjct: 60  DMRSIVANNAQAVVNISVTGTRKTGA----NLPGMPQLDPDDPLYQFFRR-----FGGQM 110

Query: 99  PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
           P   D       GSGF +T DG +LT+ H+V+     +V L+D  E  AK++G D   D+
Sbjct: 111 P--QDNEPTHGLGSGFIVTPDGTVLTNAHVVDGAEEVTVKLNDKREFKAKVLGLDKASDV 168

Query: 159 AVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           AVL++  D K +P V+   +    VGE V  IG+PF    + SAGIVSA  R++PD  G+
Sbjct: 169 AVLRI--DAKNLPTVKIGSSTQTAVGEWVLAIGSPFGFESSASAGIVSAKSRNLPD--GS 224

Query: 218 ---FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   IP+ +       +
Sbjct: 225 YVPFIQTDVAVNPGNSGGPLFNMNGEVIGINSQIYSRSGGYQGLSFAIPIEVAMNVEKQI 284

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           ++ G+V  G  G+  Q + Q LA   GL    G+L+ AV K SPA KAG++ GDVI  +D
Sbjct: 285 VTHGKVQRGKLGVTIQEVNQSLADSFGLPKPAGALVAAVEKGSPAAKAGLEPGDVILGID 344

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL 394
           G+ +++  +    IA++ P E  ++ + ++G   ++ V +GS            GD+++ 
Sbjct: 345 GKTVETPGELPAAIATKLPGESARLQIWRKGGTQNIDVKVGS-----------FGDEKVA 393

Query: 395 GMVLQDINDGNKKLVRIVALNPNREREVEAK---------------GIQKGMTIVSVNTH 439
               Q    G +  V +  L P   R+ E K               GI+ G  IVSVN  
Sbjct: 394 ANDTQPATKG-RLGVAVRPLTPEERRQAEIKGGVLVEQADGAAGRAGIRPGDIIVSVNGQ 452

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQ 465
            +  ++ +  LI  AK  K+ ++L++
Sbjct: 453 PIGDVEQLRSLI--AKSGKKAAILIE 476


>gi|157373883|ref|YP_001472483.1| 2-alkenal reductase [Shewanella sediminis HAW-EB3]
 gi|157316257|gb|ABV35355.1| 2-alkenal reductase [Shewanella sediminis HAW-EB3]
          Length = 450

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 159/475 (33%), Positives = 246/475 (51%), Gaps = 49/475 (10%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           K  +LS  +I T +LT +   S   +  A    S   L P++ R +P++V+V V     V
Sbjct: 4   KLSLLSA-AILTASLTMMPAISQAAIPMAVDGQSVPSLAPMLERTTPAVVAVAVS-GTHV 61

Query: 63  SVEQMFNA--YGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TD 118
           S +++ +A  Y FG N P++   +  FR                       GSG  I  +
Sbjct: 62  SKKKIPDAFRYFFGPNAPQEQVQERPFRG---------------------LGSGVIIDAN 100

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
            GYI+T+NH+++      + L D  E+ AKL+GTDA  D+A+L++++ +  + V+  D++
Sbjct: 101 KGYIVTNNHVIDGADEILIGLHDGREVEAKLIGTDAESDIALLQIKA-KNLVAVKRADSD 159

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFN 236
            +RVG+    IGNPF L  TV++GIVSA+ R     +    F Q DA IN GNSGG   N
Sbjct: 160 ELRVGDFAVAIGNPFGLGQTVTSGIVSAMGRSGLGIEMLENFIQTDAAINSGNSGGALVN 219

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G +IG+N  IV  G  ++G+G  IP +++   +  +I  G V  G  G+  ++LT EL
Sbjct: 220 LNGDLIGINTAIVAPGGGNVGIGFAIPANMVNNLVDQIIEHGEVRRGVLGVSGRDLTSEL 279

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL    G  +  V+ +S ADKAG+K GD+I  ++GR IKS Q+   ++A+     +
Sbjct: 280 AQGFGLDTQHGGFVDQVMTDSAADKAGIKAGDIITSVNGRKIKSFQELRAKVATMGAGAK 339

Query: 357 VKISLCKEGSKHSVAVVLGSSP----TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIV 412
           V+  L ++G + SV  VLG +      A   +H       L G  L++ +DG    V I 
Sbjct: 340 VEFGLIRDGDEESVTAVLGEASKTIEAAAGAVH-----PMLAGATLENSDDG----VEIT 390

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            +  N      A G+QKG  IV VN    S I D++ L    K+++  +V L+IK
Sbjct: 391 DIAQN--SPAAASGLQKGDVIVGVNR---SSIDDLKSLKATLKDQQ-GAVALKIK 439


>gi|254470181|ref|ZP_05083585.1| protease DO [Pseudovibrio sp. JE062]
 gi|211960492|gb|EEA95688.1| protease DO [Pseudovibrio sp. JE062]
          Length = 494

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 141/419 (33%), Positives = 212/419 (50%), Gaps = 37/419 (8%)

Query: 95  SGEEPILSDTVERLMFGSGFFIT-DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
           +G+EP           GSGF I  D+G I+T+NH++E     +V  +D T+L A+L+G+D
Sbjct: 89  NGQEPEGESPQRVQSLGSGFVIDGDEGIIVTNNHVIEGADEITVNFNDGTKLSAELLGSD 148

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              DLAVLKV+       V+F  +  +RVG+ V  IGNPF L GTV+AGIVSA +RDI  
Sbjct: 149 EKTDLAVLKVEPQSTLDSVKFGSSEVLRVGDWVMAIGNPFGLGGTVTAGIVSARNRDINS 208

Query: 214 RP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
            P   F Q DA IN+GNSGGP FN  G V+G+N +I +     +G+G  IP     + I 
Sbjct: 209 GPYDNFIQTDAAINRGNSGGPLFNMDGEVVGINTVIFSPSGGSIGIGFAIPAETATRVIA 268

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L   G    GW G+  Q++T E+A  LG+   +G+LI  V ++ PA +AG+  GDV+  
Sbjct: 269 QLREFGETRRGWLGVRIQHVTDEIAESLGMDNAQGALIAGVSEDGPAKEAGIMPGDVVLT 328

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG---------------SS 377
            DGR +   +D    +A+ +    V +++ + G +  + V LG                S
Sbjct: 329 FDGREVPEMRDLPRMVATTTIGSTVPLTVLRRGEEVEIEVTLGRLDEVAEVEQVEEEQES 388

Query: 378 PTAKNDMHLEVGDKELLGMVLQDINDG-------NKKLVRIVALNPNREREVEAKGIQKG 430
           P  K D  +      +LG+ L  I++        + ++  +V          E K ++ G
Sbjct: 389 PKDKADETV------VLGLSLAKIDEPLRERFALSDEIEGVVITRVAEGSSAEDKRVRAG 442

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IV V    V+  KDV  ++   K  KR S LL       + S      RFV+++I++
Sbjct: 443 DVIVEVAQEPVASPKDVVDMVEALKADKRRSALL-------LLSNGAGELRFVAVRIEE 494


>gi|126175849|ref|YP_001051998.1| protease Do [Shewanella baltica OS155]
 gi|125999054|gb|ABN63129.1| peptidase Do. Serine peptidase. MEROPS family S01B [Shewanella
           baltica OS155]
          Length = 450

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 152/477 (31%), Positives = 246/477 (51%), Gaps = 53/477 (11%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPP-----SSVDLPPVIARVSPSIVSVMVEPK--KKVS 63
           S+ + A+     +   +V +A +P      S   L P++ R +P++VSV V      K  
Sbjct: 6   SVLSAAMLAATLTMMPVVSQAAIPQTVEGQSIPSLAPMLERTTPAVVSVAVTGTHVSKQR 65

Query: 64  VEQMFNAYGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGY 121
           V  +F  Y FG N P++   +  FR                       GSG  I  + GY
Sbjct: 66  VPDVFR-YFFGPNAPQEQVQERPFRG---------------------LGSGVIIDAEKGY 103

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+++      V L D  E+ AKL+GTD+  D+A+L++++ +  + ++  +++++R
Sbjct: 104 IVTNNHVIDGADDIQVGLHDGREVKAKLIGTDSESDIALLQIEA-KNLVAIKSSNSDDLR 162

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALG 239
           VG+    IGNPF L  TV++GIVSAL R     +    F Q DA IN GNSGG   N  G
Sbjct: 163 VGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLNG 222

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            +IG+N  IV  G  ++G+G  IP +++K  +  +   G V  G  GI  ++L  +LA  
Sbjct: 223 ELIGINTAIVAPGGGNVGIGFAIPANMVKNLVAQIAEHGEVRRGVLGISGRDLDSQLAQG 282

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL    G  +  V K+S A+KAG+K GD+I  +DGR IKS Q+   ++A+     +V++
Sbjct: 283 FGLDTQHGGFVNEVAKDSAAEKAGIKAGDIIISVDGRGIKSFQELRAKVATMGAGAKVEL 342

Query: 360 SLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALN 415
            L ++G K +V V LG    +S +A   +H       L G  L++ + G  ++  +   +
Sbjct: 343 GLIRDGDKKTVKVTLGEASQTSESAAGAVH-----PMLQGASLENTSKG-IEITDVAQGS 396

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
           P         G+QKG  IV +N    + IKD++ L  + K+++  +V L+I  D  M
Sbjct: 397 P-----AAMSGLQKGDVIVGINR---TAIKDLKALKAQLKDQE-GAVALKIMRDKSM 444


>gi|107100227|ref|ZP_01364145.1| hypothetical protein PaerPA_01001250 [Pseudomonas aeruginosa PACS2]
          Length = 464

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 128/366 (34%), Positives = 203/366 (55%), Gaps = 15/366 (4%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           +  ++  S  +   A+LP    D  P++ + SP++V++    ++K+    M  A G  ++
Sbjct: 1   MVALLALSLAMTARAELP----DFTPLVEQASPAVVNIST--RQKLPDRAM--ARGQLSI 52

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVEDGAS 134
           P+   L   FR DF +    + P      +R     GSGF I++DGYILT+NH+V D   
Sbjct: 53  PDLEGLPPMFR-DFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVADADE 111

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPF 193
             V LSD +E  AKLVG D   D+AVLK+++  K +P ++  D+N ++VGE V  IG+PF
Sbjct: 112 ILVRLSDRSEHKAKLVGADPRSDVAVLKIEA--KNLPTLKLGDSNKLKVGEWVLAIGSPF 169

Query: 194 RLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
               +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T  
Sbjct: 170 GFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQIFTRS 229

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+  
Sbjct: 230 GGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALVAQ 289

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+++
Sbjct: 290 LVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSLSM 349

Query: 373 VLGSSP 378
            +GS P
Sbjct: 350 AVGSLP 355


>gi|212703199|ref|ZP_03311327.1| hypothetical protein DESPIG_01241 [Desulfovibrio piger ATCC 29098]
 gi|212673465|gb|EEB33948.1| hypothetical protein DESPIG_01241 [Desulfovibrio piger ATCC 29098]
          Length = 480

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 149/479 (31%), Positives = 241/479 (50%), Gaps = 35/479 (7%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV-- 64
           + +K      LT V+F++      A LP    +   + A+  P++V++  E     +   
Sbjct: 1   MRIKHFLPAVLTLVLFTAAQFAQAASLP----EFSELAAKCGPAVVNISAERTSPAAAGP 56

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMF-GSGFFITDDGYIL 123
           E+ F    F  +P            F +FF G         ++ M  GSGF I+ DGYI+
Sbjct: 57  EEFFGEM-FRGMPPGA-------DRFFEFFGGPNARGKRPPQKQMSRGSGFIISPDGYIV 108

Query: 124 TSNHIVEDGASFSVILSDD----TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           T+ H+V DG S  V L +       L A +VGTD   DLA+LKV + +    ++F D++ 
Sbjct: 109 TNYHVVADGDSIQVTLDESNGKTAPLTATVVGTDEDTDLALLKVDAKKDLPFLKFGDSDA 168

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
           + VGE +  IGNPF L  TV+AGI+SA +R+I   P   F Q DA IN GNSGGP  N  
Sbjct: 169 LLVGEWLLAIGNPFALDHTVTAGILSAKNRNIHAGPFDNFLQTDASINPGNSGGPLLNMK 228

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I+ SGQ   G+G  IP ++    +  +    +V  GW G+  Q++ +  A 
Sbjct: 229 GEVIGINTAIIASGQ---GIGFAIPSNMAAGIVEQIKGGKKVSRGWIGVTIQDVDENTAK 285

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LG+    G+L+ +V+   PA KAG++ GDVI  ++G+ ++     +  IA+  P   V 
Sbjct: 286 ALGMEHPSGALVASVLDGEPAAKAGIEAGDVITKVNGKSVEDASALLRAIAAHKPGTSVT 345

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMH-LEVGDKE----LLGMVLQDINDGNKKLVR--- 410
           + + + G    + V LG   +  N+    E G K+     LG+ ++ I D  ++ ++   
Sbjct: 346 LVVWRNGKAVDLDVTLGDRQSGVNNGKPSEAGQKQQNQGQLGLTVRPIKDEERRELKLEG 405

Query: 411 ---IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
              ++ L+ +  +     G++ G  IV  N   VS  +D+ +++   +  KR +V+LQI
Sbjct: 406 KGGLLVLDVDPSKPAAEAGVRPGDVIVKANRQAVSSPEDLSKIV-AGEGSKRGAVMLQI 463


>gi|315634007|ref|ZP_07889296.1| protease do [Aggregatibacter segnis ATCC 33393]
 gi|315477257|gb|EFU68000.1| protease do [Aggregatibacter segnis ATCC 33393]
          Length = 461

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 140/466 (30%), Positives = 237/466 (50%), Gaps = 42/466 (9%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA 70
           SI T  +     +   +V   +LP     L P++ +V PS+VS+ VE K+K S  +M + 
Sbjct: 16  SILTTPMMSQAETPVSIVAGQQLP----SLAPMLEKVLPSVVSISVEGKQKGSSAEMDD- 70

Query: 71  YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFI-TDDGYILTSNH 127
               ++PE+            KFF G +    +   R     GSG  I  + GY+LT+NH
Sbjct: 71  ----DIPEEF-----------KFFFGPDMFDRNRAPRNFKGIGSGAIINAEKGYVLTNNH 115

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
           +++D    +V L D  E  AK++G D + D+A+++V++ +    ++  D++ +RVG+   
Sbjct: 116 VIKDADKITVQLHDGREFKAKVIGADEMSDVALIQVENPKNLTALKLADSDKLRVGDFTV 175

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIGV 244
            IGNPF L  TV++GIVSAL R +    GT+    Q DA +N+GNSGGP  N  G +IG+
Sbjct: 176 AIGNPFGLGQTVTSGIVSALGRSMGSDSGTYENYIQTDAAVNRGNSGGPLVNLNGELIGI 235

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I++    + G+   IP ++    +  ++  G V  G  GI    L  +LA    +  
Sbjct: 236 NTAIISPSGGNAGIAFAIPSNMANNLVQQILEFGEVRRGMLGIKGGELNADLAQAFDIEA 295

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
            KG+ ++ V+  S ADKAG+K GDVI  ++G+ I S  +   +IA+    +Q++++  ++
Sbjct: 296 KKGAFVSEVMPGSAADKAGLKAGDVITAMNGQAISSFAEMRAKIATSGAGKQIELTYLRD 355

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGDKELL----GMVLQDINDGNKKLVRIVALNPNRER 420
           G  ++  V L      ++D   +     LL    G  L + ++   K V I  + PN   
Sbjct: 356 GKSNTAKVTL------QSDEQTQTTANSLLPALDGAELNNYDEKGMKGVSIGKIKPN--S 407

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
             E +G++ G  I+ +N  +V  +  +     KA + K  ++ L I
Sbjct: 408 LAEQRGLKNGDVIIGINRQKVENLGQLR----KALDSKPSAIALNI 449


>gi|88658017|ref|YP_507837.1| serine protease [Ehrlichia chaffeensis str. Arkansas]
 gi|88599474|gb|ABD44943.1| serine protease, DO/DeqQ family [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 471

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 140/402 (34%), Positives = 220/402 (54%), Gaps = 33/402 (8%)

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           E L  GSGF + + G I+T+ H+V +     V  SD+  +PAK++G D   DLAVLKV+ 
Sbjct: 85  EVLSAGSGFVVDESGIIVTNYHVVHNAKEVYVTFSDNKSIPAKILGVDPQTDLAVLKVEV 144

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAP 224
           + K   +EF D++   VG+ V  IGNPF L G+ S GI+SA  RD+     T F Q DA 
Sbjct: 145 NEKLPYLEFGDSDKTMVGDWVVAIGNPFGLGGSASIGIISARARDLNIGTATEFLQTDAA 204

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTS--GQFHMGVGLIIP----LSIIKKAIPSLISKG 278
           IN+GNSGGP FN  G VIG+N  I+++  G  ++GVG  IP    +SIIK     ++S+G
Sbjct: 205 INKGNSGGPLFNIDGKVIGINTAILSTQKGGGNIGVGFAIPSNNAVSIIK-----VLSQG 259

Query: 279 -RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
            +V+HGW G++ Q +T+EL  PL L+   G+LIT VVK SPA KA +  GD+I   +G  
Sbjct: 260 KKVEHGWLGVVMQPITEELVEPLQLKEVGGALITNVVKGSPASKANLLPGDIILEFNGTK 319

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG---SSPTAKNDMHLEVGDKELL 394
           I S       +       +VK+ + + GS  S+ V +G   +   ++N M  +      L
Sbjct: 320 INSISQLHQLVLRSEADNEVKLLVSRNGSIISILVKIGKFENPDISENGMPKDAIQSPEL 379

Query: 395 GMVLQDINDGN-------KKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
           G+ +  +   N       ++   +V L+ +       + I+KG  I+ +N   V+ ++D 
Sbjct: 380 GLTVGSVQRNNIYNNIEEEEAKGVVILDIDSTSNASTRNIRKGDIILQINQSPVNNLEDF 439

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           + ++ K ++ K  ++L+            DN+S FV++K+ +
Sbjct: 440 KNVMKKVRKNKSVALLIS----------RDNISAFVTVKLKQ 471


>gi|284097697|ref|ZP_06385713.1| protease Do [Candidatus Poribacteria sp. WGA-A3]
 gi|283830789|gb|EFC34883.1| protease Do [Candidatus Poribacteria sp. WGA-A3]
          Length = 513

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 206/376 (54%), Gaps = 23/376 (6%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSG  +  DGYI+T+NH+V +G    V+L D  +  AKL+GTD   DLA++K+++    
Sbjct: 140 MGSGVIVNPDGYIVTNNHVVAEGDEIQVVLGDQRKFEAKLIGTDPKTDLAIVKIEASG-- 197

Query: 170 IP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR------DIPDRPGTFTQID 222
           +P + + D++ + VGE V  +GNPF L  TV+ GI+SA+ R      D  D    F Q D
Sbjct: 198 LPFLSWGDSSTLEVGEMVVAVGNPFGLNQTVTMGIISAVGRAGVGLADYED----FIQTD 253

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
           A IN GNSGG   N  G +IG+N  I T    +MG+G  IP  + K    SL + G+V  
Sbjct: 254 AAINPGNSGGALVNLRGELIGINTAIFTRSGGYMGIGFAIPSDMAKGVARSLEAHGKVVR 313

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           GW G+  Q+LT +LA       TKG+L+T VV+ SPA+ A  + GD+I   DGR++++  
Sbjct: 314 GWLGVSIQDLTPDLAKQFEAADTKGALVTDVVEGSPAEDARFRRGDIIREFDGRLVENST 373

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP--TAKNDMHLEVGDKELL-GMVLQ 399
                +A   P+ +V + + +EG K  + VV+G  P   A       VG + +L GM ++
Sbjct: 374 KLRTYVAETPPETKVDVRILREGKKKRLTVVIGQMPKDMAGPGDAGTVGVRHVLSGMTVE 433

Query: 400 DINDG---NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
            +  G   + + VR++ + P  +   +  GI+K   I+ +N   +  + D +R+ G  +E
Sbjct: 434 SVASGSASDDRGVRVLKVEP--DSRADRAGIRKDDVILEINRMTIKDVDDFDRVTGWLEE 491

Query: 457 KKRDSVLLQIKYDPDM 472
              DSVL+ ++    M
Sbjct: 492 D--DSVLVLLRRGRSM 505


>gi|254563146|ref|YP_003070241.1| Serine protease DO-like [Methylobacterium extorquens DM4]
 gi|254270424|emb|CAX26424.1| Serine protease DO-like [Methylobacterium extorquens DM4]
          Length = 496

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 156/479 (32%), Positives = 241/479 (50%), Gaps = 27/479 (5%)

Query: 22  FSSTYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
            +  Y     K P  + D PP     V+ +V P +V+V V  K   S +   ++ G  N+
Sbjct: 32  MTPAYAQALPKTPIEAPDQPPGSFANVVDKVKPGVVAVKV--KLDDSADDDDDSPGGPNM 89

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
            +  P      ++F K F    P       R   GSGF I+ DGY++T+NH+V+   +  
Sbjct: 90  QQVPPQ----LREFFKRFGQGGPGGRGMRPRGGVGSGFIISADGYVVTNNHVVDKAKTVQ 145

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V L D   L AK++G D+  D+A+LK+     +  V+F      RVG+ V  IGNPF L 
Sbjct: 146 VTLDDGRTLDAKVIGKDSKTDIALLKITESGSYPYVQFGKGAP-RVGDWVLAIGNPFGLG 204

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV+ GIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+GVN  I +     
Sbjct: 205 GTVTVGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGVNTAIASPSGGS 264

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  IP   ++  +  L + G+V  G+ G+  Q +T+++A  LGL   KG+L+     
Sbjct: 265 VGLGFAIPAETVQTVVDQLRTDGKVVRGYLGVQVQPVTKDIAEGLGLDKAKGALVNDAES 324

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
            +PA KAG+K GDVI  ++G  + + +D    IA   P  +VK++  + G      V LG
Sbjct: 325 GTPAAKAGLKSGDVIESVNGVPVNNARDLSRLIAGLKPGTEVKLTYLRGGKSEVATVELG 384

Query: 376 SSP-----TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
           + P     T + D     G +  LG+ L   ++       +  ++ + +    A+GI +G
Sbjct: 385 TLPGDSKVTRRGDDAP--GGQARLGLSLAPASEIGLGDEGVAVMDVDPDGPAAARGISQG 442

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             I+ V    VS   +V+  I  A+   R +VL+++K            +RF+++ + K
Sbjct: 443 DVILDVAGTSVSKPSEVQAQIRAAESSGRKAVLMRVKS-------ARGQTRFIAVPLTK 494


>gi|329943124|ref|ZP_08291898.1| protease Do family protein [Chlamydophila psittaci Cal10]
 gi|332287707|ref|YP_004422608.1| serine protease [Chlamydophila psittaci 6BC]
 gi|313848281|emb|CBY17282.1| putative heat shock-related exported protease [Chlamydophila
           psittaci RD1]
 gi|325507352|gb|ADZ18990.1| serine protease [Chlamydophila psittaci 6BC]
 gi|328814671|gb|EGF84661.1| protease Do family protein [Chlamydophila psittaci Cal10]
          Length = 488

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 159/463 (34%), Positives = 242/463 (52%), Gaps = 50/463 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-----E 97
           V  + +P +V +   PK    V  +    G    P D+P  +YF  +F   F G     E
Sbjct: 54  VAEQATPGVVYIESFPKCNRPVHPVPGRRG----PYDNPF-DYFNDEFFNRFFGLPTQKE 108

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
            P+  + V     G+GF ++ DGY++T+NH+VED     V L D  + PAK++G D   D
Sbjct: 109 RPMSKEAVR----GTGFIVSPDGYVVTNNHVVEDAGKIHVTLHDGQKYPAKVIGLDPKTD 164

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD---IPDR 214
           LAV+K+ ++ K   + F +++N++VG+    IGNPF L+ TV+ G++SA  R+   I D 
Sbjct: 165 LAVIKINAN-KLPHLTFGNSDNLKVGDWAIAIGNPFGLQATVTVGVISAKGRNQLHIADF 223

Query: 215 PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q DA IN GNSGGP  N  G VIGVN  IV+    ++G+G  IP  + KK I  L
Sbjct: 224 E-DFIQTDAAINPGNSGGPLLNIDGKVIGVNTAIVSGSGGYIGIGFAIPSLMAKKIIDQL 282

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           IS G+V  G+ G+  Q +  ELA    L    G+LIT VVK SPADKAG+K  DVI   +
Sbjct: 283 ISDGQVIRGFLGVTLQPIDAELAACYKLDKVYGALITDVVKGSPADKAGLKQEDVIIAYN 342

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL 394
           GR ++S   F   I+  +P  +V + + +EG    + V++  +P         V     +
Sbjct: 343 GREVESLSAFRNAISLMNPDTRVLLKVVREGQVLEIPVIVSQAPQDDG-----VSALNRV 397

Query: 395 GMVLQDIN-DGNKKLVRIVALNPNRER----EVEA------KGIQKGMTIVSVNTHEVSC 443
           G+ +Q++N +  KKL     + P+ +      VEA       GI  G  I++VN  +VS 
Sbjct: 398 GIRVQNLNPETAKKL----GMTPDSKGVLIISVEAGSVASSSGIAPGQLILAVNRQKVSS 453

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           ++++  ++   K+   +S+LL +            + RFV LK
Sbjct: 454 VEELNTVL---KDGNNESILLMVS--------QGEVIRFVVLK 485


>gi|90021892|ref|YP_527719.1| ATPase [Saccharophagus degradans 2-40]
 gi|89951492|gb|ABD81507.1| Peptidase S1C, Do [Saccharophagus degradans 2-40]
          Length = 464

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 151/459 (32%), Positives = 234/459 (50%), Gaps = 40/459 (8%)

Query: 28  VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFR 87
           V  A LP    D   +I R SP++V +               A G   LP+   +  +F+
Sbjct: 19  VANANLP----DFSDLIERSSPAVVKINTSANV---------AQGRLQLPQGQQVPEWFK 65

Query: 88  KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
              H    G + I  +   + M GSGFFI+ DGY++T++H++++    +V L D  E PA
Sbjct: 66  ---HFLDPGRQGIRPNQRVQSM-GSGFFISADGYVITNHHVIDNADEITVELVDRREYPA 121

Query: 148 KLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
            +VG D   DLA+LK+  D   +P ++  + + ++VGE V  IG+PF L+ + SAGIVSA
Sbjct: 122 TVVGVDPRSDLALLKIDEDN--LPFLKVAEGSPLKVGEWVVAIGSPFGLKFSASAGIVSA 179

Query: 207 LDRDIPDRPGT----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           + R I ++ G     F Q D  IN GNSGGP FN  G V+GVN+ I +     +G+   I
Sbjct: 180 IGRSIRNQSGEDYVPFVQTDVAINPGNSGGPLFNLKGEVVGVNSQIYSQSGGSIGLSFAI 239

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P S++   +  L  KG V  GW G++ Q +  +LA   GL   +G+L++ V+++SPA+K 
Sbjct: 240 PSSVVNNVVKQLKEKGTVSRGWLGVVIQEVDGDLAASFGLDRPRGALVSEVLEDSPAEKG 299

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN 382
           G++ GDVI   DG  I +  D    + +  P+ +V + + ++G    + V +G+ P A  
Sbjct: 300 GLQPGDVIVSFDGGEILTSSDLPHLVGATQPESKVDVEVVRKGKTKKLKVEVGALPGADA 359

Query: 383 DMHLEVGDKELLGMVLQ-DINDGNKKL---------VRIVALNPNREREVEAKGIQKGMT 432
              L  G     G VL   + D  K L         V + A+ PN        GI+ G  
Sbjct: 360 VATLGGGPGAAKGGVLGVQVTDAPKDLLEQLKLDGGVLVQAVAPN--SPASNAGIKAGDV 417

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           I  VN  EV  +K ++++   AKE  +   LL I++  D
Sbjct: 418 ISEVNFIEVKSVKSLQKV---AKELPKGK-LLPIRFFSD 452


>gi|256820918|ref|YP_003142197.1| protease Do [Capnocytophaga ochracea DSM 7271]
 gi|256582501|gb|ACU93636.1| protease Do [Capnocytophaga ochracea DSM 7271]
          Length = 471

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/304 (37%), Positives = 177/304 (58%), Gaps = 13/304 (4%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSG  IT DGYI+T+NH++ +  +  V L+++    AKL+GTDA  D+A+LK+++D K  
Sbjct: 108 GSGVIITPDGYIVTNNHVIANATTLEVTLNNNKTYTAKLIGTDASSDIALLKIEADEKLP 167

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG----TFTQIDAPIN 226
            + F D++N +VGE V  +GNPF L  TV+AGI+SA  R+I +R      +F Q DA +N
Sbjct: 168 FLTFADSDNTQVGEWVLAVGNPFNLNSTVTAGIISAKARNISERGSDKIESFIQTDAVVN 227

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGG   N  G +IGVN  I ++   +MG    +P +I KK +  LI  G V  G  G
Sbjct: 228 MGNSGGALVNLNGDLIGVNTAISSTTGVYMGYSFAVPSNIAKKVVEDLIEYGNVQRGVMG 287

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q L  E+A  L ++ T+G  + +V  ES A  AG+K GD+I  +D   I  + D   
Sbjct: 288 VRGQGLDSEVAKKLNIKETEGFYVDSVDDESGAGSAGLKKGDIIKQIDNVKIHKYSDLSG 347

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNK 406
            IAS+ P + +K++  +EG + +  + L      KN  ++     + LG+ +++++D ++
Sbjct: 348 HIASKRPGDMLKVTYVREGKERTANITL-----KKNTTYV----IQSLGLEVKNLSDADQ 398

Query: 407 KLVR 410
           K  R
Sbjct: 399 KRFR 402


>gi|296114530|ref|ZP_06833183.1| protease Do [Gluconacetobacter hansenii ATCC 23769]
 gi|295978886|gb|EFG85611.1| protease Do [Gluconacetobacter hansenii ATCC 23769]
          Length = 530

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 151/469 (32%), Positives = 232/469 (49%), Gaps = 44/469 (9%)

Query: 32  KLPPSSVDLPP----VIARVSPSIVSV----MVEPKKKVSVEQMF-NAYGFGNLPEDHPL 82
           +LP    D P     + AR+ P++V+V    MV P  +        ++    N PE  P 
Sbjct: 53  RLPAPGHDTPDSFADLAARLLPAVVNVSTTEMVRPGDEDDDGDEGDSSPQIPNFPEGSP- 111

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
              F K FH F + +    +   +    GSGF I   G ++T+NH+V +    +V L D+
Sbjct: 112 ---FEKFFHDFMNRQSTPNAPPRKMQALGSGFIIDPAGIVVTNNHVVRNAEQITVTLQDN 168

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
           T L A L+G D   DLAVLKV S +    V F D+++ RVG+ V  IGNPF L GTV+AG
Sbjct: 169 TVLKAHLLGHDDRTDLAVLKVDSPKPLPAVPFGDSDHARVGDWVLAIGNPFGLSGTVTAG 228

Query: 203 IVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLI 261
           I+S+  R+I   P   F Q DAPIN+GNSGGP FN  G VIG+N  I +     +G+G  
Sbjct: 229 IISSRGRNIEQGPYDDFIQTDAPINKGNSGGPLFNLHGDVIGINTAIFSPSGGSIGIGFA 288

Query: 262 IPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADK 321
           IP +  +  I  L   G+V  GW G+  Q++TQ++A  LGL+   G+LI  V  + PA  
Sbjct: 289 IPSAEAQGIIAQLRQHGKVSRGWIGVRIQDVTQDIADGLGLKSAHGALIAGVEAKGPAAV 348

Query: 322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV-KISLCKEGSKHSVAVVLGSSPTA 380
           A ++ GDVI  LDG+ I      + ++ ++ P   V  + + +     +VA+ +G+ P  
Sbjct: 349 AHLQTGDVIVTLDGKDIDGRA--LPRLVAQLPAGSVAHLGIVRHDHPMNVAITIGALPEE 406

Query: 381 KND--------------------MHLEVGDKELLGMVLQDINDGNKKLV--RIVALNPNR 418
           K D                    +   VG  + +     ++ +G K +V   +   +P  
Sbjct: 407 KTDKADGKPAQKTPASGSVAVAGLGFTVGAIDDIARQKYNMPEGQKGVVVTGVTDDSPAA 466

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
           ER     G++ G  I  V    V+   +++  I   + +KR +VL  ++
Sbjct: 467 ER-----GLRNGDIITEVQQTAVNTPAELKHQIDLVRAQKRRTVLFLVQ 510


>gi|190571439|ref|YP_001975797.1| protease DO [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|213018838|ref|ZP_03334646.1| protease DO [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|190357711|emb|CAQ55160.1| protease DO [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|212995789|gb|EEB56429.1| protease DO [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 487

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 173/291 (59%), Gaps = 6/291 (2%)

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
           F +FF     I     E  + GSGF I   G I+T+ H++++    +V ++D+T   A++
Sbjct: 89  FDQFFDRAPSI---NREVTLLGSGFIIDKSGTIVTNYHVIKNAQDITVTMNDNTYFKAEV 145

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           +G DA  DLAVLK+ SD+    VEF +++  RVG+ V  IGNPF L G+VS GIVSA  R
Sbjct: 146 LGYDAKTDLAVLKINSDKDLPFVEFGNSDKARVGDTVIAIGNPFGLGGSVSTGIVSARSR 205

Query: 210 DIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF--HMGVGLIIPLSI 266
           DI       F Q DA IN+GNSGGP F+  G VIG+N  I +  +   ++G+G  IP ++
Sbjct: 206 DISIGTMNEFIQTDAAINRGNSGGPLFHLNGKVIGINTAIYSPSESGGNVGIGFAIPSNL 265

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
               I +L S  ++ HGW G+  Q +T+E A  LGL+  KG+L+ +VVK SPA+K G+KV
Sbjct: 266 AISIIDTLKSGKKIKHGWLGVQVQPITKEFAESLGLKDIKGALVASVVKGSPAEKGGIKV 325

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           GD++   DG+ I         ++   P ++V++ L ++G + ++ V +  S
Sbjct: 326 GDILLEFDGKKIDRMTQLPHMVSRTEPGKKVQVKLLRKGKEVNIKVAIEES 376


>gi|239832272|ref|ZP_04680601.1| protease Do [Ochrobactrum intermedium LMG 3301]
 gi|239824539|gb|EEQ96107.1| protease Do [Ochrobactrum intermedium LMG 3301]
          Length = 520

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 163/528 (30%), Positives = 251/528 (47%), Gaps = 74/528 (14%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +    T           S+  PP IA   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMTVGGTL----------SMGTPPAIAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + YF KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KGDGEGDGAVPMPQVPEGSPFQEYF-KDFFGDNGGAQGDESRKVQSL--GSGFVIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           +I+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V+F ++  
Sbjct: 122 FIVTNNHVIADADEIEVNFNDGSKLKAELVGKDIKTDLAILKVDPSKHKLKAVQFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDME 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T ++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAVGVIDQLKEFGEVRRGWLGVRIQPVTDDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+  KG+L+  +++ S  D   ++ GDV+   +G+ + + +D    +A     ++V+
Sbjct: 302 SLGLKEAKGALVAGLIENSGVDNKAIEAGDVVIRYEGKPVNTARDLPRLVAETPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLG-------SSPTAKNDM----HLEVGDK---------------- 391
           I + ++G + +V V LG       S+  A  D       E GD+                
Sbjct: 362 IVVVRQGEEKTVKVKLGRLVEDDKSTEAATEDQAPLPEGEGGDEGKQMPDTPKKDQKSDA 421

Query: 392 --ELLGMVLQDINDGNK---------KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
              +LGM L +++D  +         + V ++ ++P        K I+ G  IV +    
Sbjct: 422 APSVLGMKLSELSDEVRGEFGIAEDVEGVAVLYVSPG--SAAGEKRIETGDVIVDIGQVT 479

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           V    DV++ I   + + R + LL       M +      RFV+++I+
Sbjct: 480 VKTPDDVKKRIDALRREGRKNALL-------MLASRSGELRFVTVRIN 520


>gi|331000785|ref|ZP_08324433.1| serine protease MucD [Parasutterella excrementihominis YIT 11859]
 gi|329570446|gb|EGG52174.1| serine protease MucD [Parasutterella excrementihominis YIT 11859]
          Length = 482

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 148/451 (32%), Positives = 238/451 (52%), Gaps = 34/451 (7%)

Query: 30  EAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
           +A+LP    D   ++     ++VS+ V  K  V      NA  F  +P+D    +  R+ 
Sbjct: 35  QAQLP----DFTKLVEDNGKAVVSIQVTQKAAVRK----NANPFKGMPKDKL--DELRRF 84

Query: 90  FHKFFSGEEPILSDTV-ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAK 148
              F         D + ER   GSGF I+ DG ILT++H+V+      V L+DD E  AK
Sbjct: 85  GFPFPFPGPDGFEDRMPERKGQGSGFIISPDGLILTNHHVVDGADEIKVHLTDDREFNAK 144

Query: 149 LVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSAL 207
           ++G+DA  D+AV+K+  D K +P V+  ++ +++VGE V  IG PF L  TV++GIVSA 
Sbjct: 145 VIGSDAKTDVAVIKI--DGKDLPCVKLGNSKDVKVGEWVAAIGAPFGLENTVTSGIVSAK 202

Query: 208 DRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
            R++P D+   F Q DA +N GNSGGP FN  G VIG+N+ I ++    MG+   +P+ +
Sbjct: 203 SRNLPSDQFVPFIQTDAAVNPGNSGGPLFNMKGEVIGINSQIFSTSGGFMGLSFAVPIDL 262

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
             +    L+  G+V+ G  G+M Q ++ ELA   GL   KG+LI  + K S A+KAG++ 
Sbjct: 263 ALQIKDELVKHGKVNRGRLGVMIQTMSPELAKSFGLEKNKGALIAQIQKGSAAEKAGLQE 322

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP---TAKND 383
           GD++ + DG+ I +  D    +AS  P  +  + + +EG +  V V L ++     AK  
Sbjct: 323 GDIVILFDGKGIDNAADLSRAVASARPDTEHNVKVLREGKEAEVKVKLDAAADTSVAKGK 382

Query: 384 MHLEVGDKELLGMVLQDINDGNKK-----LVRIVALNPNREREVEAKGIQKGMTIVSVNT 438
              E   +  LG+ ++ +ND  KK     LV + +  P  E      GI++G  ++SV  
Sbjct: 383 AAEEA--RGRLGVTVRGLNDEEKKKYGDGLVVVESHGPASE-----AGIKEGDVLLSVGG 435

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            ++   +  +  +  A +    ++ LQ+  D
Sbjct: 436 KKIRSFEQFKDAVNAADK----TLALQVARD 462


>gi|294852720|ref|ZP_06793393.1| serine protease Do [Brucella sp. NVSL 07-0026]
 gi|294821309|gb|EFG38308.1| serine protease Do [Brucella sp. NVSL 07-0026]
          Length = 506

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 134/377 (35%), Positives = 200/377 (53%), Gaps = 27/377 (7%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE----PKKKVSVEQMF 68
            TVAL  +  + T           S+  PP +A   P+ V+ + E        +S  Q  
Sbjct: 15  ATVALGAMSVAGTV----------SMGTPPALAAQGPASVADLAEGLLDAVVNISTSQTV 64

Query: 69  NAYGFGN-------LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
              G G+       +PE  P + +F KDF     G +   S  V+ L  GSGF I  + G
Sbjct: 65  KDDGEGDGPVPMPQVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLG 375
           I + ++G++ ++ V LG
Sbjct: 362 IVVIRQGAEKTLKVKLG 378


>gi|294011009|ref|YP_003544469.1| putative serine protease [Sphingobium japonicum UT26S]
 gi|292674339|dbj|BAI95857.1| putative serine protease [Sphingobium japonicum UT26S]
          Length = 502

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 142/461 (30%), Positives = 224/461 (48%), Gaps = 57/461 (12%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL---PEDHPLKNYFRKDFHKFFSG 96
           L  ++ ++ P++V++    K++V V+  F    FG+L   P   P               
Sbjct: 48  LADMVEKLQPAVVNIST--KQRVQVQNPFAGTPFGDLFGAPGGRP--------------- 90

Query: 97  EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA------SFSVILSDDTELPAKLV 150
                  T +    GSGF I+ DGYI+T+NH+V  GA      S +V L++  E PA+LV
Sbjct: 91  ------QTRQAQSLGSGFIISADGYIVTNNHVVSAGAEGASVDSITVTLTNSEEYPARLV 144

Query: 151 GTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD 210
           G D   D+AVLK++  +    V+F D+   RVG+ V  IGNPF L GTV+AGI+SA+ R 
Sbjct: 145 GRDPATDIAVLKIEPKKALPFVKFGDSTKARVGDWVIAIGNPFALSGTVTAGIISAVHRG 204

Query: 211 IPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKA 270
                  F Q DA INQGNSGGP F+  G+VIG+N+ I++    ++G+G  IP       
Sbjct: 205 TGGTYDKFIQTDASINQGNSGGPMFDMRGNVIGINSQILSPSGGNVGIGFAIPSEQAAPI 264

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
           + +L     V  G+ GI    L ++LA  LGL   +G  +  V     ADKAG+K GDVI
Sbjct: 265 VDTLRKGQAVKRGYLGIQISPLGEDLADSLGLAKNRGEFVQGVEPGKGADKAGIKAGDVI 324

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN-DMHLEVG 389
             + G+ +   Q+    +AS+    +V I L + G + +V  V+G  P+    +   +  
Sbjct: 325 VSVAGQEVTPDQNLSSIVASQPIGSRVPIVLLRNGQRQTVTAVVGERPSEDELNAFAQSQ 384

Query: 390 DKELLGMVLQDINDGNKK--------------LVR----------IVALNPNREREVEAK 425
           D++         N+G                 ++R          IV    +   +  AK
Sbjct: 385 DEDFSQQPNNPSNNGQASQQSLGISAIPLTSTIIRQLGIAADTRGIVITAVDGSTDAGAK 444

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           G+++G  I++ N   V+   D++  +     + R ++LLQ+
Sbjct: 445 GLRRGDVIITANNRPVATQADLDAQVKAVSAQGRSAILLQV 485


>gi|170750918|ref|YP_001757178.1| protease Do [Methylobacterium radiotolerans JCM 2831]
 gi|170657440|gb|ACB26495.1| protease Do [Methylobacterium radiotolerans JCM 2831]
          Length = 516

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 154/473 (32%), Positives = 230/473 (48%), Gaps = 35/473 (7%)

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
           P  +A ++  +   +V      +VE      G   +P   P ++ F + F++        
Sbjct: 54  PASLADLAEQVTDAVVNISASTTVEARAGRAGP-QVPPGTPFEDLFEEFFNRRGGRGGGG 112

Query: 101 LSDTVERLM-----FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
                 R        GSGF I   G ++T+NH++ D     VIL D T+L A++VG D+ 
Sbjct: 113 GDSDGPRQQRKSNSLGSGFIIDSAGLVVTNNHVIGDANDIQVILHDGTKLKAEIVGKDSK 172

Query: 156 FDLAVLKVQ--SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
            DLAVL+V+  +DR    V F D++ +R G+ V  IGNPF L G+VSAGIVSA  R+I  
Sbjct: 173 IDLAVLRVKPPADRTLKAVPFGDSDKMRPGDWVIAIGNPFGLGGSVSAGIVSARGRNIES 232

Query: 214 RP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
            P   + Q DA IN+GNSGGP FN  G VIG+N  I++     +G+G  +P    K  I 
Sbjct: 233 GPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINTAILSPTGGSVGIGFAVPSGTAKPVID 292

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTKGSLITAVVKESPADKAGMKVGDVIC 331
            L   G V  GW G+  QN+    A  L L+ G +G+L+  V ++ PA  AG++VGDVI 
Sbjct: 293 QLRDFGEVRRGWLGVRIQNVDDTTAEALNLKGGARGALVAGVDEKGPAKTAGIEVGDVIL 352

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-----SSPTAKN--DM 384
             +G  +K+  D    +AS    ++V + + ++G + +  V LG       P   N    
Sbjct: 353 KFNGAPVKASGDLPRIVASTPVGQKVDVVVMRKGEEVTKPVTLGRLEDSDKPQLANLRQP 412

Query: 385 HLEVGDKELLGMVLQDINDGNKKL---------VRIVALNPNREREVEAKGIQKGMTIVS 435
             E   ++ LG+ L  + D  +K          V +  ++PN       K IQ G  IV 
Sbjct: 413 EPESATRQALGLNLSGMTDELRKKYSIKDTVKGVVVTRVDPN--STAADKRIQPGEVIVE 470

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           V    VS   +V + I   K+  R SVLL +       +G     RFV++ +D
Sbjct: 471 VGQEAVSTPAEVTKRIDALKKDGRKSVLLLV-------AGATGDVRFVAVGLD 516


>gi|152999239|ref|YP_001364920.1| protease Do [Shewanella baltica OS185]
 gi|160873852|ref|YP_001553168.1| protease Do [Shewanella baltica OS195]
 gi|304411197|ref|ZP_07392812.1| protease Do [Shewanella baltica OS183]
 gi|307306492|ref|ZP_07586235.1| protease Do [Shewanella baltica BA175]
 gi|151363857|gb|ABS06857.1| protease Do [Shewanella baltica OS185]
 gi|160859374|gb|ABX47908.1| protease Do [Shewanella baltica OS195]
 gi|304350390|gb|EFM14793.1| protease Do [Shewanella baltica OS183]
 gi|306910783|gb|EFN41211.1| protease Do [Shewanella baltica BA175]
 gi|315266079|gb|ADT92932.1| protease Do [Shewanella baltica OS678]
          Length = 450

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 152/477 (31%), Positives = 246/477 (51%), Gaps = 53/477 (11%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPP-----SSVDLPPVIARVSPSIVSVMVEPK--KKVS 63
           S+ + A+     +   +V +A +P      S   L P++ R +P++VSV V      K  
Sbjct: 6   SVLSAAMLAATLTMMPVVSQAAIPQTVEGQSIPSLAPMLERTTPAVVSVAVTGTHVSKQR 65

Query: 64  VEQMFNAYGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGY 121
           V  +F  Y FG N P++   +  FR                       GSG  I  + GY
Sbjct: 66  VPDVFR-YFFGPNAPQEQVQERPFRG---------------------LGSGVIIDAEKGY 103

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+++      V L D  E+ AKL+GTD+  D+A+L++++ +  + ++  +++++R
Sbjct: 104 IVTNNHVIDGADDIQVGLHDGREVKAKLIGTDSESDIALLQIEA-KNLVAIKSSNSDDLR 162

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALG 239
           VG+    IGNPF L  TV++GIVSAL R     +    F Q DA IN GNSGG   N  G
Sbjct: 163 VGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLNG 222

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            +IG+N  IV  G  ++G+G  IP +++K  +  +   G V  G  GI  ++L  +LA  
Sbjct: 223 ELIGINTAIVAPGGGNVGIGFAIPANMVKNLVAQIAEHGEVRRGVLGISGRDLDSQLAQG 282

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL    G  +  V K+S A+KAG+K GD+I  +DGR IKS Q+   ++A+     +V++
Sbjct: 283 FGLDTQHGGFVNEVAKDSAAEKAGIKAGDIIISVDGRGIKSFQELRAKVATMGAGAKVEL 342

Query: 360 SLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALN 415
            L ++G K +V V LG    +S +A   +H       L G  L++ + G  ++  +   +
Sbjct: 343 GLIRDGDKKTVKVTLGEASQTSESAAGAVH-----PMLQGASLENSSKG-IEITDVAQGS 396

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
           P         G+QKG  IV +N    + IKD++ L  + K+++  +V L+I  D  M
Sbjct: 397 P-----AAMSGLQKGDVIVGINR---TAIKDLKALKAQLKDQE-GAVALKIMRDKSM 444


>gi|328914959|gb|AEB55792.1| serine protease, MucD [Chlamydophila psittaci 6BC]
          Length = 475

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 159/463 (34%), Positives = 242/463 (52%), Gaps = 50/463 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-----E 97
           V  + +P +V +   PK    V  +    G    P D+P  +YF  +F   F G     E
Sbjct: 41  VAEQATPGVVYIESFPKCNRPVHPVPGRRG----PYDNPF-DYFNDEFFNRFFGLPTQKE 95

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
            P+  + V     G+GF ++ DGY++T+NH+VED     V L D  + PAK++G D   D
Sbjct: 96  RPMSKEAVR----GTGFIVSPDGYVVTNNHVVEDAGKIHVTLHDGQKYPAKVIGLDPKTD 151

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD---IPDR 214
           LAV+K+ ++ K   + F +++N++VG+    IGNPF L+ TV+ G++SA  R+   I D 
Sbjct: 152 LAVIKINAN-KLPHLTFGNSDNLKVGDWAIAIGNPFGLQATVTVGVISAKGRNQLHIADF 210

Query: 215 PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q DA IN GNSGGP  N  G VIGVN  IV+    ++G+G  IP  + KK I  L
Sbjct: 211 E-DFIQTDAAINPGNSGGPLLNIDGKVIGVNTAIVSGSGGYIGIGFAIPSLMAKKIIDQL 269

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           IS G+V  G+ G+  Q +  ELA    L    G+LIT VVK SPADKAG+K  DVI   +
Sbjct: 270 ISDGQVIRGFLGVTLQPIDAELAACYKLDKVYGALITDVVKGSPADKAGLKQEDVIIAYN 329

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL 394
           GR ++S   F   I+  +P  +V + + +EG    + V++  +P         V     +
Sbjct: 330 GREVESLSAFRNAISLMNPDTRVLLKVVREGQVLEIPVIVSQAPQDDG-----VSALNRV 384

Query: 395 GMVLQDIN-DGNKKLVRIVALNPNRER----EVEA------KGIQKGMTIVSVNTHEVSC 443
           G+ +Q++N +  KKL     + P+ +      VEA       GI  G  I++VN  +VS 
Sbjct: 385 GIRVQNLNPETAKKL----GMTPDSKGVLIISVEAGSVASSSGIAPGQLILAVNRQKVSS 440

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           ++++  ++   K+   +S+LL +            + RFV LK
Sbjct: 441 VEELNTVL---KDGNNESILLMVS--------QGEVIRFVVLK 472


>gi|22122030|dbj|BAC07235.1| DegQ serine protease [Photobacterium damselae subsp. piscicida]
          Length = 455

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 146/477 (30%), Positives = 250/477 (52%), Gaps = 47/477 (9%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD-----LPPVIARVSPSIVSVMVEP 58
           R+ L V S   + ++ V+   T +   A LP +  +     L P++ +V+P++VS+ VE 
Sbjct: 2   RKPLLVLSALALGISSVV---TPMTATAALPTAVNNQQVPSLAPMLEQVTPAVVSIAVE- 57

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-T 117
            K VS +++  AY F           +F  DF      E+P           GSG  I  
Sbjct: 58  GKHVSKQRLPEAYRF-----------FFGPDFPTEQVREQPFRG-------LGSGVIIDA 99

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
             GY++T+NH+++   +  V LSD  E+ AKL+GTD + D+A+L+++  +    ++  D+
Sbjct: 100 KKGYVVTNNHVIDGADTIKVQLSDGREIKAKLLGTDKMSDIALLQLEDAKDLTAIKLADS 159

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR---DIPDRPGTFTQIDAPINQGNSGGPC 234
           +N+RVG+    IGNPF L  TV++GIVSAL R   +I +    F Q DAPIN GNSGG  
Sbjct: 160 DNLRVGDFAVAIGNPFGLGQTVTSGIVSALGRSGLNIENFE-NFIQTDAPINSGNSGGAL 218

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
            N  G +IG+N  I+     ++G+G  IP +++K     LI  G+V  G  G+    LT 
Sbjct: 219 VNLNGELIGINTAILAPNGGNVGIGFAIPANMVKNLTDQLIEFGQVKRGVLGVTGGELTS 278

Query: 295 ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK 354
           ELA   G +   G+ +  V+ E  A KAG+K GD+I  ++ + I++  +   +I +    
Sbjct: 279 ELAETFGYKTNHGAFVNQVLPEGSAAKAGLKAGDIIVSVNNKPIRTFSELRAKIVTLGAG 338

Query: 355 EQVKISLCKEGSKHSVAVVLGSSPTAK---NDMHLEVGDKELLGMVLQDINDGNKKLVRI 411
           ++V + L ++G + +V V L ++   +   +D+H  +   E      +D   G    V++
Sbjct: 339 KKVTLGLIRDGKELNVPVTLEAAKQTQVKADDLHESLAGAEFANTSPEDKVHG----VKV 394

Query: 412 VALNPNREREVEAK-GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
             LN   ++ + A+ G++KG  I+ +N   +  + ++     KA EKK + + +++K
Sbjct: 395 TELN---KQSIAARYGLKKGDIIIGLNRQPIKNLGELR----KALEKKPNVLAMEVK 444


>gi|240140635|ref|YP_002965115.1| Serine protease DO-like protein [Methylobacterium extorquens AM1]
 gi|240010612|gb|ACS41838.1| Serine protease DO-like protein [Methylobacterium extorquens AM1]
          Length = 496

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 155/479 (32%), Positives = 240/479 (50%), Gaps = 27/479 (5%)

Query: 22  FSSTYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
            +  Y     K P  + D PP     V+ +V P +V+V V  K   S +   ++ G  N+
Sbjct: 32  MTPAYAQALPKTPIEAPDQPPGSFANVVDKVKPGVVAVKV--KLDDSADDDDDSAGGPNM 89

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
            +  P      ++F K F    P       R   GSGF I+ DGY++T+NH+V+   +  
Sbjct: 90  QQVPPQ----LREFFKRFGQGGPGGRGMRPRGGVGSGFIISADGYVVTNNHVVDKAKTVQ 145

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V L D   L AK++G D+  D+A+LK+     +  V+F      RVG+ V  IGNPF L 
Sbjct: 146 VTLDDGRTLDAKVIGKDSKTDIALLKITESGSYPYVQFGKGAP-RVGDWVLAIGNPFGLG 204

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV+ GIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+GVN  I +     
Sbjct: 205 GTVTVGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGVNTAIASPSGGS 264

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  IP   ++  +  L + G+V  G+ G+  Q +T+++A  LGL   KG+L+     
Sbjct: 265 VGLGFAIPAETVQTVVDQLRTDGKVVRGYLGVQVQPVTKDIAEGLGLDKAKGALVNDAES 324

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
            +PA KAG+K GDVI  ++G  + + +D    IA   P  +VK++  + G      V LG
Sbjct: 325 GTPAAKAGLKSGDVIESVNGVPVNNARDLSRLIAGLKPGTEVKLAYLRGGKSEVATVELG 384

Query: 376 SSP-----TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
           + P     T + D       +  LG+ L   ++       +  ++ + +    A+GI +G
Sbjct: 385 TLPGDSKVTRRGDDAPS--GQARLGLSLAPASETGLGDEGVAVMDVDPDGPAAARGISQG 442

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             I+ V    VS   +V+  I  A+   R +VL+++K            +RF+++ + K
Sbjct: 443 DVILDVAGTSVSKPSEVQAQIRAAESSGRKAVLMRVKS-------ARGQTRFIAVPLTK 494


>gi|254459945|ref|ZP_05073361.1| protease DegQ [Rhodobacterales bacterium HTCC2083]
 gi|206676534|gb|EDZ41021.1| protease DegQ [Rhodobacteraceae bacterium HTCC2083]
          Length = 494

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 140/475 (29%), Positives = 239/475 (50%), Gaps = 45/475 (9%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFR--KDFH 91
           P S  DL     ++SP++V++        S     N    G  PE  P + +FR  +D +
Sbjct: 45  PESFADLAE---KISPAVVNITT------STTVARNTAPRGVAPEGSPFEEFFREFQDRN 95

Query: 92  KFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVG 151
           +  +G+ P  S        GSGF I++DG+++T+NH+++      +   +  ELPAK++G
Sbjct: 96  RGGNGDRPRRSSA-----LGSGFVISEDGFVVTNNHVIDGADEILIEFFEGGELPAKVIG 150

Query: 152 TDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI 211
           TD   D+A+LKV++D+    V F +++  RVG+ V  +GNP     +VSAGIVSA +R +
Sbjct: 151 TDPNTDIALLKVETDKPLSFVSFGNSDFSRVGDWVMAMGNPLGQGFSVSAGIVSARNRAL 210

Query: 212 PDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
                 + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++   +
Sbjct: 211 SGSYDDYIQTDAAINRGNSGGPLFNMDGDVIGVNTAILSPNGGSIGIGFSMASNVVVNVV 270

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             L   G    GW G+  Q++T ++A  +GL    G+L+T  V E P+ +AG+K GDVI 
Sbjct: 271 DQLKEFGETRRGWLGVRIQDVTDDVAEAIGLENAAGALVTD-VPEGPSMEAGIKAGDVIM 329

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN-------DM 384
             DG+ +   +  V  + +    + V++ + ++G   ++ V LG    A+          
Sbjct: 330 SFDGKDVSDTRSLVKTVGNTQVGKAVRVIVFRDGKTETLKVTLGRREEAEGAVPASQPAA 389

Query: 385 HLEVGDKELLGMVLQ----------DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIV 434
                  E+LG+ +           D+ D    LV    +  ++  E   KG++ G  I 
Sbjct: 390 PAAPSKTEVLGLTISEITDELRDQLDLTDSASGLVIQDVVETSKAYE---KGLRAGDLIT 446

Query: 435 SVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
                +++ ++D+ + I  A+E  R S+LL ++   D         RFV+L +++
Sbjct: 447 EAGQQKLASVEDLTKQIEAAREAGRKSLLLLVRRAGD--------PRFVALALEE 493


>gi|163745625|ref|ZP_02152985.1| Putative trypsin-like serine protease [Oceanibulbus indolifex
           HEL-45]
 gi|161382443|gb|EDQ06852.1| Putative trypsin-like serine protease [Oceanibulbus indolifex
           HEL-45]
          Length = 373

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/335 (34%), Positives = 191/335 (57%), Gaps = 12/335 (3%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++  VSP++V + V   ++ +  Q         LP   P     R+ F +    +    +
Sbjct: 44  LVEAVSPAVVFIEVTASQENTQIQQ-------QLPPGMP--EELRRRFEQMLPDQNG--A 92

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
               R   GSGF I++DG I+T++H+V    + +V L+D     A++VG+D + D+AVLK
Sbjct: 93  TATPRQGLGSGFIISEDGTIVTNHHVVAGAQTVTVKLADGRSFNAEVVGSDPMTDIAVLK 152

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQI 221
           V++D     V F  +  +RVG+ V  +GNPF L GTV++GIVSAL RDI   P   F Q 
Sbjct: 153 VKADVDLPTVAFGTSKTLRVGDEVVAVGNPFGLGGTVTSGIVSALSRDIQAGPFDDFIQT 212

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DA IN+GNSGGP FN  G V+GVN  I++ G   +G+G  +P  +++  +  L   G V+
Sbjct: 213 DAAINRGNSGGPLFNNEGEVVGVNTAILSPGGGSVGIGFSVPSDLVQTIVADLADDGTVE 272

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            GW G+  + ++ E+A  LG    +G++I AV ++SPA KAG+K GD+I    G  +   
Sbjct: 273 RGWLGVQIRPMSPEVANVLGYEEPRGAVIEAVSQDSPAAKAGLKKGDIILSFGGIKVDDL 332

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           +D    +A+ +P+   ++ + ++G++ ++ V +G+
Sbjct: 333 RDLTRAVATTTPETAAEVVVLRKGAEQTLDVTVGA 367


>gi|62185362|ref|YP_220147.1| putative heat shock-related exported protease [Chlamydophila
           abortus S26/3]
 gi|62148429|emb|CAH64197.1| putative heat shock-related exported protease [Chlamydophila
           abortus S26/3]
          Length = 488

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 156/462 (33%), Positives = 240/462 (51%), Gaps = 48/462 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-----E 97
           V  + +P +V +   PK    V       G    P D+P  +YF  +F   F G     E
Sbjct: 54  VAEQATPGVVYIESFPKCNRPVHPAPGRRG----PYDNPF-DYFNDEFFNRFFGLPTQKE 108

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
            P+  + V     G+GF ++ DGY++T+NH+VED     V L D  + PAK++G D   D
Sbjct: 109 RPMSKEAVR----GTGFIVSPDGYVVTNNHVVEDAGKIHVTLHDGQKYPAKVIGLDPKTD 164

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD---IPDR 214
           LAV+K+ ++ K   + F +++N++VG+    IGNPF L+ TV+ G++SA  R+   I D 
Sbjct: 165 LAVIKINAE-KLPHLTFGNSDNLKVGDWAIAIGNPFGLQATVTVGVISAKGRNQLHIADF 223

Query: 215 PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q DA IN GNSGGP  N  G VIGVN  IV+    ++G+G  IP  + KK I  L
Sbjct: 224 E-DFIQTDAAINPGNSGGPLLNIDGKVIGVNTAIVSGSGGYIGIGFAIPSLMAKKIIDQL 282

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           IS G+V  G+ G+  Q +  ELA    L    G+LIT VVK SPADKAG+K  DVI   +
Sbjct: 283 ISDGQVIRGFLGVTLQPIDAELAACYKLDKVYGALITDVVKGSPADKAGLKQEDVIIAYN 342

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL 394
           GR ++S   F   I+  +P  +V + + +EG    + V++  +P         V     +
Sbjct: 343 GREVESLSAFRNAISLMNPNTRVLLKVVREGQVVEIPVIVSQAPQDDG-----VSALNRV 397

Query: 395 GMVLQDINDGNKKLVRIVALNPNRER----EVEA------KGIQKGMTIVSVNTHEVSCI 444
           G+ +Q++   N +  + + + P+ +      VEA       GI  G  I++VN  +VS +
Sbjct: 398 GIRVQNL---NSETAKKLGMTPDSKGVLIVSVEAGSVASSSGIAPGQLILAVNRQKVSSV 454

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +++  ++   K+   +S+LL +            + RFV LK
Sbjct: 455 EELNTVL---KDGNNESILLMVS--------QGEIIRFVVLK 485


>gi|325275447|ref|ZP_08141378.1| protease Do [Pseudomonas sp. TJI-51]
 gi|324099423|gb|EGB97338.1| protease Do [Pseudomonas sp. TJI-51]
          Length = 467

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 139/424 (32%), Positives = 216/424 (50%), Gaps = 28/424 (6%)

Query: 39  DLPPVIARVSPSIVSVMVE---PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           D   ++ + SP++V++  +   P ++V+  QM         P+   L   FR+ F +   
Sbjct: 23  DFTTLVEQASPAVVNISTKQKLPDRRVAQGQM---------PDLEGLPPMFREFFERNMP 73

Query: 96  GE--EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
            +   P      E +  GSGF I+ DGY+LT+NH+V D     V LSD +EL AKL+GTD
Sbjct: 74  QQPRSPRGDRQREAMSLGSGFIISSDGYVLTNNHVVADADEIIVRLSDRSELQAKLIGTD 133

Query: 154 ALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
              D+A+LKV  D K +P V+  D+  ++VGE V  IG+PF    +V+ GIVSA  R +P
Sbjct: 134 PRTDVALLKV--DGKNLPTVKLGDSEKLKVGEWVLAIGSPFGFDHSVTKGIVSAKGRTLP 191

Query: 213 -DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
            D    F Q D  IN GNSGGP FN  G V+G+N+ I T     MG+   IP+ +     
Sbjct: 192 NDTYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQIFTRSGGFMGLSFAIPIDVALDVS 251

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             L   G+V  GW G++ Q + ++LA   GL    G+L+  V++  PA K G++VGDVI 
Sbjct: 252 NQLKKDGKVSRGWLGVVIQEVNKDLAESFGLDKPAGALVAQVLENGPAAKGGLQVGDVIL 311

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP------TAKNDMH 385
            ++G+ I    D    + S    E+ K+ + + G + ++ V +G+ P      TA  D  
Sbjct: 312 SMNGQPIVMSADLPHLVGSLKDGEKAKLEIIRNGKRQTLDVAVGAMPDDDADITAGADGS 371

Query: 386 LEVGDKELLGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
            E      LG+ + D+    KK + +   V +   ++      G++ G  I  +N   + 
Sbjct: 372 TERSSNR-LGVAVADLTAEQKKSLELKGGVVIKEVQDGPAALIGLRPGDVISHLNNQAIG 430

Query: 443 CIKD 446
             K+
Sbjct: 431 SAKE 434



 Score = 36.6 bits (83), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+   +LT E    L L   KG ++   V++ PA   G++ GDVI  L+ + I S ++F
Sbjct: 379 LGVAVADLTAEQKKSLEL---KGGVVIKEVQDGPAALIGLRPGDVISHLNNQAIGSAKEF 435

Query: 345 VWQIASRSPKEQ-VKISLCKEG 365
             +IA   PK + V + + ++G
Sbjct: 436 T-EIAKELPKNRSVSMRVLRQG 456


>gi|73667458|ref|YP_303474.1| peptidase S1 [Ehrlichia canis str. Jake]
 gi|72394599|gb|AAZ68876.1| Peptidase S1, chymotrypsin:PDZ/DHR/GLGF domain [Ehrlichia canis
           str. Jake]
          Length = 471

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 134/401 (33%), Positives = 224/401 (55%), Gaps = 30/401 (7%)

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           E L  GSGF + + G I+T+ H+V +     +  S++  +PAK++G D   DLAVLKV+ 
Sbjct: 84  EILSAGSGFVVDESGIIVTNYHVVHNAKEVYITFSNNKSIPAKILGVDPQTDLAVLKVEV 143

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAP 224
           + K   ++F D++   VG+ V  IGNPF L G+ S GI+SA  RD+     T F Q DA 
Sbjct: 144 NEKLPYLDFGDSDTAMVGDWVVAIGNPFGLGGSASIGIISARARDLNIGTATEFLQTDAA 203

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTS--GQFHMGVGLIIPLSIIKKAIP--SLISKG-R 279
           IN+GNSGGP FN  G VIG+N  I+++  G  ++GVG  IP +    A+P   ++S+G +
Sbjct: 204 INKGNSGGPLFNVDGKVIGINTAILSTQKGGGNIGVGFAIPSN---SAVPIIKVLSQGKK 260

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V+HGW G++ Q +T+EL  P  L+   G+LIT +VK SPADKA +  GD+I   +G  I 
Sbjct: 261 VEHGWLGVVMQPITEELVEPFKLKEVSGALITNIVKGSPADKAKLLPGDIILEFNGTKIN 320

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG---SSPTAKNDMHLEVGDKELLGM 396
           S       +       +V + + + GS  +++V +G   +   ++N++  +      LG+
Sbjct: 321 SISQLHQLVLRSEANNEVTLVVSRNGSIINISVKIGKFENPDPSENELPKDSVQSHELGL 380

Query: 397 VLQDI-------NDGNKKLVR-IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
            + +I       ND  ++ V+ ++ LN +       K I+KG  I+ +N   ++ ++D +
Sbjct: 381 TVGNIKHNQIMSNDTTEEEVKGVMILNVDYTSNASTKNIRKGDIILQINQSPINNLEDFK 440

Query: 449 RLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            ++ K ++ K  ++L+            DN+S FV++K+ +
Sbjct: 441 NVMKKVRKNKSAALLIS----------RDNISMFVTVKLKQ 471


>gi|239814405|ref|YP_002943315.1| protease Do [Variovorax paradoxus S110]
 gi|239800982|gb|ACS18049.1| protease Do [Variovorax paradoxus S110]
          Length = 496

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 142/456 (31%), Positives = 239/456 (52%), Gaps = 47/456 (10%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-- 96
           D   ++ +V P++V +        +VE++ +  G G +  D  ++ +FR+ F +   G  
Sbjct: 45  DFADLVEQVGPAVVGIR-------TVEKVTSGGGSGEM--DEEMQEFFRRFFGQPLPGNP 95

Query: 97  ---------EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
                    ++P   +    +  GSGF ++ DGY++T+ H++ED +   V L+D  E  A
Sbjct: 96  RPGPRPNRPQQPQEEERPRGV--GSGFILSADGYVMTNAHVIEDASEILVTLTDKREFKA 153

Query: 148 KLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           KL+G D   D+AV+K+++    +PV +  D + +RVGE V  IG+PF L  TV+AGIVSA
Sbjct: 154 KLIGADKRSDVAVVKIEATS--LPVVKIGDISKLRVGEWVMAIGSPFGLENTVTAGIVSA 211

Query: 207 LDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
             RD  D      Q D  IN GNSGGP  N  G V+G+N+ I +    +MG+   IP+  
Sbjct: 212 KQRDTGDLV-PLIQTDVAINPGNSGGPLINLRGEVVGINSQIYSRSGGYMGISFSIPIDE 270

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
             +    L + GRV  G  G+   ++++++A  +GL   +G+L+++VV  S ADKAG++ 
Sbjct: 271 AIRVSDQLRATGRVSRGLIGVTIGSVSKDVAESIGLGKARGALVSSVVPGSAADKAGVRE 330

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-----SSPTAK 381
           GD+I     ++I++  D    +AS  P  +  +++ + GS   ++V +      + P++K
Sbjct: 331 GDIITKYGDKLIETPSDLSRSVASTKPGARNTLTVFRNGSTRELSVTVAEGDPEAKPSSK 390

Query: 382 NDMHLE------VGDKELLGMVLQDINDGNKKL------VRIVALNPNREREVEAKGIQK 429
                E          + LG+V+ D+ D  KK       VRI A +    R     G+++
Sbjct: 391 RQPEREEPQAKPSAAGKALGLVVSDLTDAQKKELKMRGGVRIEAASDGAAR----AGLRE 446

Query: 430 GMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
           G  I++V   EVS +K+ E  + KA + K  SVL +
Sbjct: 447 GDVILAVGNIEVSSVKEFETAVAKADKGKPLSVLFR 482


>gi|260565375|ref|ZP_05835859.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260151443|gb|EEW86537.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
          Length = 473

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 148/459 (32%), Positives = 226/459 (49%), Gaps = 57/459 (12%)

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGA 133
            +PE  P + +F KDF     G +   S  V+ L  GSGF I  + GYI+T+NH++ D  
Sbjct: 27  QVPEGSPFQEFF-KDFFNDKDGAQGDDSRKVQSL--GSGFIIDAEKGYIVTNNHVIADAD 83

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNP 192
              V  +D ++L A+LVG D   DLA+LKV  S  K   V F ++   R+G+ V  IGNP
Sbjct: 84  EIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEKARIGDWVLAIGNP 143

Query: 193 FRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  G VIG+N  I++ 
Sbjct: 144 FGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMDGKVIGINTAIISP 203

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+G  IP  +    I  L   G V  GW G+  Q +T+++A  LGL+ TKG+LI 
Sbjct: 204 SGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQSLGLKETKGALIA 263

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            +++ S  D   ++ GDV+   DG+ + + +D    +A R   ++V+I + ++G++ ++ 
Sbjct: 264 GLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAERPVGKEVEIVVIRQGAEKTLK 323

Query: 372 VVL-----------------------GSSPTAKNDM----------HLEVGDKELLGMVL 398
           V L                       G  P A+ +           H       +LGM L
Sbjct: 324 VKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEHKSDAAPSVLGMKL 383

Query: 399 QDINDG---------NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
             ++D          + + V I+ + P        K I+ G  IV +    V   +DV++
Sbjct: 384 SKLDDDIRGEFGIAEDVEGVAILYVAPG--TAAGEKRIETGDVIVDIGQVTVKTPEDVKK 441

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            I   + + R + LL       M +      RFV+++ID
Sbjct: 442 RIDALRREGRKNALL-------MLASRSGELRFVTIRID 473


>gi|120600225|ref|YP_964799.1| protease Do [Shewanella sp. W3-18-1]
 gi|146291847|ref|YP_001182271.1| protease Do [Shewanella putrefaciens CN-32]
 gi|120560318|gb|ABM26245.1| peptidase Do. Serine peptidase. MEROPS family S01B [Shewanella sp.
           W3-18-1]
 gi|145563537|gb|ABP74472.1| protease Do [Shewanella putrefaciens CN-32]
          Length = 451

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 151/478 (31%), Positives = 241/478 (50%), Gaps = 54/478 (11%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVD------LPPVIARVSPSIVSVMVEPK--KKV 62
           S+ + A+     +    + +A +P  +VD      L P++ R +P++VSV V      K 
Sbjct: 6   SVLSAAMLAATLTMMPAISQAAIP-QTVDGQSMPSLAPMLERATPAVVSVAVTGTHVSKQ 64

Query: 63  SVEQMFNAYGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDG 120
            V  +F  Y FG N+P++   +  FR                       GSG  I  D G
Sbjct: 65  RVPDVFR-YFFGPNVPQEQIQERPFRG---------------------LGSGVIIDADKG 102

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YI+T+NH++       V L D  E+ AKL+G DA  D+A+L++++ +  + ++  D++++
Sbjct: 103 YIVTNNHVINGADDIQVGLHDGREVKAKLIGADAESDIALLQIEA-KNLVAIKSSDSDDL 161

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNAL 238
           RVG+    IGNPF L  TV++GIVSAL R     +    F Q DA IN GNSGG   N  
Sbjct: 162 RVGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLN 221

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G +IG+N  IV  G  ++G+G  IP +++K  +  ++  G V  G  GI  ++L  +LA 
Sbjct: 222 GELIGINTAIVAPGGGNVGIGFAIPANMVKNLVAQIVEHGEVRRGVLGISGRDLDSQLAQ 281

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G  +  V   S A+KAG+K GD+I  +D R IKS Q+   ++A+     +V+
Sbjct: 282 GFGLDTQHGGFVNEVTAGSAAEKAGIKAGDIIVSVDSRGIKSFQELRAKVATMGAGAKVE 341

Query: 359 ISLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVAL 414
           + + ++G K +V V LG    +S +A   +H       L G  L++   G   +  +   
Sbjct: 342 LGIIRDGDKKTVKVTLGEASQTSDSAAGAVH-----PMLQGAALENAAKGGVTITDVAQG 396

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
           +P         G+QKG  IV +N    + IKD++ L    K+++  +V L+I  D  M
Sbjct: 397 SP-----AAMSGLQKGDIIVGINR---TAIKDLKALKAHLKDQE-GAVALKILRDKSM 445


>gi|294139201|ref|YP_003555179.1| serine protease, HtrA/DegQ/DegS family [Shewanella violacea DSS12]
 gi|293325670|dbj|BAJ00401.1| serine protease, HtrA/DegQ/DegS family [Shewanella violacea DSS12]
          Length = 450

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 150/454 (33%), Positives = 234/454 (51%), Gaps = 53/454 (11%)

Query: 27  LVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA--YGFG-NLPEDHPLK 83
           +  E +  PS   L P++ R +P++V+V V     +S +++ +A  Y FG N P +   +
Sbjct: 30  MAAEGQSIPS---LAPMLVRTTPAVVAVAV-TGTHISKQKLPDAFRYFFGPNAPREQVQE 85

Query: 84  NYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDD 142
             FR                       GSG  I    GYI+T+NH+++      + L D 
Sbjct: 86  RPFRG---------------------LGSGVIIDAAKGYIVTNNHVIDGADEILIGLHDG 124

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
            E+ AKL+GTD+  D+A+L++++D   + ++  D++ +RVG+    IGNPF L  TV++G
Sbjct: 125 REVEAKLIGTDSEADIALLQIKAD-NLVAIKRADSDKLRVGDFAVAIGNPFGLGQTVTSG 183

Query: 203 IVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           IVSA+ R     +    F Q DA IN GNSGG   N  G +IG+N  IV  G  ++G+G 
Sbjct: 184 IVSAMGRSGLGIEMLENFIQTDAAINSGNSGGALVNLNGDLIGINTAIVAPGGGNVGIGF 243

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            IP +++   +  LI  G V  G  G+  ++LT ELA   GL    G  +  V+ +S AD
Sbjct: 244 AIPSNMVSNLVDQLIEHGEVRRGVLGVTGRDLTNELAKGFGLNTQHGGFVDQVMDDSAAD 303

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG----S 376
           KAG+K GD+I  ++GR IKS Q+   ++ +     +VK  L ++G+K +V   LG    +
Sbjct: 304 KAGIKAGDIIVSVNGRNIKSFQELRAKVGTMGAGAEVKFGLIRDGNKRTVTATLGETSQT 363

Query: 377 SPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
           + TA   +H       L G  L++   G    V I  +  N      A G+QKG  IV V
Sbjct: 364 TETAAGAIH-----PMLTGAALENSQQG----VEITDVAQN--SPAAASGLQKGDLIVGV 412

Query: 437 NTHEVSCIKDVERLIGKAK-EKKRDSVLLQIKYD 469
           N  ++  +K +     KAK   ++ +V L+IK D
Sbjct: 413 NRSQIKNLKSL-----KAKLADQQGTVALKIKRD 441


>gi|150025284|ref|YP_001296110.1| protease DegQ precursor [Flavobacterium psychrophilum JIP02/86]
 gi|149771825|emb|CAL43299.1| Protease DegQ precursor [Flavobacterium psychrophilum JIP02/86]
          Length = 461

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 201/359 (55%), Gaps = 14/359 (3%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSG  I+ DGYI+T+NH+V++     + L+++    AKLVGTD+  D+A+LK+++D K  
Sbjct: 100 GSGVIISQDGYIVTNNHVVKEATQLEITLNNNKTYKAKLVGTDSKMDIALLKIEADEKLP 159

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
              F +++N++VGE V  +GNP+ L  TV+AGIVSA  RD+ +    +F Q DA +N GN
Sbjct: 160 YATFGNSDNLKVGEWVLAVGNPYNLTSTVTAGIVSAKARDLSNNGIQSFIQTDAAVNPGN 219

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGG   N  G +IG+N MI +    ++G    +P ++ +K +  L+  G V  G  GI  
Sbjct: 220 SGGALVNTRGELIGINTMISSQTGSYVGYSFAVPSNLTRKIVEDLMEYGNVQRGILGIEA 279

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
             L    +  LG++ + G L+  V K S A+K+G+K GD+I  LD + I S  D    I 
Sbjct: 280 GELNSATSKELGIKQSTGVLVNKVSKNSGAEKSGLKKGDIITKLDEKSILSFADLTSYIN 339

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV 409
           ++ P +++K+ + ++    ++ V L    T K     E+ + +L G+ L DI++ + K +
Sbjct: 340 TKRPNDEIKVGIIRDDKNMTIPVKL----TKK-----ELINYDLKGLELADIDNADMKRL 390

Query: 410 RI---VALNPNREREVEAKGIQ-KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
            I   V +      E+     Q KG  I+S++  + + I+ V +++ K  E +R  + L
Sbjct: 391 NIKYGVKIENITNDELSGYAEQLKGAVILSIDNIKATDIETVTKVLSKKAENQRSQIEL 449


>gi|114706853|ref|ZP_01439753.1| putative protease precursor signal peptide protein [Fulvimarina
           pelagi HTCC2506]
 gi|114537801|gb|EAU40925.1| putative protease precursor signal peptide protein [Fulvimarina
           pelagi HTCC2506]
          Length = 623

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 151/502 (30%), Positives = 242/502 (48%), Gaps = 70/502 (13%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG----NLPEDHPLKNYFRKD 89
           PP+S   P  ++ ++ S++  +V     +S  Q     G G      PE  PL+++F   
Sbjct: 145 PPASRQGPESVSELAESLLDAVV----NISTAQRVERPGGGIPPLEAPEGSPLQDFF--- 197

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKL 149
                 G+       V+ L  GSGF I   G ++T+NH+++D    +V  +D ++L A+L
Sbjct: 198 -DDLLRGDGNPSGRRVQSL--GSGFVIDPSGVVITNNHVIQDADEITVNFADGSQLEAEL 254

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           +G D   DLAVLKVQSD   + V F D+  I++G+ V  IGNPF L G+VS GIVSA  R
Sbjct: 255 LGRDPKTDLAVLKVQSDEPLVSVAFGDSETIKIGDWVMAIGNPFGLGGSVSLGIVSARGR 314

Query: 210 DIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIK 268
           +I   P   F Q DA IN+GNSGGP F+  G+V+G+N  I++     +G+G  IP ++  
Sbjct: 315 NINAGPYDNFIQTDAAINRGNSGGPLFDMNGNVVGINTAIISPTGGSIGIGFSIPANLAV 374

Query: 269 KAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGD 328
             +  L   G    GW GI    +T ++A  LG+   +G+++   +   P+    +K GD
Sbjct: 375 NVVNQLREFGETRRGWLGIRLSAVTDDIASGLGIGEARGAVVVGTIDGGPSQDV-LKAGD 433

Query: 329 VICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH------SVAVVLG------- 375
           VI   DG+ ++S +D    +A     + V++ + ++ S+       +V V LG       
Sbjct: 434 VITAFDGKTVESSRDLPRIVAETPVGKDVEVEILRKTSREADAEPMTVTVTLGRLEDGER 493

Query: 376 ---SSPTA-KNDMHLEVGDKE-------------LLGMVLQDINDGNKK----------- 407
                P   + +   +  D E             +LG+ L  I+D  +            
Sbjct: 494 LMAEGPNGEEEEADGDTSDDEAVEGEAQTGATDPVLGLTLGAIDDDTRSEFNLPEDAEGV 553

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK-EKKRDSVLLQI 466
           L+  VA   N       KGI+ GM I  +    VS + DVE  + + + E +R++++L  
Sbjct: 554 LITAVAAGSN----AAEKGIEAGMLIQEIAQESVSSVSDVEEKLAELRSEGRRNALMLVA 609

Query: 467 KYDPDMQSGNDNMSRFVSLKID 488
           + D D+        RFV L +D
Sbjct: 610 EQDGDL--------RFVVLPLD 623


>gi|332188007|ref|ZP_08389739.1| protease Do family protein [Sphingomonas sp. S17]
 gi|332012008|gb|EGI54081.1| protease Do family protein [Sphingomonas sp. S17]
          Length = 430

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 211/390 (54%), Gaps = 35/390 (8%)

Query: 110 FGSGFFITDDGYILTSNHIVED-GA-----SFSVILSDDTELPAKLVGTDALFDLAVLKV 163
            GSGF I+ DGY++T+NH+V   GA     +  V L+   E PA++VG D   DLAVLK+
Sbjct: 31  LGSGFLISADGYVVTNNHVVAGRGAGVQVQAIKVTLTGGQEYPARVVGRDEASDLAVLKI 90

Query: 164 QSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQI 221
           +++   +P V F D    R G+ V  IGNP+ L GTV+AGIVSAL RD+   P  +F Q 
Sbjct: 91  EANN--LPFVRFGDPPGARTGDWVLAIGNPYGLGGTVTAGIVSALHRDLRSGPYDSFIQT 148

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DA IN GNSGGP F+  G+VIG+N  I++    ++G+G  IP  I K  + +L + GRV 
Sbjct: 149 DASINSGNSGGPLFDMQGNVIGINTAIISPTGGNVGLGFAIPAEIAKPVVDTLRAGGRVR 208

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            G+ G++ Q +T+++A  LGL+  +G ++  V    PA +AG++ GDVI  ++G  I   
Sbjct: 209 RGYLGLLLQPVTEDVAAALGLQKDRGEIVAEVQPNLPAARAGLRQGDVILRVNGSEITPE 268

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT--------------------AK 381
                 +A+     +V + + +EG++ ++  V+   P                     A 
Sbjct: 269 NSVARLVAAAPVGSRVTLEVLREGAQKTLTAVVAERPPEASLNGEDEEFDLDDDGEGKAS 328

Query: 382 NDMHLEVGDKELLGMVLQD--INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTH 439
               L +  + L   +  +  ++ G + LV IV ++P+   +  AKG+ +G  I+S+N  
Sbjct: 329 VSAGLGLSVRPLTPALASELRVDPGTQGLV-IVQVDPS--SDAAAKGLSEGDIILSINQQ 385

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            V   ++   LI  A++  R  VLL +K +
Sbjct: 386 AVRTAQEAVSLIAAARKAGRKQVLLLVKRE 415


>gi|251792936|ref|YP_003007662.1| protease DegQ [Aggregatibacter aphrophilus NJ8700]
 gi|247534329|gb|ACS97575.1| protease DegQ [Aggregatibacter aphrophilus NJ8700]
          Length = 460

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 144/478 (30%), Positives = 245/478 (51%), Gaps = 42/478 (8%)

Query: 1   MFKRQ-ILSVKSICTVALTCVIFSSTYL--VLEAKLPPSSVDLPPVIARVSPSIVSVMVE 57
           M KR  +L+  ++    LT  + S   +  V+E +  PS   L P++ +V PS+VS+ VE
Sbjct: 1   MKKRNFVLTGIALGLSILTTPMISQAEIPAVVEGQQVPS---LAPMLEKVLPSVVSISVE 57

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFF 115
            K+K    QM ++     +PE+            KFF G +    D   R     GSG  
Sbjct: 58  GKQKGRSAQMDDS-----IPEEF-----------KFFFGPDMFDRDRAPRNFKGIGSGAI 101

Query: 116 IT-DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEF 174
           I  + GY+LT+NH+++D    +V L D  E  AK++G D + D+A+++++  +    ++ 
Sbjct: 102 INAEKGYVLTNNHVIKDADKITVQLQDGREFKAKVIGADEMSDVALIQIEKPKNLTALKI 161

Query: 175 EDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG---TFTQIDAPINQGNSG 231
            D++ +RVG+    IGNPF L  TV++GIVSAL R +    G    + Q DA +N+GNSG
Sbjct: 162 ADSDKLRVGDFTVAIGNPFGLGQTVTSGIVSALGRSMGSDSGMYENYIQTDAAVNRGNSG 221

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP  N  G +IG+N  I++    + G+   IP ++    +  ++  G V  G  GI    
Sbjct: 222 GPLINLNGELIGINTAIISPSGGNAGIAFAIPSNMANNLVQQILEFGEVRRGMLGIKGGE 281

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           L  +LA    +   KG+ ++ V+  S ADKAG+K GDVI  ++G+ + S  +   +IA+ 
Sbjct: 282 LNADLAQAFDIEAKKGAFVSEVIPGSAADKAGLKAGDVITAMNGQAVSSFAEMRAKIATS 341

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGS---SPTAKNDMHLEVGDKELLGMVLQDINDGNKKL 408
              ++++++  ++G  ++  V L S   + T+ N++        L G  L + ++   K 
Sbjct: 342 GAGKEIELTYLRDGKSNNTKVTLQSDEQTQTSANNLL-----PALEGAELNNYDEKGVKG 396

Query: 409 VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           V I  + PN     E +G++ G  I+ VN  ++  +  +     KA + K  +V L I
Sbjct: 397 VSISKIKPN--SLAEQRGLKSGDVIIGVNRQKIENLGQLR----KALDNKPSAVALNI 448


>gi|217971912|ref|YP_002356663.1| protease Do [Shewanella baltica OS223]
 gi|217497047|gb|ACK45240.1| protease Do [Shewanella baltica OS223]
          Length = 450

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 152/477 (31%), Positives = 246/477 (51%), Gaps = 53/477 (11%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPP-----SSVDLPPVIARVSPSIVSVMVEPK--KKVS 63
           S+ + A+     +   +V +A +P      S   L P++ R +P++VSV V      K  
Sbjct: 6   SVLSAAMLAATLTMMPVVSQAAIPQTVEGQSIPSLAPMLERTTPAVVSVAVTGTHVSKQR 65

Query: 64  VEQMFNAYGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGY 121
           V  +F  Y FG N P++   +  FR                       GSG  I  + GY
Sbjct: 66  VPDVFR-YFFGPNAPQEQVQERPFRG---------------------LGSGVIIDAEKGY 103

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+++      V L D  E+ AKL+GTD+  D+A+L++++ +  + ++  +++++R
Sbjct: 104 IVTNNHVIDGADDIQVGLHDGREVKAKLIGTDSESDIALLQIEA-KNLVAIKSSNSDDLR 162

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALG 239
           VG+    IGNPF L  TV++GIVSAL R     +    F Q DA IN GNSGG   N  G
Sbjct: 163 VGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLNG 222

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            +IG+N  IV  G  ++G+G  IP +++K  +  +   G V  G  GI  ++L  +LA  
Sbjct: 223 ELIGINTAIVAPGGGNVGIGFAIPANMVKNLVAQIAEHGEVRRGVLGISGRDLDSQLAQG 282

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL    G  +  V K+S A+KAG+K GD+I  +DGR IKS Q+   ++A+     +V++
Sbjct: 283 FGLDTQHGGFVNEVAKDSAAEKAGIKAGDIIISVDGRGIKSFQELRAKVATMGACAKVEL 342

Query: 360 SLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALN 415
            L ++G K +V V LG    +S +A   +H       L G  L++ + G  ++  +   +
Sbjct: 343 GLIRDGDKKTVKVTLGEASQTSESAAGAVH-----PMLQGASLENSSKG-IEITDVAQGS 396

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
           P         G+QKG  IV +N    + IKD++ L  + K+++  +V L+I  D  M
Sbjct: 397 P-----AAMSGLQKGDVIVGINR---TAIKDLKALKAQLKDQE-GAVALKIMRDKSM 444


>gi|83854913|ref|ZP_00948443.1| Putative trypsin-like serine protease [Sulfitobacter sp. NAS-14.1]
 gi|83842756|gb|EAP81923.1| Putative trypsin-like serine protease [Sulfitobacter sp. NAS-14.1]
          Length = 347

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 118/337 (35%), Positives = 190/337 (56%), Gaps = 17/337 (5%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHP--LKNYFRKDFHKFFSGEEPI 100
           ++ ++SP++V + V    + +  Q+        LPE  P  L+  F +   +  +G +P+
Sbjct: 19  LVEQISPAVVFIEVTGTAEQASAQV-------QLPEGMPEELRKRFEQLMPQGPAGAQPM 71

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF ++ DG I+T+NH+V    +  V L+D     AK+VG+D L D+AV
Sbjct: 72  HG-------LGSGFIVSKDGSIVTNNHVVAGADTVKVKLADGRSFDAKVVGSDVLTDIAV 124

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFT 219
           LKV++D     V+F  ++++RVG+ V  +GNPF L GTV+ GI+SA  R+I   P   F 
Sbjct: 125 LKVEADVDLPAVKFGSSDSMRVGDEVVAMGNPFGLGGTVTTGIISAKSRNINAGPYDDFI 184

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +P  +++  +  L   G 
Sbjct: 185 QTDAAINRGNSGGPLFNNAGEVIGVNTAILSPDGGSVGIGFSVPSDLVQDIVADLSDDGE 244

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           +  GW G+  + +T E+A  LGL   KG++I A+  +SPA KAG++ GD+I   D   IK
Sbjct: 245 ITRGWLGVQIRPMTAEVAQVLGLDAPKGAVIEAIGDDSPAKKAGLEKGDIILSFDDTEIK 304

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
             +D    +A   P+ + ++ +  +G + +  V +G+
Sbjct: 305 ELRDLTRAVAETDPEAKAEVMVLHKGKEVTRTVTIGT 341


>gi|311104979|ref|YP_003977832.1| serine protease MucD 2 [Achromobacter xylosoxidans A8]
 gi|310759668|gb|ADP15117.1| serine protease MucD 2 [Achromobacter xylosoxidans A8]
          Length = 480

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 221/425 (52%), Gaps = 31/425 (7%)

Query: 41  PPVIARVS----PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
           PP  A+++    P++V++ V   +KVS +            E  P   +F +       G
Sbjct: 54  PPNFAQITRDFGPAVVNISVSGTRKVSAD------------EGDPFAQFFGQ--IPGARG 99

Query: 97  EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
           + P  S  V     GSGF ++ DG ILT+ H+V+D    +V L+D  E  AK++G+D   
Sbjct: 100 QRP--SREVPMRGEGSGFIVSADGTILTNAHVVQDAKEVTVKLTDRREYKAKVLGSDPQT 157

Query: 157 DLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
           D+AVLK+  D K +PV +  D N ++VGE V  IG+P+ L  T +AGIVSA  R +PD  
Sbjct: 158 DVAVLKI--DAKNLPVVKVGDVNQLQVGEWVLAIGSPYGLENTATAGIVSAKGRSLPDDT 215

Query: 216 GT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q D  +N GNSGGP FN  G V+G+N+ I +      G+   IP+ +  K    +
Sbjct: 216 SVPFIQTDVAVNPGNSGGPLFNDRGEVVGINSQIYSRTGGFQGLSFSIPIDVAYKIKDQI 275

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           +  G+V H   G+  Q + Q+LA    L    G+L+++V K S ADKAG++ GDV+  +D
Sbjct: 276 LEHGKVQHARLGVTVQEVNQDLANSFKLDTPSGALVSSVEKGSAADKAGLQPGDVVRKID 335

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL- 393
           G+ I S  D    I   +P E++K+ + + GS+  +   LG  P  K+      G++E+ 
Sbjct: 336 GKTIVSSGDLASTITLATPGEKIKLDVWRNGSQKELVATLGGIP--KDKTQASAGEQEVQ 393

Query: 394 ---LGMVLQDINDGNKKLVRIVALNPNREREVEAK-GIQKGMTIVSVNTHEVSCIKDVER 449
              LG+ L+ ++   ++      L   R     AK GI+ G  ++S+N   V  +  V+ 
Sbjct: 394 RGQLGLALRPLSPQEQQAAGAEGLLIERSIGPAAKAGIEPGDVLLSLNGVPVHNVAQVKE 453

Query: 450 LIGKA 454
            + KA
Sbjct: 454 ALSKA 458


>gi|315499021|ref|YP_004087825.1| protease do [Asticcacaulis excentricus CB 48]
 gi|315417033|gb|ADU13674.1| protease Do [Asticcacaulis excentricus CB 48]
          Length = 498

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 145/445 (32%), Positives = 226/445 (50%), Gaps = 47/445 (10%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           +I RVSP++VS+  E K KV V       GF    +D        ++             
Sbjct: 66  IIERVSPAVVSI--ETKGKVKVPNGLIIPGFEPPSQDEGEGEGNEREVRGA--------- 114

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
                   GSGFFIT DGY++T+NH++E     +V+L+++ +L AK++G D   DLAVLK
Sbjct: 115 --------GSGFFITADGYVVTNNHVIEGADEITVVLTNEQKLTAKVIGRDPATDLAVLK 166

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT--- 219
           V+  + F  V+FE     RVG+ V  +GNPF L GT +AGIVSA  R  PD    +    
Sbjct: 167 VEG-KNFPFVQFETDQRPRVGDWVIAVGNPFGLSGTATAGIVSAFGR--PDGAQGYVDYM 223

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           QIDA IN+GNSGGP F+  G VIGVN+ I+T    + GVG  IP          L++ G+
Sbjct: 224 QIDAAINRGNSGGPTFDLNGRVIGVNSAIITPSGGNAGVGFAIPADTASAIARKLMAGGK 283

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V+ G+ G+    +T E    L L    G+ I  V K+ PA K G++VGD++  ++G+ +K
Sbjct: 284 VERGYIGVQILPVTDEYVESLSLPDKDGAYIADVTKDGPAAKGGVQVGDIVKKVNGKTVK 343

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL---------EVGD 390
            + D    +A   P E+V+I + + G    + +V    P  +++++          E G 
Sbjct: 344 LNTDLTRNVADVRPGEKVEIEVFRNGKMVKLTIVAALRP-GEDELNKVLNGGATTPETG- 401

Query: 391 KELLGMVLQDINDGNKKLVRI---------VALNPNREREVEAKGIQKGMTIVSVNTHEV 441
             +LG+ ++ ++  ++K   I          A+ P    +   KG++ G  IV  N   V
Sbjct: 402 APVLGLSVKPLDPASRKTYGIEADVSGLVVTAIEPT--SDAAKKGLKAGDVIVRANNLPV 459

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQI 466
           +   D ++++   K   R S+LL +
Sbjct: 460 ANRADFDKIVVDMKAANRPSILLLV 484


>gi|116749436|ref|YP_846123.1| protease Do [Syntrophobacter fumaroxidans MPOB]
 gi|116698500|gb|ABK17688.1| protease Do [Syntrophobacter fumaroxidans MPOB]
          Length = 475

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 149/457 (32%), Positives = 232/457 (50%), Gaps = 44/457 (9%)

Query: 31  AKLPPSSVDLPPVI---------ARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHP 81
           A+  P+  D P V          A+++P +V+V V    K+   +  +  G    PE  P
Sbjct: 29  AQAAPAEGDQPGVTPTSPFATLAAKLTPVVVNVRV---TKIERAEFPDFEG----PE-QP 80

Query: 82  LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSD 141
             ++FR     FF          V     GSG  I  DGY+LT+NH+VE     +V LSD
Sbjct: 81  FGDFFRH----FFGDRRGF--PNVPAQGAGSGVIIRGDGYVLTNNHVVEGAREVTVTLSD 134

Query: 142 DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
             E  A++VG DA  DLA+LK+++ +        D++ ++VG+ V  IGNPF L  TV++
Sbjct: 135 KQEHKARIVGRDAKTDLALLKIEAGKSLPAASLGDSDQLKVGDWVMAIGNPFGLSETVTS 194

Query: 202 GIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           GIVSA  R I   P   F Q DA IN GNSGGP FN  G V+G+N  I+ + Q   G+G 
Sbjct: 195 GIVSAKGRVIGAGPYDDFIQTDASINPGNSGGPLFNMKGEVVGINTAIIPNAQ---GIGF 251

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            IP++  K  IP L +KG V  G+ G+  Q++T +LA  +GL   KG+L+  VV+  PAD
Sbjct: 252 AIPVNTAKPLIPQLETKGEVTRGYLGVSIQSITPDLASAMGLGDGKGALVADVVEGGPAD 311

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG---SS 377
           +AG++ GDVI    G+ +K   D  + +A+     +  +++ +EG +  + V +G   S 
Sbjct: 312 RAGIRRGDVILAFGGKDVKDSHDLSFMVAAAPVGRESAVTIMREGVERRLDVKIGKQESE 371

Query: 378 PTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREV---------EAKGIQ 428
             AK +   +   K   G+ L+D+     ++   + L   R   V         +   ++
Sbjct: 372 EGAKEEFSKQAHGK--WGLQLRDV---PPRVAEELGLESERGALVAGVLPGSPADRAALR 426

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
           +G  I+ VN   V+   +++  I  A E+    +L+Q
Sbjct: 427 QGDVILEVNRQPVTSASELKERIAGAGERGALVLLVQ 463


>gi|148550710|ref|YP_001260149.1| protease Do [Sphingomonas wittichii RW1]
 gi|148503129|gb|ABQ71382.1| protease Do [Sphingomonas wittichii RW1]
          Length = 501

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 138/416 (33%), Positives = 217/416 (52%), Gaps = 48/416 (11%)

Query: 90  FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV-EDGA----SFSVILSDDTE 144
           F +FF    P    T E    GSGF ++ DGYI+T+NH++  DG     + +V L +  E
Sbjct: 82  FERFFG--SPTGPRTREAQSLGSGFILSADGYIVTNNHVITADGQGKVETITVTLHNGEE 139

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
            PA LVG+D   DLAVLK+ + RK +P V F D+  +RVG+ V  IGNPF L GTV+AGI
Sbjct: 140 YPATLVGSDPASDLAVLKI-TLRKPLPFVTFGDSTRVRVGDWVLAIGNPFGLGGTVTAGI 198

Query: 204 VSALDRDIP-----DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           VSA+ R+       DR   + Q DA IN+GNSGGP F++ G VIG+N  I +    ++G+
Sbjct: 199 VSAVYRNTGTGRAYDR---YLQTDASINRGNSGGPMFDSSGRVIGINNAIFSPTGGNVGI 255

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  IP  I    +  L +   ++ G+ G+  Q +T++LA  LG+   +G  + +V    P
Sbjct: 256 GFAIPAEIAAPIVEKLKAGKAIERGYLGVTIQPMTEDLASSLGVPRDRGEFVQSVEPGGP 315

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A +AG++ GDVI  +DG+ +   Q   + +AS  P  +V + L +   + +V       P
Sbjct: 316 AAQAGIRAGDVILRVDGKEVTPSQSLSFLVASVEPGRKVAVELMRGNQRMTVTATPVLRP 375

Query: 379 T---------AKNDMHLEVGDKE-------LLGMVLQDINDGNKK-----------LVRI 411
           +          ++D   +  DK+        LG+ ++ +  G  +           ++  
Sbjct: 376 SEDKLARQGFGRDDRRFDNFDKDRASPSEKTLGLAVEPLTPGIARQLGASDVSQGLVISS 435

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
           V  N +  R    KG+ +G  I+S N   V+   D+E  I +A+   R ++LL++K
Sbjct: 436 VEGNSDAAR----KGLSRGDIILSANNRPVASAADLEAAIRQARTAGRSAILLRVK 487


>gi|295688442|ref|YP_003592135.1| protease Do [Caulobacter segnis ATCC 21756]
 gi|295430345|gb|ADG09517.1| protease Do [Caulobacter segnis ATCC 21756]
          Length = 528

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 141/408 (34%), Positives = 212/408 (51%), Gaps = 39/408 (9%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV----QSD 166
           GSGFFI+ DGYI+T+NH+V D     V++ D  EL A LVG D   DLAV+KV      +
Sbjct: 127 GSGFFISADGYIVTNNHVVADADDIQVVMKDGRELKATLVGRDEGTDLAVIKVVDPKSKN 186

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDA 223
            +F  V FE+    RVG+ V TIGNPF L GT +AGI+SA  R++ D   +F    QIDA
Sbjct: 187 TEFPYVNFENQAKPRVGDWVITIGNPFGLGGTATAGIISAYGRNLGDTTSSFVNYIQIDA 246

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
           PIN+GNSGGP F+  G VIGVN+ I +     +G+G  IP  + +     LI+ G+V  G
Sbjct: 247 PINRGNSGGPSFDIYGRVIGVNSAIYSPSGGSVGIGFAIPADVAEDTAKQLIAGGKVVRG 306

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           + G+  Q+   E A  +GL+  KG+++  VV   PA KAG+   D++  ++G  +    +
Sbjct: 307 YIGVSIQDFNAEAAEAMGLKDVKGAIVAEVVAGGPAAKAGLLPDDILVGVNGVKVADRSE 366

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA------KNDMHLEVG-----DK- 391
              ++A   P E +K+S+ ++G    V V  G+ P+       ++D   + G     DK 
Sbjct: 367 LTREVAKARPGEIIKMSILRDGKPRIVDVRSGTRPSENALTANEDDQDQDNGGAPAPDKP 426

Query: 392 -----ELLGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTH 439
                E LG+ L  I+   ++  +I       +      + +   KG+ KG  + ++N  
Sbjct: 427 ATQRIEALGLTLAPIDAAARQTYKIDSEIKGLLITGVKGDSDAGEKGLAKGDVLANINGA 486

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            V+   DV   +  AK+  R  VL+++           N   FV LKI
Sbjct: 487 PVTSAADVNAAVAAAKKVGRTGVLVKVI--------RGNRPVFVPLKI 526


>gi|220917263|ref|YP_002492567.1| protease Do [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955117|gb|ACL65501.1| protease Do [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 524

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 144/456 (31%), Positives = 230/456 (50%), Gaps = 37/456 (8%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMF----NAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           L P+I ++ P++V++      K    Q      N +G G  P++      F   F ++F 
Sbjct: 62  LAPLIDKLRPAVVNISTTTVTKHPRVQRGPRGQNPHG-GGTPDEG-----FEDFFERYFG 115

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
              P + +  +    GSGF +  +GYILT+NH+V+D     V LSDD E  A++VG D L
Sbjct: 116 RPAPEMPEEFKGSSLGSGFLLNTEGYILTNNHVVKDATDIRVRLSDDREFGARIVGRDPL 175

Query: 156 FDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
            D+A++++ +  K +P V   D++ +R G+ V  +G+PF LR T + GIVSA  R   + 
Sbjct: 176 TDVALIQLVNPPKNLPTVVLGDSDALRQGDFVLALGSPFGLRDTATLGIVSAKHRPGINP 235

Query: 215 PGT---FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
            GT   F Q DA IN GNSGGP FN  G V+G+N  IV S Q   G+G  +P+++ K  +
Sbjct: 236 GGTYDDFIQTDAAINPGNSGGPLFNLRGEVVGINTAIV-SPQIGQGIGFAVPINMAKALL 294

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTKGSLITAVVKESPADKAGMKVGDVI 330
           P L  KG+V  G+ G+   +L+ +L    GL+ GTKG+L+  VV  SPADKAG++ GDV+
Sbjct: 295 PQLKEKGKVTRGFLGVSVSDLSPDLIQGFGLQSGTKGALVQNVVPRSPADKAGLQPGDVV 354

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD 390
             L+ + +++       +A  SP +   +++ + G K   AV +   P     +      
Sbjct: 355 VALNDKTVETAGALTRGVALVSPGQTANLTVLRGGQKKQFAVKVVQRPEDGEAVGRNEQG 414

Query: 391 KELLGMVLQDINDGNKKLVRIVALNPNRERE-------------------VEAKGIQKGM 431
               G      +   K  V I  + P+  R+                    +  GI++G 
Sbjct: 415 GGDEGGGQGARDQSPKLGVSIAPITPDVARQFGVEPGEGVVVADVTEGGPADRAGIRRGD 474

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            I+  N  +V+  +D+   + K KE   D  LL+++
Sbjct: 475 VILEANRQKVARPEDMRSAVAKLKEG--DMALLRVR 508


>gi|225023804|ref|ZP_03712996.1| hypothetical protein EIKCOROL_00669 [Eikenella corrodens ATCC
           23834]
 gi|224943403|gb|EEG24612.1| hypothetical protein EIKCOROL_00669 [Eikenella corrodens ATCC
           23834]
          Length = 486

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 120/320 (37%), Positives = 175/320 (54%), Gaps = 16/320 (5%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVE----RLMFGSGFFITDDGYILTSNHIVED 131
           LPE+ P        F +FF   +P  SD +E       FGSGF I+ DGYILT+ H++  
Sbjct: 86  LPENDP--------FSEFFKRLQPSQSDLIEPGDDEYNFGSGFLISSDGYILTNTHVLSG 137

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIG 190
             S  V+L++  E  A+LVG+D   D+A+LK+  D + +P V+  D   +RVGE V  IG
Sbjct: 138 MNSIKVVLNNRREYTARLVGSDTQTDIALLKI--DAQGLPTVKIGDPKTLRVGEWVAAIG 195

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
            PF    +V+AGIVSA  R +P+   T F Q D  IN GNSGGP FN  G V+GVN+ I 
Sbjct: 196 APFGFDNSVTAGIVSAKGRSLPNENYTPFIQTDVAINPGNSGGPLFNLRGQVVGVNSQIY 255

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +     MG+   IP+ +       L   G+V+ G  G++ Q ++ +LA   GL+   G+L
Sbjct: 256 SQSGGFMGISFAIPIDVAMNVADQLRRNGKVERGRIGVVIQEVSYDLAKSFGLQAANGAL 315

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           I+ V    PADKAG++ GD++  ++G  +K+  D    +    P  Q+ + + + G +  
Sbjct: 316 ISQVTPGGPADKAGLQPGDIVQSVNGENVKASSDLPVLVGMMPPGTQLTLGIWRNGKREE 375

Query: 370 VAVVLGSSPTAKNDMHLEVG 389
           V V LGSS T   D   + G
Sbjct: 376 VQVTLGSSNTGNADTGNQSG 395


>gi|182414154|ref|YP_001819220.1| protease Do [Opitutus terrae PB90-1]
 gi|177841368|gb|ACB75620.1| protease Do [Opitutus terrae PB90-1]
          Length = 471

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 131/389 (33%), Positives = 209/389 (53%), Gaps = 17/389 (4%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSV--MVEPKKK 61
           R + S+ SI   +    +        + K P  ++D  PV A  S  + S   ++EP +K
Sbjct: 4   RSLASLLSIAIASAVPFVAHGKEAKPDRKPPTLAIDPSPVTAGKSALVTSYADILEPAQK 63

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
             V    + Y    + E   L  + R+    FF  E P      +    GSG  ++ DGY
Sbjct: 64  AVV----SVYSMKIVRERMALNPFLRQ----FFGNEIPDQERERKEEGLGSGVIVSPDGY 115

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           ILT+NH+VE      V+L+DD E  AK++G D   D+AV+K++ +R  + V   D++NIR
Sbjct: 116 ILTNNHVVEGADELKVLLADDREFIAKVIGADPKTDIAVIKIEGERLPV-VTLADSDNIR 174

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDI---PDRPG--TFTQIDAPINQGNSGGPCFN 236
           VG+ VF +GNP  +  TV+ GIVSA  R +    +  G  +F Q DA IN GNSGG   +
Sbjct: 175 VGDVVFAVGNPLAVGQTVTMGIVSAKGRSVGILDEVAGYESFIQTDAAINMGNSGGALVD 234

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
           A G ++G+N+ I++  + ++G+G  +P+++    + SLI  G V  G+ G+ +Q L  + 
Sbjct: 235 AKGRLVGINSAILSPSRGNIGIGFAVPVNLAATVMHSLIETGTVSRGYLGVQSQTLAADE 294

Query: 297 AIPLGL-RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           A   GL R TKG  IT V  +S ADK G+KVGDV+  ++ + + + +D    IA  +P  
Sbjct: 295 AEAFGLPRDTKGVTITDVTPDSAADKGGLKVGDVVLSVNDKPVAALRDLRIYIAQTAPGS 354

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDM 384
           +VK+ + ++G    + +VLG      N++
Sbjct: 355 KVKLKISRDGKPQVLDIVLGKLDEKPNEL 383


>gi|153874555|ref|ZP_02002730.1| Periplasmic serine protease [Beggiatoa sp. PS]
 gi|152068980|gb|EDN67269.1| Periplasmic serine protease [Beggiatoa sp. PS]
          Length = 431

 Score =  206 bits (525), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 189/341 (55%), Gaps = 17/341 (4%)

Query: 78  EDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV 137
           +D P  ++FR  F      E P  S        GSGF I+ DGYI+T+NH++E+     V
Sbjct: 28  KDSPFHDFFRHFFENEDFEEHPSTS-------LGSGFIISSDGYIVTNNHVIEEAEEIIV 80

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLR 196
            LS+  E  A+L G D   D+A+LKV  D   +P V+   +N+++VGE V  IG+PF   
Sbjct: 81  RLSNRQEYKAELKGADKRSDIALLKV--DATDLPIVQLGSSNDLKVGEWVLAIGSPFGFE 138

Query: 197 GTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
            +V+AGIVSA  R +P +    F Q D  IN GNSGGP FN  G VIGVN+ I +     
Sbjct: 139 HSVTAGIVSAKGRSLPRENYVPFIQTDVAINPGNSGGPLFNLKGQVIGVNSQIYSRTGGF 198

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           MG+   IP+ ++K  +  L  +G+V  GW G++ Q++TQ LA   G+   +G+L+  V+ 
Sbjct: 199 MGLSFAIPVDVMKTVVEQLKKRGKVSRGWLGVLIQDVTQNLAESFGMERPQGALVAKVLP 258

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           ESPA+ A  +VGD+I    G+ I+   D    + S     +V+ S+ +EG + ++ VV+G
Sbjct: 259 ESPAETATFQVGDIIVSFAGKNIERSADLPPIVGSTDVGSKVQTSVIREGKQVTLEVVIG 318

Query: 376 SSPTAKNDMHLEVGDK-----ELLGMVLQDINDGNKKLVRI 411
             P  + D+ L V  K       LG+ + D+ +  ++ + I
Sbjct: 319 ELP-PEEDIQLAVSSKGTATFNRLGLSVIDLEEEKRETLGI 358


>gi|163853228|ref|YP_001641271.1| protease Do [Methylobacterium extorquens PA1]
 gi|163664833|gb|ABY32200.1| protease Do [Methylobacterium extorquens PA1]
          Length = 496

 Score =  206 bits (525), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 155/478 (32%), Positives = 240/478 (50%), Gaps = 25/478 (5%)

Query: 22  FSSTYLVLEAKLPPSSVDLPP-----VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
            +  Y     K P  + D PP     V+ +V P +V+V V  K   S +   ++ G  N+
Sbjct: 32  MTPAYAQALPKTPIEAPDQPPGSFANVVDKVKPGVVAVKV--KLDDSADDDDDSPGGPNM 89

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
            +  P      ++F K F    P       R   GSGF I+ DGY++T+NH+V+   +  
Sbjct: 90  QQVPPQ----LREFFKRFGQGGPGGRGMRPRGGVGSGFIISADGYVVTNNHVVDKAKTVQ 145

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V L D   L AK++G D+  D+A+LK+     +  V+F      RVG+ V  IGNPF L 
Sbjct: 146 VTLDDGRTLDAKVIGKDSKTDIALLKITESGSYPYVQFGKGAP-RVGDWVLAIGNPFGLG 204

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV+ GIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+GVN  I +     
Sbjct: 205 GTVTVGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGVNTAIASPSGGS 264

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  IP   ++  +  L + G+V  G+ G+  Q +T+++A  LGL   KG+L+     
Sbjct: 265 VGLGFAIPAETVQTVVDQLRTDGKVVRGYLGVQVQPVTKDIAEGLGLDKAKGALVNDAES 324

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
            +PA KAG+K GDVI  ++G  + + +D    IA   P  +VK++  + G      V LG
Sbjct: 325 GTPAAKAGLKSGDVIESVNGVPVNNARDLSRLIAGLKPGTEVKLAYLRGGKSEVATVELG 384

Query: 376 SSP----TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGM 431
           + P     A+       G +  LG+ L   ++       +  ++ + +    A+GI +G 
Sbjct: 385 TLPGDSKVARRGDEAPSG-QARLGLSLAPASEIGLGDEGVAVMDVDPDGPAAARGISQGD 443

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            I+ V    VS   +V+  I  A+   R +VL+++K            +RF+++ + K
Sbjct: 444 VILDVAGTSVSKPSEVQAQIRAAESSGRKAVLMRVKS-------ARGQTRFIAVPLTK 494


>gi|254512185|ref|ZP_05124252.1| MucD serine protease MucD [Rhodobacteraceae bacterium KLH11]
 gi|221535896|gb|EEE38884.1| MucD serine protease MucD [Rhodobacteraceae bacterium KLH11]
          Length = 477

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 140/470 (29%), Positives = 243/470 (51%), Gaps = 37/470 (7%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           L P+  ++SP++V++         +E      G   +PE  P +++FR+   +   G + 
Sbjct: 25  LAPLAEQISPAVVNITT----STLIEGQTGPQGI--VPEGSPFEDFFREFQDRNDDGGDE 78

Query: 100 ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV-ILSDD----TELPAKLVGTDA 154
             S        GSGF I++DGYI+T+NH++ +     V     D     ELPAK++GTD 
Sbjct: 79  --SRPRRSNALGSGFVISEDGYIVTNNHVIAEADEILVEFFPGDGQPVKELPAKVIGTDE 136

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             D+A+LKV+++     V+F +++  RVG+ V  +GNP     +VSAGI+SA +R +   
Sbjct: 137 KTDIALLKVEAEGPLKYVKFGNSDVARVGDWVIAMGNPLGQGFSVSAGIISARNRALSGS 196

Query: 215 PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++ K +  L
Sbjct: 197 YDDYIQTDAAINRGNSGGPLFNMNGEVIGVNTAILSPTGGSIGIGFSMASNVVTKVVDQL 256

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
              G    GW G+  Q++T+++A  +GL    G+LI+  V + PA  AG+  GDVI   D
Sbjct: 257 REFGETRRGWLGVRIQDVTEDMAEAMGLDKPGGALISD-VPDGPAKDAGLLAGDVILSFD 315

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE------- 387
           G  ++  +  V Q+   +  + V++ + ++G   +V V LG    A+   + E       
Sbjct: 316 GVEVEDTRALVRQVGETTVGKSVRVVVHRDGGTQTVLVTLGRREDAERAENGEEEAPEAQ 375

Query: 388 -VGDKELLGMVLQDINDGNKKLVRIVA-------LNPNREREVEAKGIQKGMTIVSVNTH 439
              +K++LG+ +  ++D  ++ + + A        N +   E   KG++ G  I      
Sbjct: 376 DEENKDILGLTIAPLSDTQREELGLDADAEGLLVTNVDEASEAFEKGLRAGDLITEAGQQ 435

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +V+ I D+E  + +A+E  R S+LL ++   +         RFV+L +++
Sbjct: 436 KVTSISDLEARMEEAREAGRKSLLLLVRRGGE--------PRFVALSLEE 477


>gi|260582934|ref|ZP_05850718.1| periplasmic serine peptidase DegS [Haemophilus influenzae NT127]
 gi|2935168|gb|AAC38203.1| HtrA [Haemophilus influenzae]
 gi|260094034|gb|EEW77938.1| periplasmic serine peptidase DegS [Haemophilus influenzae NT127]
          Length = 463

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 130/448 (29%), Positives = 233/448 (52%), Gaps = 23/448 (5%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + ++AL   + S+++ V +A LP        L P++ +V P++V++ VE K KV     F
Sbjct: 8   LNSIALGLSVLSTSF-VAQATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPF 66

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILTSN 126
                 ++PE+   K +F   F + F G      ++       GSG  I    GY+LT+N
Sbjct: 67  ----LDDIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLTNN 116

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H++++    +V L D  E  AKLVG D L D+A+++++       ++F D++ +RVG+  
Sbjct: 117 HVIDEADKITVQLQDGREFKAKLVGKDELSDIALVQLEKPSNLTEIKFADSDKLRVGDFT 176

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIG 243
             IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +IG
Sbjct: 177 VAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGELIG 236

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    + 
Sbjct: 237 INTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVS 296

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++  +
Sbjct: 297 AQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLR 356

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVE 423
           +G  H V + L +  +++     E+    L G  L+D +    K + I  + PN      
Sbjct: 357 DGKSHDVKMKLQADDSSQLSSKTEL--PALDGATLKDYDAKGVKGIEITKIQPN--SLAA 412

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLI 451
            +G++ G  I+ +N   +  I+++ +++
Sbjct: 413 QRGLKSGDIIIGINRQMIENIRELNKVL 440


>gi|114564523|ref|YP_752037.1| protease Do [Shewanella frigidimarina NCIMB 400]
 gi|114335816|gb|ABI73198.1| peptidase Do. Serine peptidase. MEROPS family S01B [Shewanella
           frigidimarina NCIMB 400]
          Length = 449

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 144/452 (31%), Positives = 234/452 (51%), Gaps = 51/452 (11%)

Query: 35  PSSVD------LPPVIARVSPSIVSVMVEPKK--KVSVEQMFNAYGFG-NLPEDHPLKNY 85
           P +VD      L P++ R +P++VSV V   +  K  V  +F  Y FG N P++   +  
Sbjct: 29  PQAVDGQAIPSLAPMLERTTPAVVSVAVSGTQVSKQRVPDVFR-YFFGPNAPQEQVQERP 87

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTE 144
           FR                       GSG  I  D GYI+T+NH++       + L D  E
Sbjct: 88  FRG---------------------LGSGVIIDADKGYIITNNHVINGADDIQIGLHDGRE 126

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
           + AKL+G D   D+A+L++++ +  I ++  D++ IRVG+    IGNPF L  TV++GIV
Sbjct: 127 VKAKLIGADKESDIALLQIEA-KNLIAIKQTDSDEIRVGDFAVAIGNPFGLGQTVTSGIV 185

Query: 205 SALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           SAL R     +    F Q DA IN GNSGG   N  G +IG+N  IV     ++G+G  I
Sbjct: 186 SALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLKGELIGINTAIVAPNGGNVGIGFAI 245

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P +++   +  +I  G V  G  G+  ++L  ELA   GL    G  +  V+ +S ADKA
Sbjct: 246 PANMVNNLVEQIIEHGEVRRGVLGVSGRDLDNELAKAFGLDTQHGGFVNEVMPKSAADKA 305

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN 382
           G+K GD+I  L+GR IK+ Q+   ++A+     +V+  + ++G K ++   LG +    +
Sbjct: 306 GLKAGDIITSLNGRSIKTFQELRAKVATMGAGAEVEFGIIRDGDKKTIKTTLGEA----D 361

Query: 383 DMHLEVGDKE--LLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
            +  E G+    L G  L+D    +KK ++I  +       +   G+QKG  IV +N ++
Sbjct: 362 KVEAEAGNVHPMLQGATLED----SKKGIQITEIAQGSPAAMS--GLQKGDLIVGLNRNK 415

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
           V+ +K ++ ++    +  ++SV L+I  D ++
Sbjct: 416 VTSLKALKEML----KDNQNSVALKILRDNNL 443


>gi|170720256|ref|YP_001747944.1| protease Do [Pseudomonas putida W619]
 gi|169758259|gb|ACA71575.1| protease Do [Pseudomonas putida W619]
          Length = 479

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 138/435 (31%), Positives = 220/435 (50%), Gaps = 28/435 (6%)

Query: 28  VLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKKKVSVEQMFNAYGFGNLPEDHPLKN 84
           VL A+   +  D   ++ + SP++V++  +   P ++++  QM         P+   L  
Sbjct: 22  VLSAQAEEALPDFTTLVEQASPAVVNISTKQKLPDRRIAAGQM---------PDLEGLPP 72

Query: 85  YFRKDFHKFFSGE--EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
            FR+ F +    +   P      E    GSGF I+ DGY+LT+NH+V D     V LSD 
Sbjct: 73  MFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYVLTNNHVVADADEIIVRLSDR 132

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
           +EL AKLVGTD   D+A+LKV  D K +P V+  D+  ++VGE V  IG+PF    +V+ 
Sbjct: 133 SELQAKLVGTDPRTDVALLKV--DGKNLPTVKLGDSEKLKVGEWVLAIGSPFGFDHSVTK 190

Query: 202 GIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           GIVSA  R +P D    F Q D  IN GNSGGP FN  G V+G+N+ I T     MG+  
Sbjct: 191 GIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMNGEVVGINSQIFTRSGGFMGLSF 250

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+  V+++ PA 
Sbjct: 251 AIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFGLDKPAGALVAQVLEDGPAA 310

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
           K+G++VGDVI  ++G+ I    D    + +     + K+ + + G + ++ V +G+ P  
Sbjct: 311 KSGLQVGDVILSMNGQPIVMSADLPHLVGTLKAGAKAKLEIIRNGKRQNLDVTIGAMPDD 370

Query: 381 KNDMHLEVG-------DKELLGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKG 430
             D+    G           LG+ + D+    KK + +   V +   ++      G++ G
Sbjct: 371 DADIGTGTGADGSAERSSNRLGVSVSDLTAEQKKSLELKGGVVIKEVQDGPAAMIGLRPG 430

Query: 431 MTIVSVNTHEVSCIK 445
             I  +N   ++  K
Sbjct: 431 DVISHLNNQAIASAK 445


>gi|34498749|ref|NP_902964.1| periplasmic serine protease [Chromobacterium violaceum ATCC 12472]
 gi|34332874|gb|AAQ60958.2| periplasmic serine protease [Chromobacterium violaceum ATCC 12472]
          Length = 488

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 137/428 (32%), Positives = 220/428 (51%), Gaps = 19/428 (4%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   +++R  P++V++    +   +  Q      F  +PED PL ++FR+    F   + 
Sbjct: 46  DFTQLVSRDGPAVVNIQATREGGGAAPQQSGNMPF-PVPEDDPLYDFFRR----FMPNQP 100

Query: 99  PILSDTVER-LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
           P      E  + +GSGF I+ DG+ILT+ H+V DG    V L+D  EL AKLVG D   D
Sbjct: 101 PQQEQGPEESVSYGSGFIISSDGFILTNAHVVADGGQIRVTLTDKRELRAKLVGLDKRSD 160

Query: 158 LAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG 216
           +A+LKV +    +PV +  +  +++VGE V  IG PF    TV+AGIVSA  R +PD   
Sbjct: 161 VALLKVAAAD--LPVAKIGNPADLKVGEWVAAIGAPFGFDNTVTAGIVSAKGRSLPDETL 218

Query: 217 T-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q D  IN GNSGGP FN  G V+G+N+ I +     MG+   IP+ +  +    L 
Sbjct: 219 VPFIQTDVAINPGNSGGPLFNLRGEVVGINSQIYSRSGGFMGISFAIPIDLAMQVADQLK 278

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
           +KG+V  G  G+  Q +TQELA   GL+   G+L+  V  + PA +AG++ GD+I  L+ 
Sbjct: 279 TKGKVSRGQLGVNIQEVTQELAQSFGLQRPSGALVVRVDPKGPAARAGLQAGDIILKLNN 338

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL-------GSSPTAKNDMHLEV 388
           + I S +D    + S  P  ++K+ + ++G + ++   L       GS+    +D   + 
Sbjct: 339 QSIDSSKDLPMLVGSLGPGTKIKLVVWRKGFEKTMEATLVEQAQEPGSNTKPASDNSPQG 398

Query: 389 GDKELLGMVLQDINDGNKK--LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
                LG+ L ++    +    +R   L    +      G+  G  I+ +N ++++ I  
Sbjct: 399 YQFGKLGLTLSELTAEQRGDLGIRGGLLIQKSQGPAARSGLMPGDIILGLNQNDITSISA 458

Query: 447 VERLIGKA 454
            E+ +  A
Sbjct: 459 FEKALASA 466


>gi|251771975|gb|EES52547.1| Peptidase S1C, Do [Leptospirillum ferrodiazotrophum]
          Length = 503

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 144/416 (34%), Positives = 224/416 (53%), Gaps = 31/416 (7%)

Query: 78  EDHPLKNYFRKDFHKFFSGEEPILSDT------VERLMFGSGFFITDDGYILTSNHIVED 131
           E H L   F   F K F G  P  +        VER + GSGF I+ DG I+T+NH+V++
Sbjct: 85  EPH-LPPMFDDPFFKRFFGTPPFGNGNQAPQKHVERSL-GSGFIISSDGVIVTNNHVVKN 142

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
               +V+L++     AK++GTD + D+AV+K+ +      V + D+ N+ VG  V  +G+
Sbjct: 143 ATKVTVLLNNRKSYQAKVLGTDPMTDIAVIKINARTPLPTVTWGDSKNVDVGTIVLAMGS 202

Query: 192 PFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           PF L  +V+ GIVSAL R     ++   F Q DA IN GNSGGP  N  G V+G+N  I 
Sbjct: 203 PFGLTQSVTMGIVSALKRSNMGIEQYENFIQTDAAINPGNSGGPLVNLRGEVVGMNTAIY 262

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           T+   + G+G  IP++++++ +  L++KG+V  GW GI  QN+T  +A   GL+   G L
Sbjct: 263 TTNGGYEGIGFAIPVTMVRQVVQDLMTKGKVVRGWLGISIQNVTPVIAKQFGLKKNSGVL 322

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           ++ V+  SPA  A +K GDVI  L+G  ++   D    +A   P +   ++L +EG    
Sbjct: 323 VSDVLPGSPAQAAHLKRGDVITALNGTTVEDANDLRMHVARIPPGKTATLTLVREGKVRK 382

Query: 370 VAVVLGSSPT--AKNDMHLE--VGDKE--LLGMVLQDIN-DGNKKL--------VRIVAL 414
           + V +G  P   A N    E   G+ +  L G+ + D+N D  ++L        V + A+
Sbjct: 383 IDVRVGELPKKLAMNQERHEGSAGNFKNVLRGLRILDLNGDIRQQLGIPESVHGVVVQAV 442

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS-VLLQIKYD 469
            P     VEA G+++G  IV V+   V  ++D  R+   A++   D+ VLL I +D
Sbjct: 443 QPG--SAVEAAGLRRGDLIVEVDRKPVRSVRDFVRV---ARKIPADTEVLLTILHD 493



 Score = 37.7 bits (86), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 50/86 (58%), Gaps = 5/86 (5%)

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
           +  ++ Q+L IP  + G    ++ AV   S  + AG++ GD+I  +D + ++S +DFV +
Sbjct: 420 LNGDIRQQLGIPESVHGV---VVQAVQPGSAVEAAGLRRGDLIVEVDRKPVRSVRDFV-R 475

Query: 348 IASRSPKE-QVKISLCKEGSKHSVAV 372
           +A + P + +V +++  +G    V+V
Sbjct: 476 VARKIPADTEVLLTILHDGRHSYVSV 501


>gi|255263637|ref|ZP_05342979.1| protease do [Thalassiobium sp. R2A62]
 gi|255105972|gb|EET48646.1| protease do [Thalassiobium sp. R2A62]
          Length = 486

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 150/486 (30%), Positives = 241/486 (49%), Gaps = 48/486 (9%)

Query: 21  IFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDH 80
           + + T+       P S  DL     ++SPS+V++        +V       G   +PE  
Sbjct: 29  VIAQTFAAQAQDRPASLADLA---EQISPSVVNI----TTTTTVAGRTGPQGV--VPEGS 79

Query: 81  PLKNYFRKDFHKFFSGEEPILSDTVERL-MFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
           P +++F          E P       R    GSGF I++DGYI+T+NH++E      +  
Sbjct: 80  PFEDFFN---------ELPDRKGAPRRSSALGSGFVISEDGYIVTNNHVIEGADEILIEF 130

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDR--KFIPVEFEDANNIRVGEAVFTIGNPFRLRG 197
            +  ELPA+LVGTD   D+A+LKV++D   KF+P  F D++  RVG+ V  +GNP     
Sbjct: 131 FEGFELPAELVGTDPNTDIALLKVEADEALKFVP--FGDSDISRVGDWVIAMGNPLGQGF 188

Query: 198 TVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     +G
Sbjct: 189 SVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPNGGSIG 248

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL-GLRGTKGSLITAVVKE 316
           +G  +  +++ + +  L   G    GW G+  Q++T ++   + GL    G+LIT  V  
Sbjct: 249 IGFSMASNVVTRVVDQLQEFGETRRGWLGVRIQDITPDMMDAIAGLESVNGALITD-VPP 307

Query: 317 SPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
            PA++AG   GDVI   DG  +   +  V  + +      V++ + ++G+  ++ V LG 
Sbjct: 308 GPAEEAGFLAGDVILSFDGTDVDDTRGLVRTVGNTQVGAAVRVVVLRDGATETILVTLGR 367

Query: 377 SPTAKNDMHLEVGDK--------ELLGMVLQDIN-------DGNKKLVRIVALNPNRERE 421
             TA+  +               E+LGM L +I+       DG   L  ++  N + E E
Sbjct: 368 RETAEAAVPAVAPAPEPEEPTEIEVLGMTLVEISDEMRAEIDGISDLKGLLVANVDEETE 427

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSR 481
              KG+++G  I      ++  I D++  + +A+E  R S+LL ++ D D         R
Sbjct: 428 AFEKGLRQGDVITEAGQQKIESIGDLQDRLAEAEEAGRKSILLLVRRDGD--------PR 479

Query: 482 FVSLKI 487
           FV++ +
Sbjct: 480 FVAISL 485


>gi|124516215|gb|EAY57723.1| Peptidase S1C, Do [Leptospirillum rubarum]
          Length = 500

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 134/409 (32%), Positives = 217/409 (53%), Gaps = 35/409 (8%)

Query: 85  YFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
           +FR+ F   F+         VER + GSGF I+ DGYI+T+ H+++     +V+LSD T 
Sbjct: 93  FFRQFFGTPFNHGGGPPQKHVERSL-GSGFIISKDGYIVTNYHVIKHATKVTVVLSDKTS 151

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
             AK+VG D + D+AV+++        + +  + ++ VG  V  +G+PF L  +++ GIV
Sbjct: 152 YRAKVVGKDPMTDVAVIRIHPKHDLPVIRWGSSRDVSVGTIVLAMGSPFGLTQSITMGIV 211

Query: 205 SALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           SAL R     ++   F Q DA IN GNSGGP  N  G VIG+N  I T+   + G+G  I
Sbjct: 212 SALKRSNMGIEQYENFIQTDAAINPGNSGGPLVNLKGEVIGMNTAIYTTNGGYEGIGFAI 271

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P+ ++++ +  L++KG+V  GW G+  QN+T  +A    L G +G L++ V+  SPA KA
Sbjct: 272 PVDMVRRVLKDLMTKGKVVRGWLGVSIQNVTPVIAKQFRLPGHRGVLVSDVLPNSPAKKA 331

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-- 380
           GMK GDVI  L+G+ +    D   +++  +P     +S+ ++G + ++ V +G  P+   
Sbjct: 332 GMKRGDVILGLNGQDVMDANDLRLRVSQIAPGTDATLSIIRDGRRRNITVRVGELPSKLS 391

Query: 381 --------KNDMHLEVGDKELLGMVLQDIND---------GNKKLVRIVALNPNREREVE 423
                   K+  H    D  L G+++ D+N           N + V I A+ P      E
Sbjct: 392 MMGGAEPEKSPSHF---DNVLNGIMVMDLNRDIRGQLNLPDNTRGVVISAIAPG--SLAE 446

Query: 424 AKGIQKGMTIVSVNTHEVSCIK---DVERLIGKAKEKKRDSVLLQIKYD 469
           A G+++G  I  +N   V+ +     V R IGK+     ++VLL +  D
Sbjct: 447 ASGLKRGDVIQEINRRPVTSVHAYIRVARHIGKS-----ENVLLTVLRD 490



 Score = 37.4 bits (85), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL-RGTKGSLITAVVKESPADKA 322
           LS++  A P   S    D+   GIM  +L +++   L L   T+G +I+A+   S A+ +
Sbjct: 390 LSMMGGAEPEK-SPSHFDNVLNGIMVMDLNRDIRGQLNLPDNTRGVVISAIAPGSLAEAS 448

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           G+K GDVI  ++ R + S   ++         E V +++ ++G    V++
Sbjct: 449 GLKRGDVIQEINRRPVTSVHAYIRVARHIGKSENVLLTVLRDGHHSYVSL 498


>gi|303258469|ref|ZP_07344472.1| S1C (protease Do) subfamily peptidase MucD [Burkholderiales
           bacterium 1_1_47]
 gi|302858915|gb|EFL82003.1| S1C (protease Do) subfamily peptidase MucD [Burkholderiales
           bacterium 1_1_47]
          Length = 488

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 131/374 (35%), Positives = 209/374 (55%), Gaps = 23/374 (6%)

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           ER   GSGF I+ DG ILT++H+V+      V L+DD E  AK++G+DA  D+AV+K+  
Sbjct: 108 ERKGQGSGFIISPDGLILTNHHVVDGADEIKVHLTDDREFNAKVIGSDAKTDVAVIKI-- 165

Query: 166 DRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDA 223
           D K +P V+  ++ +++VGE V  IG PF L  TV++GIVSA  R++P D+   F Q DA
Sbjct: 166 DGKDLPCVKLGNSKDVKVGEWVAAIGAPFGLENTVTSGIVSAKSRNLPSDQFVPFIQTDA 225

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N GNSGGP FN  G VIG+N+ I ++    MG+   +P+ +  +    L+  G+V+ G
Sbjct: 226 AVNPGNSGGPLFNMKGEVIGINSQIFSTSGGFMGLSFAVPIDLALQIKDELVKHGKVNRG 285

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
             G+M Q ++ ELA   GL   KG+LI  + K S A+KAG++ GD++ + DG+ I +  D
Sbjct: 286 RLGVMIQTMSPELAKSFGLEKNKGALIAQIQKGSAAEKAGLQEGDIVILFDGKGIDNAAD 345

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP---TAKNDMHLEVGDKELLGMVLQD 400
               +AS  P  +  + + +EG +  V V L ++     AK     E   +  LG+ ++ 
Sbjct: 346 LSRAVASARPDTEHNVKVLREGKEAEVKVKLDAAADTSVAKGKAAEEA--RGRLGVTVRG 403

Query: 401 INDGNKK-----LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
           +ND  KK     LV + +  P  E      GI++G  ++SV   ++   +  +  +  A 
Sbjct: 404 LNDEEKKKYGDGLVVVESHGPASE-----AGIKEGDVLLSVGGKKIRSFEQFKDAVNAAD 458

Query: 456 EKKRDSVLLQIKYD 469
           +    ++ LQ+  D
Sbjct: 459 K----TLALQVARD 468


>gi|87119814|ref|ZP_01075711.1| serine protease MucD precursor [Marinomonas sp. MED121]
 gi|86165290|gb|EAQ66558.1| serine protease MucD precursor [Marinomonas sp. MED121]
          Length = 464

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 218/415 (52%), Gaps = 22/415 (5%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQM-FNAYGFGNL-PEDHPLKNYFRKDFHKFFSG 96
           D   ++   SP++V++        S EQ+     G G L P    L  +FR      F G
Sbjct: 30  DFTELVEDSSPAVVNI--------STEQLPATGQGQGQLNPNAKELNEFFRH-----FFG 76

Query: 97  EEPI--LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
           ++P+       +R   GSGF I+ DGY+LT+NH+++      V L+D  E  A+LVGTD 
Sbjct: 77  QQPLDKQPQRKQRNSLGSGFIISQDGYVLTNNHVIDGADIIHVRLNDRREYQAELVGTDK 136

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-D 213
             DLA+LK+++D     V+  D+++++ G+ V  IG+PF    TV+AGIVSAL R++P D
Sbjct: 137 RTDLALLKIEAD-DLPTVKIGDSDDMKPGQWVLAIGSPFGFDYTVTAGIVSALGRNLPSD 195

Query: 214 RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
               F Q D  IN GNSGGP FN  G VIG+N+ I T     MGV   IP +++   +  
Sbjct: 196 NYVPFIQTDVAINPGNSGGPLFNLDGEVIGINSQIYTRSGGFMGVSFAIPSNLVMSVVDQ 255

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           L S+GRV   W G++ Q+++ +LA   GL    G+L++ V+ +SPA  AG+  GD+I   
Sbjct: 256 LKSEGRVTRAWLGVIIQDVSNDLAESFGLDRPSGALVSRVIPDSPAQAAGLMDGDIILEF 315

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL 393
           +G +I+   +  +++ +    +  +  + + G K  ++  L + P+  + +      +  
Sbjct: 316 NGELIEQSSELPYRVGALKAGDLAESVIYRNGKKMDLSFTLENYPSDPDQLTQTQQQENR 375

Query: 394 LGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
           LGMV+ +I +   +  +I   V +           G+Q+G  I  +N   +  ++
Sbjct: 376 LGMVVGEIPEDMLRRFKIKNGVVVEQVLGGSAARNGLQQGDVITMLNGTSIDSVE 430


>gi|188592008|ref|YP_001796606.1| periplasmic protease [Cupriavidus taiwanensis LMG 19424]
 gi|170938382|emb|CAP63369.1| PERIPLASMIC PROTEASE; contains two PDZ domain [Cupriavidus
           taiwanensis LMG 19424]
          Length = 511

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 139/454 (30%), Positives = 226/454 (49%), Gaps = 44/454 (9%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
           +D   ++A+  P++V++ V  + + +  QM        +  D PL  +F++ F   F G 
Sbjct: 78  MDFSGIVAQYGPAVVNISVTARAQRTAVQMPPG-----IDPDDPLFQFFKR-FGPQFQGP 131

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
           +      V     GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++GTD   D
Sbjct: 132 QGGAQQLVRGQ--GSGFIVSPDGLILTNAHVVDGAQEVTVKLTDRREFKAKVLGTDPQTD 189

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AV+++ + R    V   D + +RVGE V  IG+P+    TV+AGIVSA  R +PD    
Sbjct: 190 VAVIRIDA-RDLPTVRLGDPSQVRVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYV 248

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D  +N GNSGGP FN  G V+G+N+ I +    + G+   IP+ +  K    L++
Sbjct: 249 PFIQTDVAVNPGNSGGPLFNQRGEVVGINSQIYSQTGGYQGLSFAIPIDVATKVQQQLVA 308

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G+V  G  GI  Q + Q LA   GL    G+L+ +V  +SPA +AG+K GDVI  L+  
Sbjct: 309 HGKVTRGRLGISVQEVNQALAQSFGLPKPTGALVNSVEPDSPAARAGLKPGDVIVQLNND 368

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL--- 393
           +I    D    +A   P  Q  + + ++G   +++V +GS+      +  + G KE    
Sbjct: 369 VIDHSGDLPEHVADIKPGTQSSLKIIRKGQPMTLSVTVGSA--RDQAVAQKAGGKEANGR 426

Query: 394 LGMVLQDINDGNKKLVRIVALNPNREREVEAK-------------GIQKGMTIVSVNTHE 440
           LG+ ++ ++   K           RE  +E               GIQ G  I+S+N   
Sbjct: 427 LGLAVRPLSPAEK-----------RESGIEGGLVVEDVTGPAARVGIQPGDVILSLNGTP 475

Query: 441 VSCIKDVERLIGKAKEK-----KRDSVLLQIKYD 469
           ++ +  +  L+GK+ ++     +RD   + I  D
Sbjct: 476 IASVDQLRTLVGKSGKQVALLVQRDDARIFIPLD 509


>gi|254485878|ref|ZP_05099083.1| periplasmic serine protease, DO/DeqQ family [Roseobacter sp.
           GAI101]
 gi|214042747|gb|EEB83385.1| periplasmic serine protease, DO/DeqQ family [Roseobacter sp.
           GAI101]
          Length = 372

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 121/336 (36%), Positives = 188/336 (55%), Gaps = 15/336 (4%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF-SGEEPIL 101
           ++  +SPS+V + V  +   S  +M        +P+  P     R+ F +   +G+ P  
Sbjct: 44  LVETISPSVVFIEVSGQAAQSGPKM-------EMPQGMP--EELRRRFEQMMPNGDAP-- 92

Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
           +  V+ L  GSGF ++ DG I+T+NH+VE     +V LSD     A +VG+D++ D+A+L
Sbjct: 93  AQPVQGL--GSGFIVSKDGQIVTNNHVVEGADKVTVKLSDGRSFDATVVGSDSMTDIALL 150

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQ 220
           K+++D     V F  ++ +RVG+ V  +GNPF L GTV+ GIVSA  R+I   P   F Q
Sbjct: 151 KIEADVDLPAVTFGSSDAMRVGDEVVAMGNPFGLGGTVTTGIVSAKSRNIHAGPYDDFIQ 210

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
            DA IN+GNSGGP FN  G VIGVN  I++ G   +G+G  +P  +++  +  L   G +
Sbjct: 211 TDAAINRGNSGGPLFNNAGEVIGVNTAILSPGGGSVGIGFSVPSDLVQTIVADLADDGTI 270

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             GW G+  + +T E+A  LG    KG++I AV  +SPA KAG+  GD+I   +G  I  
Sbjct: 271 TRGWLGVQIRPMTAEIAQLLGYDAPKGAVIEAVGDDSPAKKAGLVKGDIILSFNGTAIDE 330

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
            +D    +A   P E   + +  +G + + AV +G+
Sbjct: 331 LRDLTRAVAETDPDETADVVVLHKGEQVTRAVTIGT 366


>gi|296114355|ref|ZP_06833009.1| protease Do [Gluconacetobacter hansenii ATCC 23769]
 gi|295979116|gb|EFG85840.1| protease Do [Gluconacetobacter hansenii ATCC 23769]
          Length = 516

 Score =  206 bits (523), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 138/378 (36%), Positives = 199/378 (52%), Gaps = 27/378 (7%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I+ DGY++T+NH+V+     +V L D T LPAK+VG D+  D+A+LKV    K  
Sbjct: 116 GSGFVISPDGYVVTNNHVVKGATKVTVTLDDGTSLPAKIVGRDSKTDIALLKVTPSGKLR 175

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            +E  D++ +  GE V  +GNP+ L GTV+AGIVSA  RDI D P  +F Q+DAPIN+GN
Sbjct: 176 FIELGDSDKVEPGEWVVAVGNPYGLGGTVTAGIVSARGRDIGDGPYDSFIQVDAPINRGN 235

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F   G V+GVN  I++     +G+G  IP   +K  +  L   G V  G+ G+  
Sbjct: 236 SGGPLFTQDGKVVGVNTAILSPSGGSIGIGFAIPSDTVKNVVEQLEKTGHVTRGYLGVTA 295

Query: 290 QNLTQELAIPLGLR---GT--KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
           Q +T  +A  LGL+   GT   G+L+ +V   SPA+KAG+K GDV+  L+G+ I +    
Sbjct: 296 QVITPSMATALGLKSVNGTPATGALVASVSAGSPAEKAGIKAGDVVTDLNGQKIDTPHTL 355

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVL------GSSPTAKNDMHLEVGDK-ELLGMV 397
             ++AS  P  +V +   +     + +V +      GS+     D H +  DK   LG+ 
Sbjct: 356 AVKVASVVPGTKVTVGYLRNDKPQTASVTIANLGKGGSTDGTVGDDHTD--DKGPRLGVS 413

Query: 398 LQDIN---------DGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
           L  +          D N   V +  + P      E  GI  G  I +V    V   +   
Sbjct: 414 LAPLTPDARQQLGLDENVHGVVVSDVQPG--SSAEQAGIHAGDVIQAVGNKPVENPRATV 471

Query: 449 RLIGKAKEKKRDSVLLQI 466
             I +A E    SVLL++
Sbjct: 472 SAIRQALETNH-SVLLRV 488


>gi|86158196|ref|YP_464981.1| peptidase S1C, Do [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774707|gb|ABC81544.1| peptidase S1C, Do [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 524

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 144/456 (31%), Positives = 230/456 (50%), Gaps = 37/456 (8%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMF----NAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           L P+I ++ P++V++      K    Q      N +G G  P++      F   F ++F 
Sbjct: 62  LAPLIDKLRPAVVNISTTTVTKHPRVQRGPRGQNPHG-GGTPDEG-----FEDFFERYFG 115

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
              P + +  +    GSGF +  +G+ILT+NH+V+D     V LSDD E  AK+VG D L
Sbjct: 116 RPAPEMPEEFKGSSLGSGFLLNGEGFILTNNHVVKDATDIRVRLSDDREFGAKIVGRDPL 175

Query: 156 FDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
            D+A++++ +  K +P V   D++ +R G+ V  +G+PF LR T + GIVSA  R   + 
Sbjct: 176 TDVALIQLVNPPKNLPTVVLGDSDALRQGDFVLALGSPFGLRDTATLGIVSAKHRPGINP 235

Query: 215 PGT---FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
            GT   F Q DA IN GNSGGP FN  G V+G+N  IV S Q   G+G  +P+++ K  +
Sbjct: 236 GGTYDDFIQTDAAINPGNSGGPLFNLRGEVVGINTAIV-SPQIGQGIGFAVPINMAKALL 294

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTKGSLITAVVKESPADKAGMKVGDVI 330
           P L  KG+V  G+ G+   +L+ +L    GL+ GTKG+L+  VV  SPADKAG++ GDV+
Sbjct: 295 PQLKEKGKVTRGFLGVSVSDLSPDLIQGFGLQPGTKGALVQNVVPRSPADKAGLQPGDVV 354

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD 390
             L+ + +++       +A  SP +   +++ + G K   AV +   P     +      
Sbjct: 355 VALNDKTVETAGALTRGVALVSPGQTANLTVLRGGQKKQFAVKVVQRPEDGEAVGRGEQG 414

Query: 391 KELLGMVLQDINDGNKKLVRIVALNPNRERE-------------------VEAKGIQKGM 431
               G      +   K  V I  + P+  R+                    +  GI++G 
Sbjct: 415 GGEEGGGQGARDQSPKLGVSIAPITPDVARQFGVEPGDGVVVVDVTEGGPADRAGIRRGD 474

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            I+  N  +V+  +D+   + K KE   D  LL+++
Sbjct: 475 VILEANRQKVTRPEDMRSAVAKLKEG--DMALLRVR 508


>gi|114771708|ref|ZP_01449112.1| possible serine protease [alpha proteobacterium HTCC2255]
 gi|114547780|gb|EAU50670.1| possible serine protease [alpha proteobacterium HTCC2255]
          Length = 492

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 150/503 (29%), Positives = 242/503 (48%), Gaps = 41/503 (8%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKL-----PPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           L+++ I TV +  +   S  ++L         P S  DL      +SPS+V++       
Sbjct: 10  LTIRQIHTVIINTLFVFSILMLLTVSAHARGAPESFADLAE---ELSPSVVNITTSTTIA 66

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
              +Q         +PE  P ++ FR     FF+  E   +        GSGF ++ DGY
Sbjct: 67  GVTDQARP-----QIPEGSPFEDLFRD----FFNNGEGGQARPRRSSALGSGFVVSSDGY 117

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+++      +   D  EL AKLVG D   D+AVLKV++      V F D++  R
Sbjct: 118 IVTNNHVIDKADEIVIEFFDGKELVAKLVGRDPKTDIAVLKVEASEPLPFVGFGDSDIAR 177

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGH 240
           VG+ V  IGNP     +VSAGI+SA +R +   P   F Q DA IN+GNSGGP FN  G 
Sbjct: 178 VGDWVMAIGNPLGQGFSVSAGIISARNRTLRSGPYDDFIQTDAAINRGNSGGPLFNMSGE 237

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVN  I++     +G+G  +   ++ + +  L   G    GW G+  Q++  ++A  L
Sbjct: 238 VIGVNTAIISPNGGSIGLGFSMSSRVVGRVVKQLKEYGETRRGWLGVQIQDIDSDMAEAL 297

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL    G+L++  V E P   AG++ GDVI   DG  ++  +  V  + +    + V++ 
Sbjct: 298 GLDKVSGALVSG-VPEGPGADAGIQSGDVIISFDGVEVEDTRGLVTAVGNADVGKVVRVI 356

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHL-------EVGDKELLGMVLQDINDGNK------- 406
           + ++G   ++ V LG    A+ +  +       ++ + E  GM L  IN  ++       
Sbjct: 357 IFRDGKTKTIKVTLGRREAAEKEKLVPVTKAPEKIKETEKFGMKLLTINSESRIKLNLPE 416

Query: 407 KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
            L  +  L+ +   +   KGI+ G  IV     +++ + D+ ++   A E  R S+LL +
Sbjct: 417 DLEGVAVLDVSDTSDAFEKGIRAGDVIVEAGRTKIADVNDISKIFEDAIEAGRKSILLLV 476

Query: 467 KYDPDMQSGNDNMSRFVSLKIDK 489
                     DN SRFV L + +
Sbjct: 477 LR-------GDN-SRFVGLSLSE 491


>gi|326794166|ref|YP_004311986.1| protease Do [Marinomonas mediterranea MMB-1]
 gi|326544930|gb|ADZ90150.1| protease Do [Marinomonas mediterranea MMB-1]
          Length = 469

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 132/444 (29%), Positives = 225/444 (50%), Gaps = 18/444 (4%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           +K++   A++  +  S +    A LP    D   ++ + SP++V++  E  +  +  +  
Sbjct: 5   LKTMSVAAISFTLMFSMFANAAANLP----DFTDLVEKTSPAVVNISTEQTQSSATGRQL 60

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDGYILTSN 126
           N       P+   L  +FR  F +   G++       +R     GSGF I+ DGY+LT+N
Sbjct: 61  N-------PDAQELNEFFRHFFGQQPFGQQQSPKRQQQRQRSSLGSGFIISKDGYVLTNN 113

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+++      V L+D  E  AKLVGTDA  DLA+LK+++D     V+  D+++++ G+ V
Sbjct: 114 HVIDGADVIHVRLNDRREYEAKLVGTDARTDLALLKIEAD-DLPTVKMADSDDLKAGQWV 172

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVN 245
             IG+PF    TV+AGIVSAL R++P D    F Q D  IN GNSGGP FN  G V+G+N
Sbjct: 173 VAIGSPFGFDYTVTAGIVSALGRNLPSDNYVPFIQTDVAINPGNSGGPLFNLDGEVVGIN 232

Query: 246 AMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGT 305
           + I T     MGV   IP  +    +  L + G+V   W G++ Q++  +LA   GL   
Sbjct: 233 SQIYTRSGGFMGVSFAIPSKVAMSVVDQLKADGKVSRAWLGVIIQDVNNDLAESFGLDRP 292

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
            G+L++ V+  SPA+KAG++ GD+I   +G+ I+   +  + +       +V   + ++G
Sbjct: 293 HGALVSRVMPGSPAEKAGLQPGDIIMSFEGKTIEHSSELPYIVGRMKADSEVTAKVFRDG 352

Query: 366 SKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI---VALNPNREREV 422
            + ++   L   P        +   +  LGM++ ++ +     + I   V +        
Sbjct: 353 DEKTIDFTLDKRPDDSKLASQDQQQQNRLGMIVGEVPEKLASRLTIQGGVVVEQVLGGTA 412

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKD 446
              G+Q+G  I  +N   ++ + D
Sbjct: 413 ARNGLQQGDVITMLNGKRINGVDD 436


>gi|197122475|ref|YP_002134426.1| protease Do [Anaeromyxobacter sp. K]
 gi|196172324|gb|ACG73297.1| protease Do [Anaeromyxobacter sp. K]
          Length = 523

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 143/456 (31%), Positives = 230/456 (50%), Gaps = 37/456 (8%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMF----NAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           L P+I ++ P++V++      K    Q      N +G G  P++      F   F ++F 
Sbjct: 61  LAPLIDKLRPAVVNISTTTVTKHPRVQRGPRGQNPHG-GGTPDEG-----FEDFFERYFG 114

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
              P + +  +    GSGF +  +GYILT+NH+V+D     V LSDD E  A++VG D L
Sbjct: 115 RPAPEMPEEFKGSSLGSGFLLNTEGYILTNNHVVKDATDIRVRLSDDREFGARIVGRDPL 174

Query: 156 FDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
            D+A++++ +  K +P V   D++ +R G+ V  +G+PF LR T + GIVSA  R   + 
Sbjct: 175 TDVALIQLVNPPKNLPTVVLGDSDALRQGDFVLALGSPFGLRDTATLGIVSAKHRPGINP 234

Query: 215 PGT---FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
            GT   F Q DA IN GNSGGP FN  G V+G+N  IV S Q   G+G  +P+++ K  +
Sbjct: 235 GGTYDDFIQTDAAINPGNSGGPLFNLRGEVVGINTAIV-SPQIGQGIGFAVPINMAKALL 293

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLR-GTKGSLITAVVKESPADKAGMKVGDVI 330
           P L  KG+V  G+ G+   +L+ +L    GL+ GTKG+L+  VV  SPADKAG++ GDV+
Sbjct: 294 PQLKEKGKVTRGFLGVSVSDLSPDLIQGFGLQSGTKGALVQNVVPRSPADKAGLQPGDVV 353

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD 390
             L+ + +++       +A  +P +   +++ + G K   AV +   P     +      
Sbjct: 354 VALNDKTVETAGALTRGVALVAPGQTANLTVLRGGQKKQFAVKVVQRPEDGEAVGRNEQG 413

Query: 391 KELLGMVLQDINDGNKKLVRIVALNPNRERE-------------------VEAKGIQKGM 431
               G      +   K  V I  + P+  R+                    +  GI++G 
Sbjct: 414 GGDEGGGQGARDQSPKLGVSIAPITPDVARQFGVEPGEGVVVVDVTEGGPADRAGIRRGD 473

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            I+  N  +V+  +D+   + K KE   D  LL+++
Sbjct: 474 VILEANRQKVARPEDMRSAVAKLKEG--DMALLRVR 507


>gi|87201343|ref|YP_498600.1| peptidase S1C, Do [Novosphingobium aromaticivorans DSM 12444]
 gi|87137024|gb|ABD27766.1| Peptidase S1C, Do [Novosphingobium aromaticivorans DSM 12444]
          Length = 510

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 155/481 (32%), Positives = 238/481 (49%), Gaps = 65/481 (13%)

Query: 27  LVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYF 86
           +V  A  P S  DL     ++ P++V++    + KV     F    FG+L          
Sbjct: 41  VVPRAGAPASFADL---TQQLQPAVVNISTRQRVKVQANNPFAGTPFGDL---------- 87

Query: 87  RKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV-EDGA----SFSVILSD 141
                  F G +     T E    GSGF I+ DGY++T+NH++  DG     S +V   D
Sbjct: 88  -------FGGGQGNGPQTREAQSLGSGFIISADGYVVTNNHVITADGQGEVESITVTTPD 140

Query: 142 DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
            TE PAKL+G DA  DLAVLK+     F  V+F D+   RVG+ V  IGNPF L GTV+ 
Sbjct: 141 GTEYPAKLIGKDAASDLAVLKISRPTAFPFVKFGDSRKARVGDWVIAIGNPFGLGGTVTQ 200

Query: 202 GIVSALDRDIP-----DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHM 256
           GI+SA+ R+       DR   + Q DA IN+GNSGGP F+  G+VIG+N  I +     +
Sbjct: 201 GIISAVYRNTGSGSAYDR---YLQTDASINRGNSGGPMFDMQGNVIGINNAIFSPTGGSV 257

Query: 257 GVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKE 316
           G+G  IP  I    +  L +   +D G+ G+  Q L+++LA  LGL   +G  I  V   
Sbjct: 258 GIGFAIPAEIAAPIVDKLRAGQAIDRGYLGVRIQPLSEDLAASLGLPKNRGEFIQGVEPG 317

Query: 317 SPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
             A KAG++ GDV+  +DG+ +   Q   + +A+ +P +++ I L + G + +V  V+  
Sbjct: 318 QAAAKAGIQAGDVVVKVDGKDVTPDQTLSFIVANTAPGKRIPIELIRNGQRLTVQTVVAK 377

Query: 377 SPTAKN-----------------------------DMHLEVGDKELLGMVLQDINDG-NK 406
            PT +                                 L V    L   + + +  G + 
Sbjct: 378 RPTEEELAQQSFDPDAQQDDDQFGARPQQQGPSVLQNALGVAAIPLTPQIARQLGAGEDA 437

Query: 407 KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           K V I A++ +   +  AKG+Q+G  ++S N   V+ + D+ER++  AK + R++VLL+I
Sbjct: 438 KGVVITAVDGS--SDAAAKGLQRGDIVLSANYVTVTTLADLERIVRNAKTEGREAVLLRI 495

Query: 467 K 467
           +
Sbjct: 496 Q 496


>gi|113971603|ref|YP_735396.1| peptidase Do [Shewanella sp. MR-4]
 gi|117919142|ref|YP_868334.1| peptidase Do [Shewanella sp. ANA-3]
 gi|113886287|gb|ABI40339.1| peptidase Do. Serine peptidase. MEROPS family S01B [Shewanella sp.
           MR-4]
 gi|117611474|gb|ABK46928.1| peptidase Do. Serine peptidase. MEROPS family S01B [Shewanella sp.
           ANA-3]
          Length = 450

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 149/461 (32%), Positives = 233/461 (50%), Gaps = 48/461 (10%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPS----SV-DLPPVIARVSPSIVSVMVEPK--KKVS 63
           S+ + A+     +    V +A +P S    S+  L P++ R +P++VSV V      K  
Sbjct: 6   SVLSAAMLAATLTMMPAVSQAAIPQSVEGQSIPSLAPMLERTTPAVVSVAVSGTHVSKQR 65

Query: 64  VEQMFNAYGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGY 121
           V  +F  Y FG N P++   +  FR                       GSG  I  D GY
Sbjct: 66  VPDVFR-YFFGPNAPQEQVQERPFRG---------------------LGSGVIIDADKGY 103

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+++      V L D  E+ AKL+GTD+  D+A+L++++ +  + ++  D++ +R
Sbjct: 104 IVTNNHVIDGADDIQVGLHDGREVKAKLIGTDSESDIALLQIEA-KNLVAIKTSDSDELR 162

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALG 239
           VG+    IGNPF L  TV++GIVSAL R     +    F Q DA IN GNSGG   N  G
Sbjct: 163 VGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLKG 222

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            +IG+N  IV  G  ++G+G  IP +++K  +  +   G V  G  GI  ++L  +LA  
Sbjct: 223 ELIGINTAIVAPGGGNVGIGFAIPANMVKNLVAQIAEHGEVRRGVLGISGRDLDSQLAQG 282

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL    G  +  V   S A+KAG+K GD+I  +DGR IKS Q+   ++A+     +V++
Sbjct: 283 FGLDTQHGGFVNEVTAGSAAEKAGIKAGDIIVSVDGRAIKSFQELRAKVATMGAGAKVEL 342

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE 419
            L ++G K +V V LG +          V    L G  L++ + G  ++  +   +P   
Sbjct: 343 GLIRDGDKKTVNVTLGEASQTTEKAAGAV-HPMLQGASLENASKG-VEITEVAQGSP--- 397

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
                 G+QKG  IV +N    S +KD++ L    KE+ +D
Sbjct: 398 --AAMSGLQKGDVIVGINR---SAVKDLKSL----KEQLKD 429


>gi|46201208|ref|ZP_00055558.2| COG0265: Trypsin-like serine proteases, typically periplasmic,
           contain C-terminal PDZ domain [Magnetospirillum
           magnetotacticum MS-1]
          Length = 488

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 143/465 (30%), Positives = 227/465 (48%), Gaps = 36/465 (7%)

Query: 46  RVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV 105
           R+ P++V++      K S      A      P   PL+ +F++   +   G+ P  + + 
Sbjct: 31  RLLPAVVNISTTQTMKPSQ----GAPELPQFPPGSPLEEFFKEFMERQQGGKSPD-APSR 85

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           +    GSGF I   GYI+T+NH++ D    SV L DDT   A LVG D   DLA+LK++ 
Sbjct: 86  KATSLGSGFIIDAAGYIVTNNHVIADADEISVKLHDDTVFQATLVGRDPKVDLALLKIEP 145

Query: 166 DRK-FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDA 223
            +K  +PV F +++  RVG+ V  IGNPF   GTV+AGIVSA  RDI   P   F Q DA
Sbjct: 146 GKKPLVPVPFGNSDEARVGDWVLAIGNPFGFGGTVTAGIVSARARDINAGPYDDFLQTDA 205

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            IN+GNSGG  FN  G VIG+N+ I++     +G+G  +P ++    +  L   G+V  G
Sbjct: 206 AINRGNSGGSMFNMKGEVIGINSAIISPSGGSIGIGFAVPAALAVPVLDDLRKFGKVRRG 265

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           W GI  Q+L  ++A  +GL   KG+L+  V    P  KAG+K GDV+   DG+ I   + 
Sbjct: 266 WLGIRIQSLDTDMAENIGLPDQKGALVAKVDPNGPGVKAGLKDGDVVLKFDGKDITEMRR 325

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS-----------------SPTAKNDMHL 386
               +AS    ++V + + ++G + ++   +G                   P A  D  L
Sbjct: 326 LPRYVASTPIGKKVDVVIWRDGKRQTITASVGEMPEDPAEQQVKGKPESPKPQANKDGIL 385

Query: 387 EVGDKEL----LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
            +    L    L   L++    +++   IV      +     KG++ G  I+  +   V 
Sbjct: 386 TIPGAGLTVSSLTAQLRERFGLDEEAKGIVVTEVKPDSPAAEKGMRPGDMIIEADHKPVR 445

Query: 443 CIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
              D+ +LI + +     S+LL+++        N    R+++L +
Sbjct: 446 SPADLGKLIDEGRRAGAKSLLLRVE--------NPQQLRYIALPL 482


>gi|330991260|ref|ZP_08315211.1| putative serine protease do-like protein [Gluconacetobacter sp.
           SXCC-1]
 gi|329761279|gb|EGG77772.1| putative serine protease do-like protein [Gluconacetobacter sp.
           SXCC-1]
          Length = 514

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 185/337 (54%), Gaps = 20/337 (5%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I+ DGY++T+NH+V+     +V L D T LPAK+VG D+  D+A+LKV    K  
Sbjct: 112 GSGFVISPDGYVVTNNHVVKGATKVTVTLDDGTALPAKIVGRDSKTDIALLKVSPSGKLR 171

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            +E  D++ +  GE V  +GNP+ L GTV+AGIVSA  RDI D P  +F Q+DAPIN+GN
Sbjct: 172 FIELGDSDKVEPGEWVVAVGNPYGLGGTVTAGIVSARGRDIGDGPYDSFIQVDAPINRGN 231

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F   G V+GVN  I++     +G+G  IP   +K  +  L   G V  G+ G+  
Sbjct: 232 SGGPLFTQDGKVVGVNTAILSPSGGSIGIGFAIPSDTVKNIVDQLEKTGHVTRGYLGVTA 291

Query: 290 QNLTQELAIPLGLRGTK------GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           Q +T  +A  LG++ +       G+L+ +V   SPA+KAG+K GDV+  L+G+ I +   
Sbjct: 292 QAITPSMASALGMKPSATGAPATGALVASVSAGSPAEKAGLKAGDVVTELNGQPIDTPHT 351

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVV---LGSSPTAKNDMHLEVGDKELLGMVLQD 400
              ++A+  P  +  +S  +     + +V+   LG   TA       VGD         D
Sbjct: 352 LAVKVATIVPGTKATLSYLRNNKPQTASVLISTLGKGGTADG----TVGD------TTHD 401

Query: 401 INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVN 437
            + G K  V +  L P+  +++  +   +G+ +  V 
Sbjct: 402 ADKGPKLGVTLAPLTPDLRQQLGLEESVRGVVVSDVQ 438


>gi|94264623|ref|ZP_01288406.1| Peptidase S1C, Do [delta proteobacterium MLMS-1]
 gi|93454918|gb|EAT05159.1| Peptidase S1C, Do [delta proteobacterium MLMS-1]
          Length = 484

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 151/471 (32%), Positives = 233/471 (49%), Gaps = 39/471 (8%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKV--SVEQMFNAYGFGNLPEDHPLKNYFRKDF- 90
           PPS  +L      + PS+V++      K   S    F   GF  LPE       FR+ F 
Sbjct: 35  PPSFAEL---AEEMGPSVVNIYTTQTVKAPRSPHPFFGGEGFEELPE------MFRRFFD 85

Query: 91  --HKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAK 148
             H    GE+      ++R   GSG  I+ DGYI+T+NH+VE+  S ++ L++  E  A+
Sbjct: 86  MPHPSPHGEQQQPPRELQRTSLGSGVIISTDGYIVTNNHVVENADSINIRLTNFEEYDAE 145

Query: 149 LVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALD 208
           ++G D   DLA+LK+ S  +   V   D+  +RVG+ V  IGNPF    TV+AGIVS   
Sbjct: 146 VIGRDPKTDLALLKIDSKHELPAVRMGDSEALRVGDWVLAIGNPFGFEQTVTAGIVSGKG 205

Query: 209 RDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSII 267
           R +   P   F Q DA IN GNSGGP F   G ++G+N  I + G  ++G+G  IP+++ 
Sbjct: 206 RSLGSGPYENFIQTDASINPGNSGGPLFALDGAMVGINTAIYSRGGGNIGIGFAIPVNMA 265

Query: 268 KKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVG 327
           K  +  L   G V  GW G+M Q++T +LA  L L    G+L+  V    PA  AG+K G
Sbjct: 266 KNVVEQLREHGTVTRGWLGVMIQHVTPDLARHLQLERPIGALVGEVDPAGPAAAAGLKAG 325

Query: 328 DVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-----------S 376
           DVI    G+ I         +A  +P E+V++ + + G + ++ V +G           S
Sbjct: 326 DVIVEYAGKEISQMTMVPTLVAQTTPGEEVEMVVMRRGERQTLTVTIGKLDEEDERRARS 385

Query: 377 SPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSV 436
           +P ++  + L V  +EL   V + +     + V I  +           G+++G  IV V
Sbjct: 386 APESEEQLGLAV--QELTPEVAESLGISQDQGVLIADVKAG--SAAAEAGLRRGEVIVEV 441

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           N   +  ++    +I +A E+   SVLL ++            SRFV+++I
Sbjct: 442 NQQAIESLEQYAAVIEEALEE--GSVLLLVR-------NRQGQSRFVAIRI 483


>gi|167625592|ref|YP_001675886.1| protease Do [Shewanella halifaxensis HAW-EB4]
 gi|167355614|gb|ABZ78227.1| protease Do [Shewanella halifaxensis HAW-EB4]
          Length = 451

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 151/477 (31%), Positives = 243/477 (50%), Gaps = 58/477 (12%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLP--------PSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           SI + A+     +    V +A +P        PS   L P++ + +P++V+V V     V
Sbjct: 6   SILSAAILGATLTLAPAVSQAAIPLAVGGQELPS---LAPMLQKTTPAVVAVAVS-GTHV 61

Query: 63  SVEQMFNA--YGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TD 118
           S +++ +A  Y FG N P +   +  F+                       GSG  I   
Sbjct: 62  SKQKVPDAFRYFFGPNAPREQVQERPFKG---------------------LGSGVIIDAK 100

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           +GYI+T+NH++E      + L D  E+ AKL+GTDA  D+A+L++++ +    ++  D++
Sbjct: 101 EGYIVTNNHVIEGADEILIGLHDGREVEAKLIGTDAESDIALLQIKA-KNLTALKRADSD 159

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFN 236
            ++VG+    IGNPF L  TV++GIVSA+ R     +    F Q DA IN GNSGG   N
Sbjct: 160 ELQVGDFAVAIGNPFGLGQTVTSGIVSAMGRSGLGIEMLENFIQTDAAINSGNSGGALVN 219

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G +IG+N  IV  G  ++G+G  IP +++   +  ++  G V  G  G+M Q+LT EL
Sbjct: 220 LNGELIGINTAIVAPGGGNVGIGFAIPANMVNNLVQQIVEHGEVRRGVLGVMGQDLTNEL 279

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   G+    G  I  V+ +S ADKAG+KVGD+I  ++GR IKS Q+   ++A+     +
Sbjct: 280 AKGFGIETQHGGFINEVMPDSAADKAGIKVGDIIVSVNGRSIKSFQELRAKVATMGAGSK 339

Query: 357 VKISLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIV 412
           V+  L ++G + +V   LG    S+  A   +H       L G  L+  +    ++  + 
Sbjct: 340 VEFGLIRDGDEETVTATLGESTQSAEAAAGAVH-----PMLQGAKLETSDSSGVEITDVA 394

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
             +P       A G+ KG  IV VN  +V+ +K ++     A E ++ SV L+IK D
Sbjct: 395 QGSP-----AAASGLIKGDVIVGVNRTKVNNLKALK----SALEDQKGSVALKIKRD 442


>gi|119384123|ref|YP_915179.1| protease Do [Paracoccus denitrificans PD1222]
 gi|119373890|gb|ABL69483.1| protease Do [Paracoccus denitrificans PD1222]
          Length = 514

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 150/472 (31%), Positives = 230/472 (48%), Gaps = 35/472 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK-DFH 91
           +P S  DL   + +VSP++V++         +     A G   LPE  P  + FR+  F 
Sbjct: 60  MPESFADL---VEKVSPAVVNITTTSTVSTPL-----ARGP-QLPEGSPFSDLFREFGFP 110

Query: 92  KFFSGEEPILSDTVERLM----FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
            F  GE        +R       GSGF I+ DG I+T+NH+++      V       LPA
Sbjct: 111 GFPPGEGNPFQRGPQREQRSNALGSGFVISPDGLIVTNNHVIDGADEIEVEFFSGKRLPA 170

Query: 148 KLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSAL 207
           +++G D   D+AVLKV+SD     V+F D++  RVG+ V  +GNP     + S GIVSA 
Sbjct: 171 QVIGKDDKTDVAVLKVESDDPLPFVKFGDSDRARVGDWVLALGNPLGQGFSASTGIVSAR 230

Query: 208 DRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSII 267
           +R +      F Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++
Sbjct: 231 NRALSGTYDDFIQTDAAINRGNSGGPLFNLDGEVIGVNTAILSPNGGSIGIGFSMASNVV 290

Query: 268 KKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVG 327
            K +  L   G    GW G+  Q +T ++A  LGL   KG+++T  V   PA  AGMK G
Sbjct: 291 SKVVEQLEEFGETRRGWLGVKIQPVTDDIAESLGLSEAKGAMVTD-VPAGPAADAGMKAG 349

Query: 328 DVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE 387
           DVI   DG  +K  +D V ++A     E V + + +EG    + V LG    A+     +
Sbjct: 350 DVITSFDGGEVKYPRDLVRRVADAPVGEAVAVVVQREGEPVELQVTLGRRELAEGTGSGK 409

Query: 388 VGDKE-----LLGMVLQDINDG-------NKKLVRIVALNPNREREVEAKGIQKGMTIVS 435
           V   E     ++GM L  +          ++ +  +V  + +       KG+  G  I  
Sbjct: 410 VSSAEETASDVMGMTLAPLTPEIAAELGVSRDMQGLVVQSVDPSGAAADKGLVAGDVITE 469

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
                V+ + D+E  I +A+E  R S+L+ ++     ++G     RFV+L +
Sbjct: 470 AGQQPVATLADLEGRIKEAREAGRKSILVMVR-----RAGE---PRFVALPV 513


>gi|312959554|ref|ZP_07774071.1| S1C (protease Do) subfamily peptidase MucD [Pseudomonas fluorescens
           WH6]
 gi|311286271|gb|EFQ64835.1| S1C (protease Do) subfamily peptidase MucD [Pseudomonas fluorescens
           WH6]
          Length = 479

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 142/454 (31%), Positives = 227/454 (50%), Gaps = 27/454 (5%)

Query: 24  STYLVLEAKLPPSSVDLP---PVIARVSPSIVSVMVE---PKKKVSVEQMFNAYGFGNLP 77
           +T LVL   +   +V+LP    ++ + SP++V++      P +KVS +QM +  G   + 
Sbjct: 14  ATVLVLGQAVTAQAVELPDFTQLVEQASPAVVNISTTQKLPDRKVSNQQMPDLEGLPPM- 72

Query: 78  EDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV 137
               L+ +F +   +  +          E    GSGF I+ DGYILT+NH++ D     V
Sbjct: 73  ----LREFFERGMPQPRAPRGGGGGQR-EAQSLGSGFIISPDGYILTNNHVIADADEILV 127

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLR 196
            L+D +EL AKLVGTD   D+A+LK++   K +PV +   + +++ G+ V  IG+PF   
Sbjct: 128 RLADRSELKAKLVGTDPRSDVALLKIEG--KDLPVLKLGKSQDLKAGQWVVAIGSPFGFD 185

Query: 197 GTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
            TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN  G V+G+N+ I T     
Sbjct: 186 HTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAGEVVGINSQIYTRSGGF 245

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           MGV   IP+ +       L S G+V  GW G++ Q + ++LA   GL    G+L+  +  
Sbjct: 246 MGVSFAIPIDVAMDVSNQLKSGGKVSRGWLGVVIQEVNKDLAESFGLDKPAGALVAQIQD 305

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             PA K G++VGDVI  ++G+ I    D    + +     + K+ + ++G + +V + +G
Sbjct: 306 GGPAAKGGLQVGDVILSMNGQPIIMSADLPHLVGALKAGSKAKLEVIRDGKRQNVELTVG 365

Query: 376 SSPTAKNDMHLEVGDK-------ELLGMVLQDINDGNKKLVRI---VALNPNREREVEAK 425
           + P     +      K         LG+ + ++ D  KK   +   V +   ++      
Sbjct: 366 AIPEEGATLDALGNTKPGAERSSNRLGIAVAELTDEQKKTFDLKSGVVIKEVQDGPAALI 425

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
           G+Q G  I  +N   +   K     I KA  K R
Sbjct: 426 GLQPGDVITHLNNQAIETTKQFTD-IAKALPKNR 458


>gi|293604229|ref|ZP_06686637.1| HtrA/DegQ/DegS family serine protease [Achromobacter piechaudii
           ATCC 43553]
 gi|292817454|gb|EFF76527.1| HtrA/DegQ/DegS family serine protease [Achromobacter piechaudii
           ATCC 43553]
          Length = 490

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 221/431 (51%), Gaps = 35/431 (8%)

Query: 37  SVDLPPVIARVS----PSIVSVMVEPKKKVSVEQM--FNAYGFGNLPEDHPLKNYFRKDF 90
           S   PP  A+++    P++V++ V   +KVS +    F  + FG +P             
Sbjct: 60  STSSPPNFAQITRDFGPAVVNISVSGTRKVSADDGDPFAQF-FGQIPGSR---------- 108

Query: 91  HKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLV 150
               S E P+  +       GSGF I+ DG ILT+ H+V+D    +V L+D  E  AK++
Sbjct: 109 GSMPSREVPMRGE-------GSGFIISADGIILTNAHVVQDAKEVTVKLTDRREYKAKVL 161

Query: 151 GTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           G D   D+AVLK+  D K +PV +  D N ++VGE V  IG+P+ L  T +AGIVSA  R
Sbjct: 162 GADPQTDVAVLKI--DAKNLPVVKVGDVNQLQVGEWVLAIGSPYGLENTATAGIVSAKGR 219

Query: 210 DIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIK 268
            +PD     F Q D  +N GNSGGP FN  G V+G+N+ I +      G+   IP+ +  
Sbjct: 220 SLPDDTSVPFIQTDVAVNPGNSGGPLFNDRGEVVGINSQIYSRTGGFQGLSFSIPIDVAY 279

Query: 269 KAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGD 328
           K    ++  G+V H   G+  Q + Q+LA    L    G+L+++V K S ADKAG++ GD
Sbjct: 280 KIKDQILEHGKVQHARLGVTVQEVNQDLANSFKLDTPSGALVSSVEKGSAADKAGLQPGD 339

Query: 329 VICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEV 388
           V+  ++G+ I S  D    I   SP E++K+ + + GS   +   LG  P  K+      
Sbjct: 340 VVRQINGKTIVSSGDLASMITLASPGEKIKLDVWRAGSPKELVATLGGVP--KDKTQTAS 397

Query: 389 GDKEL----LGMVLQDINDGNKKLVRIVALNPNREREVEAK-GIQKGMTIVSVNTHEVSC 443
           GD+E+    LG+ L+ ++   ++      L   R     AK GI+ G  ++S+N   V  
Sbjct: 398 GDQEVQRGQLGLALRPLSPQEQQASGTEGLLIERSAGPAAKAGIEPGDVLLSLNGVPVHN 457

Query: 444 IKDVERLIGKA 454
           +  V+  + KA
Sbjct: 458 VGQVKEALSKA 468


>gi|83941436|ref|ZP_00953898.1| Putative trypsin-like serine protease [Sulfitobacter sp. EE-36]
 gi|83847256|gb|EAP85131.1| Putative trypsin-like serine protease [Sulfitobacter sp. EE-36]
          Length = 372

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 117/337 (34%), Positives = 190/337 (56%), Gaps = 17/337 (5%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHP--LKNYFRKDFHKFFSGEEPI 100
           ++ ++SP++V + V    + +  Q+        LPE  P  L+  F +   +  +G +P+
Sbjct: 44  LVEQISPAVVFIEVTGTAEQASAQV-------QLPEGMPEELRKRFEQLMPQGPAGAQPM 96

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF ++ DG I+T+NH+V    +  V L+D     AK+VG+D L D+AV
Sbjct: 97  HG-------LGSGFIVSKDGMIVTNNHVVTGADTVKVKLADGRSFDAKVVGSDVLTDIAV 149

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFT 219
           LKV++D     V+F  ++++RVG+ V  +GNPF L GTV+ GI+SA  R+I   P   F 
Sbjct: 150 LKVEADVDLPAVKFGSSDDMRVGDEVVAMGNPFGLGGTVTTGIISAKSRNINAGPYDDFI 209

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +P  +++  +  L   G 
Sbjct: 210 QTDAAINRGNSGGPLFNNAGEVIGVNTAILSPDGGSVGIGFSVPSDLVQDIVADLSDDGE 269

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           +  GW G+  + +T E+A  LGL   KG++I A+  +SPA KAG++ GD+I   +   IK
Sbjct: 270 ITRGWLGVQIRPMTAEVAQVLGLDAPKGAVIEAIGDDSPAKKAGLEKGDIILSFNDTEIK 329

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
             +D    +A   P+ + ++ +  +G + +  V +G+
Sbjct: 330 ELRDLTRAVAETDPEAKAEVMVLHKGKEVTRTVTIGT 366


>gi|154249689|ref|YP_001410514.1| protease Do [Fervidobacterium nodosum Rt17-B1]
 gi|154153625|gb|ABS60857.1| protease Do [Fervidobacterium nodosum Rt17-B1]
          Length = 453

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 188/336 (55%), Gaps = 17/336 (5%)

Query: 86  FRKDFHKFFSGEEPIL---SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
           F ++F+K F G+ P     SD+V     GSGF I+ +GYI+T+ H+VE     +V L + 
Sbjct: 58  FIREFYKQFFGDIPRQFEESDSV-----GSGFIISKEGYIVTNYHVVEGAKKITVTLLNG 112

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
               A+ +G D   D+AV+K+   +    +E  D++ +++GE    IGNP   +  V+ G
Sbjct: 113 DTYDAQYIGGDEELDIAVIKISPKKDLPVIELGDSDKLQIGEWAIAIGNPLGFQHAVTVG 172

Query: 203 IVSALDRDIP--DRPGTFT---QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           ++SA+ R IP  D  G +T   Q DA IN GNSGGP  N  G VIG+N  I+   Q  M 
Sbjct: 173 VISAVGRKIPKPDGSGYYTNLIQTDAAINPGNSGGPLLNIYGQVIGINTAIINPSQ-AMN 231

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +G  IP++  K+ I  +I+ G+V+  + G+  Q +T+ LA  LGL+  KG  +  V K S
Sbjct: 232 IGFAIPINTAKRFINQIIATGKVEKAYLGVYVQTVTESLAKSLGLKVNKGVYVAQVEKGS 291

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           PA+KAG+K GDVI  L+G  ++  ++    + + +P  +VK++L + G + +V V LG+ 
Sbjct: 292 PAEKAGIKEGDVITKLNGSYVELAEELTSLVRNYTPGTKVKVTLNRAGKEITVEVTLGTF 351

Query: 378 PTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVA 413
           PT K         KE L + + +I   ++   ++ A
Sbjct: 352 PTQKTG---STAAKEFLNLKVSNITSDDRNKYKVPA 384


>gi|150021663|ref|YP_001307017.1| protease Do [Thermosipho melanesiensis BI429]
 gi|149794184|gb|ABR31632.1| protease Do [Thermosipho melanesiensis BI429]
          Length = 452

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 143/463 (30%), Positives = 235/463 (50%), Gaps = 56/463 (12%)

Query: 10  KSICTVALTCV-IFSSTYLVLEAKLPPSSV--DLPPVIARVSPSIVSV-MVEPKKKVSVE 65
           K +  + LT + IFS  Y+    + P + V  +  P + ++  ++ S   ++P     +E
Sbjct: 3   KRLGILILTVLAIFSFGYVNPNYESPITKVVDEAAPAVVKIEATVYSTSYIDP----FIE 58

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTS 125
           + F  + FG++P+ +  K                           GSGF    +GYILT+
Sbjct: 59  EFFKRW-FGDIPKQYQQKG-----------------------TSLGSGFIFEKEGYILTN 94

Query: 126 NHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGE 184
            H+V+   +  V L D  E  A+ +G D   D+A+LK+    + +PV EF D++ +++GE
Sbjct: 95  FHVVDGAENIKVSLLDGKEFSAEFIGGDKELDIAILKIDPKNQELPVLEFGDSDKLKIGE 154

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFT---QIDAPINQGNSGGPCFNALG 239
               IGNP   + TV+ G++SA  R IP  D  G +T   Q DA IN GNSGGP  N  G
Sbjct: 155 WAIAIGNPLGFQHTVTVGVISATGRKIPKPDNDGYYTNLIQTDAAINPGNSGGPLLNIHG 214

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIG+N  I+   +  M +G  IP++  K+ I S+I  G+ +  + G+  Q +T+ELA  
Sbjct: 215 QVIGINTAIIAPSE-AMNIGFAIPINTAKRFIDSIIKTGKAEKAYLGVYMQTVTKELAKA 273

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           LGL+  KG  I+ V+K+SPA+KAG+K GDVI  ++G  + S  +    I + +P  ++KI
Sbjct: 274 LGLKTDKGVFISQVIKDSPAEKAGLKDGDVIIEVEGLSVTSASELKSIIHNYTPGSKIKI 333

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE 419
            + ++G      V LG S     +       KE +G+ ++DI + +++  +I    P   
Sbjct: 334 IVNRKGKIIKFEVTLGKS----KETEKVTSAKEFMGLTVKDITNADREEYQI----PEEI 385

Query: 420 REVEAKG-----IQKGMTI--VSVN--THEVSCIKDVERLIGK 453
             V  K      I +G  I  +++N   +E+  I D  ++I K
Sbjct: 386 SGVVVKNSKISYISEGYVIFRIAINGQKYEIRNINDWNKVISK 428


>gi|148555269|ref|YP_001262851.1| protease Do [Sphingomonas wittichii RW1]
 gi|148500459|gb|ABQ68713.1| protease Do [Sphingomonas wittichii RW1]
          Length = 518

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 161/502 (32%), Positives = 246/502 (49%), Gaps = 72/502 (14%)

Query: 31  AKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDF 90
           A  P + +    + A++ P++V++        S  Q     G GN     P +  FR+  
Sbjct: 42  APRPGAPMSFADLAAKLQPAVVNI--------STTQKIQVRGGGNAFSGTPFEELFRR-- 91

Query: 91  HKFFSGE----EPILSDTVERLMFGSGFFITDDGYILTSNHIV----EDGA-----SFSV 137
             F  G+    +PI   T E    GSGF I+ DGY++T+NH++    E G+     S +V
Sbjct: 92  --FGGGQGDDGKPI---TREATSLGSGFIISPDGYVVTNNHVISASPEGGSGAVVSSITV 146

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLR 196
            L D  E  A +VG D   DLA+LK+  D K +P V+F D+   RVG+ V  IGNPF L 
Sbjct: 147 TLPDRKEYKATIVGRDQTSDLALLKI--DAKNLPFVQFGDSTRTRVGDWVVAIGNPFGLG 204

Query: 197 GTVSAGIVSALDRDIP-----DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           GTV+AGIVSAL R I      DR   + Q DA INQGNSGGP F+  G+VIG+N  I + 
Sbjct: 205 GTVTAGIVSALHRSIGINGPYDR---YIQTDASINQGNSGGPMFDLQGNVIGINTAIFSP 261

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
              ++G+G  IP    K  I  L +  RV  G+ G+  Q +T+++A  LGL   +G ++ 
Sbjct: 262 TGGNVGIGFAIPAEEAKPIIDQLRTGQRVRRGYLGVGIQPMTEDIASSLGLPKDRGEIVA 321

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V     A +AG++ GDVI  +D + I       + +   +   ++ I L +EG + +V 
Sbjct: 322 RVEPGEAAARAGIRQGDVIVRVDNQEITPDNTLSYIVGKAAVGARLPIELIREGQRKTVT 381

Query: 372 VVLGSSP-----TAKNDMHLEVGD--------------KELLGMVLQDIND------GNK 406
           V LG  P      +  ++  + GD              +  +G+ LQ +        G  
Sbjct: 382 VTLGERPPEDQLASAGNLDEDQGDDAPGAAQSAPDQSTRTAIGLGLQTLTPDIARRLGVS 441

Query: 407 KLVRIVALNP-NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
             +R V +N  +   +  A G Q    I+ +N   V+ ++     I +A++ KR +VLL 
Sbjct: 442 STLRGVVINYVDPSSDAAANGFQPRDIILQINNVPVATVQAAAAKITEAQKAKRPTVLLF 501

Query: 466 IKYDPDMQSGNDNMSRFVSLKI 487
           +      Q GN N  R+V ++I
Sbjct: 502 V------QRGN-NPPRYVGVQI 516


>gi|254464370|ref|ZP_05077781.1| S1C (protease Do) subfamily peptidase MucD [Rhodobacterales
           bacterium Y4I]
 gi|206685278|gb|EDZ45760.1| S1C (protease Do) subfamily peptidase MucD [Rhodobacterales
           bacterium Y4I]
          Length = 495

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 135/436 (30%), Positives = 226/436 (51%), Gaps = 38/436 (8%)

Query: 74  GNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
           G +PE  P +++FR+   +  +G  P  S        GSGF I++DGYI+T+NH++E   
Sbjct: 74  GIVPEGSPFEDFFREFQDRNGNGSRPRRSSA-----LGSGFVISEDGYIVTNNHVIEGAD 128

Query: 134 SFSVILSDDTE-----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
              +            LPA+++GTD   D+A+LKV++      V+F D++  RVG+ V  
Sbjct: 129 EIEIEFYPGEGQPKGLLPAEVIGTDPNTDIALLKVKAPAPLKFVKFGDSDTARVGDWVVA 188

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           +GNP     ++SAGIVSA +R++      + Q DA IN+GNSGGP FN  G V+GVN  I
Sbjct: 189 MGNPLGQGFSLSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMDGDVVGVNTAI 248

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           ++     +G+G  +  +++ K +  L   G    GW G+  Q++  +LA  +GL   +G+
Sbjct: 249 LSPNGGSIGIGFSMASNVVVKVVEQLKEYGETRRGWLGVKIQDVDADLAEAIGLEKARGA 308

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+T  V + PA  AG+  GDVI   DG  ++  +  V Q+ +    + V++ + +EG   
Sbjct: 309 LVTD-VPDGPAKDAGVLAGDVIVSFDGVDVRDTRGLVRQVGNAEVGKTVRVVVYREGKTE 367

Query: 369 SVAVVLG---------SSPTAKNDMHLEVGDKELLGMVL--------QDINDGNKKLVRI 411
           ++ V LG         S+P   N    +  +KELLG+ +         ++N G +++  +
Sbjct: 368 TLRVTLGRREDAERGPSAPETGNGAP-DSSEKELLGLSVGALTEQMRSELNVG-EEVEGL 425

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
             L+ +   E   KG++ G  I      +V  + D+E  + +AKE  R S+LL ++   +
Sbjct: 426 AILSVDETSEAWEKGLRAGDVITEAGQQKVVSVSDLEARVEEAKEAGRKSLLLLVRRGGE 485

Query: 472 MQSGNDNMSRFVSLKI 487
                    RFV+L +
Sbjct: 486 --------PRFVALNL 493


>gi|315224115|ref|ZP_07865955.1| protease do [Capnocytophaga ochracea F0287]
 gi|314945848|gb|EFS97857.1| protease do [Capnocytophaga ochracea F0287]
          Length = 471

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/273 (38%), Positives = 161/273 (58%), Gaps = 4/273 (1%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSG  IT DGYI+T+NH++ +  +  V L+++    AKL+GTDA  D+A+LK+++D K  
Sbjct: 108 GSGVIITPDGYIVTNNHVIANATTLEVTLNNNKTYTAKLIGTDASSDIALLKIEADEKLP 167

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG----TFTQIDAPIN 226
            + F D++N +VGE V  +GNPF L  TV+AGI+SA  R+I +R      +F Q DA +N
Sbjct: 168 FLTFADSDNTQVGEWVLAVGNPFNLNSTVTAGIISAKARNISERGSDKIESFIQTDAVVN 227

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGG   N  G +IG+N  I ++   +MG    +P +I KK +  LI  G V  G  G
Sbjct: 228 MGNSGGALVNLNGDLIGINTAISSTTGVYMGYSFAVPSNIAKKVVEDLIEYGNVQRGVMG 287

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q L  E+A  L ++ T+G  + +V  ES A  AG+K GD+I  +D   +  + D   
Sbjct: 288 VRGQGLDSEIAKKLNVKETEGFYVDSVDDESGAGAAGLKKGDIIKQIDNVKVHKYSDLSG 347

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT 379
            IAS+ P + +K++  +EG + +  + L  + T
Sbjct: 348 HIASKRPGDMLKVTYVREGKERTANITLKKNTT 380


>gi|328543002|ref|YP_004303111.1| serine protease DO-like protein [polymorphum gilvum SL003B-26A1]
 gi|326412748|gb|ADZ69811.1| Serine protease DO-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 493

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 139/409 (33%), Positives = 209/409 (51%), Gaps = 46/409 (11%)

Query: 110 FGSGFFITD-DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
            GSGF I   DG I+T+ H++E     +   +D T+L A+++G+D   DLAVLKV+  + 
Sbjct: 102 LGSGFVIDGVDGIIITNYHVIEGADEITANFNDGTKLVAEVLGSDEKTDLAVLKVKPTKP 161

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQ 227
              V+F D++ IRVG+ V  IGNPF L GTV+ GIVSA +RDI   P   F Q DA IN+
Sbjct: 162 LKAVDFGDSDAIRVGDWVMAIGNPFGLGGTVTVGIVSARNRDINAGPYDNFIQTDASINR 221

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP F+  G V+G+N  I++     +G+G  IP       I  L   G    GW G+
Sbjct: 222 GNSGGPLFDMDGKVVGINTAIISPSGGSIGIGFAIPAKTAVNVIAQLREFGETRRGWLGV 281

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T E+A  LG+   KG+L+  V ++ PA +A ++ GDVI   DGR + + +D    
Sbjct: 282 RIQEVTDEIAESLGMDEAKGALVAGVSEDGPAAQADIQPGDVIVSFDGRPVPAMRDLPRM 341

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVL-------------GSSPTAKNDMHLEVGDKELL 394
           +A  +  + V + + ++G + ++ V L             G++P  + +   +    E L
Sbjct: 342 VADTAIGKAVDVVVLRKGEEVTLQVTLGRLEDAEAAENGGGAAPKQETEQAPQ---SEAL 398

Query: 395 GMVLQDINDGNKKLVRIVALNPNREREVEA--------------KGIQKGMTIVSVNTHE 440
           GM+L D++D  ++  +I A       E+E               K +Q G  I  V    
Sbjct: 399 GMILADLDDALREKFQIDA-------EIEGVVVTEVAPGSVAADKRVQAGDVIKEVGQEP 451

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V+  KDV   I   K +KR S LL       + S      RFV L+I++
Sbjct: 452 VATPKDVLDRIAALKAEKRKSALL-------LLSNPTGELRFVPLRIEE 493


>gi|114776842|ref|ZP_01451885.1| trypsin domain/PDZ domain protein [Mariprofundus ferrooxydans PV-1]
 gi|114552928|gb|EAU55359.1| trypsin domain/PDZ domain protein [Mariprofundus ferrooxydans PV-1]
          Length = 452

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 143/422 (33%), Positives = 221/422 (52%), Gaps = 26/422 (6%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK 92
           +P S  DL    A  + S+V++    + K SV+ +   +GF   P+  P  ++F    H 
Sbjct: 9   MPDSFADLA---AAQADSVVNISTTKRVK-SVQGLPPGFGF---PKGSPFDDFF----HD 57

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
           F            E+   G+GF I+ DGYI+T+NH+V+      V + D +E  AK++GT
Sbjct: 58  FLRNMP-----EREQHALGTGFIISSDGYIVTNNHVVDSADEVLVKMRDGSEHKAKVIGT 112

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D+  D+A+LK+++      V+  D+  +RVG+ V  IGNPF L  TV+AGIVSA  R I 
Sbjct: 113 DSKLDVALLKIKASH-LKAVKLGDSEALRVGDWVVAIGNPFGLEQTVTAGIVSAKGRVIG 171

Query: 213 DRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
             P   F Q DA IN GNSGGP FN  G VIG+N  I +    + G+G  IP+++ K AI
Sbjct: 172 SGPYDDFIQTDAAINPGNSGGPLFNVRGEVIGINTAIYSRSGGNNGIGFAIPVNLAKSAI 231

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             L   G +     G+   ++ +E A  LGL+  +G+L+  V   S A+KAG++ GDVI 
Sbjct: 232 DELRRTGHITRARLGVHITDVDEETAKALGLKNREGALVPQVEAGSAAEKAGIRAGDVII 291

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-- 389
            +DG  +K   +   ++A  +P ++VKI + ++G +  + V + + P  K       G  
Sbjct: 292 SIDGIQVKKAHELPIRVARHTPGDKVKIGIIRDGKERIITVTVDTMPDDKVASRHTPGQT 351

Query: 390 DKELLGMVLQDIN-DGNKKLVRIVALNPNRER-----EVEAKGIQKGMTIVSVNTHEVSC 443
           DK  LG+V+Q++  D  ++L   V      ER          GI +G  I  +N  +V  
Sbjct: 352 DKVRLGIVVQELTRDIARQLHTRVHHGVAVERVQPGMPAARAGIMRGDVIYRINGEDVKS 411

Query: 444 IK 445
           +K
Sbjct: 412 MK 413



 Score = 46.6 bits (109), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%)

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
           + S  + G+ D    GI+ Q LT+++A  L  R   G  +  V    PA +AG+  GDVI
Sbjct: 342 VASRHTPGQTDKVRLGIVVQELTRDIARQLHTRVHHGVAVERVQPGMPAARAGIMRGDVI 401

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
             ++G  +KS + F   I++  P   +++ L + G +
Sbjct: 402 YRINGEDVKSMKAFTSTISAFKPGSVLRVMLDRGGDQ 438


>gi|144899065|emb|CAM75929.1| Peptidase S1C, Do [Magnetospirillum gryphiswaldense MSR-1]
          Length = 493

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 142/437 (32%), Positives = 216/437 (49%), Gaps = 42/437 (9%)

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
             P   P +++F++    F   +    +        GSGF I   GY++T+NH++ D   
Sbjct: 69  QFPPGSPFEDFFKE----FMERQARPDAAPKRATSLGSGFVIDAAGYVVTNNHVIADADE 124

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK-FIPVEFEDANNIRVGEAVFTIGNPF 193
            +V L DDT   A L+G D+  DLAVLK+   +K    V F +++  R+G+ V  IGNPF
Sbjct: 125 ITVTLHDDTTHKATLIGRDSKTDLAVLKIDPGKKTLTAVPFGNSDLSRIGDWVLAIGNPF 184

Query: 194 RLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
            L GTV+AGIVSA  RDI   P   F Q DA IN+GNSGGP FN+ G V+G+N  I +  
Sbjct: 185 GLGGTVTAGIVSARARDINAGPYDDFIQTDASINRGNSGGPLFNSAGEVVGINTAIFSPS 244

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              +G+G  IP ++ K  I  L   GR   GW G+  Q+L  ELA  +GL  +KG+L+ +
Sbjct: 245 GGSIGIGFAIPSTLAKPVIDDLKQFGRTRRGWLGVRIQSLDPELAESMGLTESKGALVAS 304

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           V    PA KA +K GDVI   DGR I   +     +A  +  ++  + + ++G +  V V
Sbjct: 305 VNAGGPAAKANLKPGDVILKFDGRDITEMRKLPRIVAETAIGKKAPVEIWRDGKRVIVDV 364

Query: 373 VLGSSPTAKNDMHLEVGDK---ELLGMVLQDINDGNKKLVRIVALNPN-RER-------- 420
            +G  P    ++  +  +K   +  G V+          + + ALNP  RER        
Sbjct: 365 AVGELPEEPEEVASKSPEKPQTQAQGQVIAGTG------LTVSALNPALRERFGLEEDTA 418

Query: 421 -----EVE-----AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
                EV+      KG++ G  I+      V    D+ + +  AK   +  +LL+++   
Sbjct: 419 GLVVTEVKDGPAAEKGMKPGDVIIEAGNKPVRNPADLTKAVEAAKASSQKFLLLRVE--- 475

Query: 471 DMQSGNDNMSRFVSLKI 487
                N    R+V+L +
Sbjct: 476 -----NPQALRYVALPL 487


>gi|218885412|ref|YP_002434733.1| protease Do [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756366|gb|ACL07265.1| protease Do [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 481

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 142/442 (32%), Positives = 226/442 (51%), Gaps = 41/442 (9%)

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM 109
           ++V++  E K   + E  FN   F N+P   P   +F + F KF   ++       ++  
Sbjct: 42  AVVNISTE-KTVQAAENPFNEL-FRNMPPGTPFDKFFDQ-FEKFHGRQQ----RPQKQRS 94

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILS----DDTELPAKLVGTDALFDLAVLKVQS 165
            GSGF I+ DGYI+T+NH+V +     V L           A ++GTD   DLA+LK+ +
Sbjct: 95  LGSGFIISTDGYIVTNNHVVAEADVIRVNLQGASGKSNSYVANVIGTDEETDLALLKINA 154

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAP 224
                 + F D++ + VGE +  IGNPF L  +V+AGI+SA  RDI   P   F Q DA 
Sbjct: 155 GNTLPVLPFGDSDKLEVGEWLLAIGNPFGLDHSVTAGILSAKGRDIRSGPFDNFLQTDAS 214

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           IN GNSGGP  N  G VIG+N  I+ SGQ   G+G  IP ++ ++ I  L ++G+V  GW
Sbjct: 215 INPGNSGGPLLNMNGQVIGINTAIIASGQ---GIGFAIPSNMAERVIAQLRAEGKVRRGW 271

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  Q++ +  A  LGL   +G+L+ +V+   PADKAG+K GD++  ++G  +      
Sbjct: 272 IGVTIQDVDEATARALGLGEPRGALVGSVMPGEPADKAGLKPGDIVLKVEGDDVSDSSQL 331

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS-----PTAKNDMHLEVGDKEL----LG 395
           + +IA+  P +  K++L + G   +V + LG          + D   E   KE     LG
Sbjct: 332 LRRIAALKPGDTTKLTLWRNGQTKTVNLTLGERTAEHLTAQRGDAAPEKSGKEQASAGLG 391

Query: 396 MVLQDINDGNKK-----------LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
           M ++ ++  + +           +V +    P  E ++ A     G  I+  N   V+  
Sbjct: 392 MSVRPVSAEDARNLKLEEARGLLVVSVEGGKPAAEADIRA-----GDIILLANLKPVNTA 446

Query: 445 KDVERLIGKAKEKKRDSVLLQI 466
            D+ ++I +   KKR +V+LQ+
Sbjct: 447 ADLTKVI-EQDGKKRGAVMLQL 467


>gi|319776144|ref|YP_004138632.1| periplasmic serine protease do/HhoA-like [Haemophilus influenzae
           F3047]
 gi|317450735|emb|CBY86955.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae F3047]
          Length = 463

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/452 (29%), Positives = 233/452 (51%), Gaps = 31/452 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + ++AL   + S+++ V +A LP        L P++ +V P++V++ VE K KV     F
Sbjct: 8   LNSIALGLSVLSTSF-VAQATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPF 66

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILTSN 126
                 N+PE+   K +F   F + F G      ++       GSG  I    GY+LT+N
Sbjct: 67  ----LDNIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLTNN 116

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+++     +V L D  E  AKLVG D   D+A+++++       ++F D++ +RVG+  
Sbjct: 117 HVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSDKLRVGDFT 176

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIG 243
             IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +IG
Sbjct: 177 VAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGELIG 236

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    + 
Sbjct: 237 INTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVS 296

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++  +
Sbjct: 297 AQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLR 356

Query: 364 EGSKHSVAVVL----GSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE 419
           +G  H+V + L    GS  ++K ++        L G  L+D +    K + I  + PN  
Sbjct: 357 DGKSHNVKMKLQADDGSQLSSKTEL------PALDGATLKDYDAKGVKGIEITKIQPN-- 408

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
                +G++ G  I+ +N   +  I+++ +++
Sbjct: 409 SLAAQRGLKSGDIIIGINRQMIENIRELNKVL 440


>gi|331005218|ref|ZP_08328611.1| HtrA protease/chaperone protein [gamma proteobacterium IMCC1989]
 gi|330420961|gb|EGG95234.1| HtrA protease/chaperone protein [gamma proteobacterium IMCC1989]
          Length = 467

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 205/386 (53%), Gaps = 19/386 (4%)

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            LPE+ P      + F   F  + P   +  +    GSGF I++ GYILT+NH+V+    
Sbjct: 62  QLPENIP------EIFRHLFEQQMPQRQNRRQGNSMGSGFLISESGYILTNNHVVDGATD 115

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPF 193
             V L D  E  A +VG D   DLA+LK+  D + +P +E  +++N+ VGE V  IG+PF
Sbjct: 116 IMVRLIDRREFDATVVGVDPQTDLALLKI--DAESLPYLELANSDNLLVGEWVLAIGSPF 173

Query: 194 RLRGTVSAGIVSALDRDIPDRPGT----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
            L  +VSAGIVSA+ R IP         F Q D  IN GNSGGP FN  G V+G+N+ I 
Sbjct: 174 GLDYSVSAGIVSAIGRSIPSGQQQNYVPFIQTDVAINPGNSGGPLFNLEGQVVGINSQIY 233

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           T+    +G+   IP ++ K  +  L   GRVD GW G++ Q++ ++LA+  GL   +G+L
Sbjct: 234 TNSGGSIGLSFAIPANLAKSVVAQLKESGRVDRGWLGVVIQDVGKDLALSFGLDKPQGAL 293

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           I  + K+ P   +G+KV D+I   +G+ I+   D    +    P   V   + ++G K +
Sbjct: 294 IAQLDKKGPGQASGLKVSDIILSFNGKDIQRSSDLPHIVGPIKPGTTVPAQVMRKGKKLT 353

Query: 370 VAVVLGSS--PTAKNDMHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREVEA 424
           + + +GS   P    +   +  +K  +G  ++D+ D  +++V    +V ++   +     
Sbjct: 354 LQITVGSRNMPVTTQERSSQA-EKSRIGAAVEDLTDDEREIVGLDGVVIIDVRPDSPAAK 412

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERL 450
            G+++G  IV +   +VS ++   ++
Sbjct: 413 AGLRQGDVIVQLGFEDVSSVQSFNQI 438


>gi|114046185|ref|YP_736735.1| peptidase Do [Shewanella sp. MR-7]
 gi|113887627|gb|ABI41678.1| peptidase Do. Serine peptidase. MEROPS family S01B [Shewanella sp.
           MR-7]
          Length = 450

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 152/465 (32%), Positives = 235/465 (50%), Gaps = 51/465 (10%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPS----SV-DLPPVIARVSPSIVSVMVEPK-- 59
           LSV S   +A T  +  +     +A +P S    S+  L P++ R +P++VSV V     
Sbjct: 5   LSVLSAAMLAATLTMMPAAS---QAAIPQSVEGQSIPSLAPMLERTTPAVVSVAVSGTHV 61

Query: 60  KKVSVEQMFNAYGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-T 117
            K  V  +F  Y FG N P++   +  FR                       GSG  I  
Sbjct: 62  SKQRVPDVFR-YFFGPNAPQEQVQERPFRG---------------------LGSGVIIDA 99

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
           D GYI+T+NH+++      V L D  E+ AKL+GTD+  D+A+L++++ +  + ++  D+
Sbjct: 100 DKGYIVTNNHVIDGADDIQVGLHDGREVKAKLIGTDSESDIALLQIEA-KNLVAIKTSDS 158

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCF 235
           + +RVG+    IGNPF L  TV++GIVSAL R     +    F Q DA IN GNSGG   
Sbjct: 159 DELRVGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALV 218

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G +IG+N  IV  G  ++G+G  IP +++K  +  +   G V  G  GI  ++L  +
Sbjct: 219 NLKGELIGINTAIVAPGGGNVGIGFAIPANMVKNLVAQIAEHGEVRRGVLGISGRDLDSQ 278

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA   GL    G  +  V   S A+KAG+K GD+I  +DGR IKS Q+   ++A+     
Sbjct: 279 LAQGFGLDTQHGGFVNEVTAGSAAEKAGIKAGDIIVSVDGRAIKSFQELRAKVATMGAGA 338

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALN 415
           +V++ L ++G K +V V LG +          V    L G  L++ + G  ++  +   +
Sbjct: 339 KVELGLIRDGDKKTVNVTLGEASQTTEKAAGAV-HPMLQGASLENASKG-VEITEVAQGS 396

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
           P         G+QKG  IV +N    S +KD++ L    KE+ +D
Sbjct: 397 P-----AAMSGLQKGDVIVGINR---SAVKDLKSL----KEQLKD 429


>gi|319792221|ref|YP_004153861.1| protease do [Variovorax paradoxus EPS]
 gi|315594684|gb|ADU35750.1| protease Do [Variovorax paradoxus EPS]
          Length = 494

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 150/493 (30%), Positives = 243/493 (49%), Gaps = 42/493 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLE-----AKLPPSSVDLPPVIARVSPSIVSVM 55
           MFK +   ++S        +   +T+L +E      +  P   DL   + +V PS+V++ 
Sbjct: 2   MFKVEGHKLRSGVLAFALALTAGATFLPVEPVHAQTRTLPDFTDL---VDQVGPSVVNIR 58

Query: 56  VEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG--------EEPILSDTVER 107
                  +VE++    G GN   D  ++ +FR+ F +   G          P      ER
Sbjct: 59  -------TVEKVAQ-RGAGNGEMDEEMQEFFRRFFGQPAPGTPRQGPRPNRPQQPQEEER 110

Query: 108 LM-FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGF +T DGY++T+ H+VED +   V L D  E  AK+VG D   D+AV+K+++ 
Sbjct: 111 PRGVGSGFILTADGYVMTNAHVVEDASEVLVTLPDKREFKAKIVGADKRTDVAVVKIEAT 170

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPIN 226
                V+  D + +RVGE V  IG+PF L  TV+AGIVSA  RD  +    F Q D  IN
Sbjct: 171 -GLPAVKVGDISKLRVGEWVMAIGSPFGLENTVTAGIVSAKQRDTGEYL-PFIQTDVAIN 228

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  N  G V+G+N+ I +     MG+   IP+    +    L + GRV  G  G
Sbjct: 229 PGNSGGPLINMRGEVVGINSQIYSRSGGFMGISFSIPIDEAIRVSEQLRTSGRVSRGRIG 288

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +    +T+++A  +GL   +G+L+  V   SP +KAG++ GDVI   DG+ I+   D   
Sbjct: 289 VQIDQVTKDVAEAIGLSKAQGALVRGVEAGSPGEKAGVEPGDVITKFDGKAIEKPSDLPR 348

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-----------ELLG 395
            + +  P  +  +++ + GS   ++V +      K        D+           + +G
Sbjct: 349 LVGNTKPGTKSTLTVFRRGSSRDLSVTIAEIEPDKPAKRASDRDEPAPKPSASAAAKSIG 408

Query: 396 MVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
           + + D+ND  KK +++   V ++   E    A G+++G  I++V   EV+  ++ E  + 
Sbjct: 409 LAVSDLNDAQKKELKLKGGVKVDAASEGAARA-GLREGDIILAVGNIEVANTREFEAALA 467

Query: 453 KAKEKKRDSVLLQ 465
           KA + K  SVL +
Sbjct: 468 KADKSKALSVLFR 480


>gi|260220632|emb|CBA28366.1| hypothetical protein Csp_A06910 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 492

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 136/420 (32%), Positives = 210/420 (50%), Gaps = 31/420 (7%)

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVER 107
           P++V++ V+   K S            +P+  P     R  F++FF   + P  SD    
Sbjct: 74  PAVVNISVQGAVKTSARS--------GVPQLDP-----RDPFYEFFRRFQPPAESDNAPT 120

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSGF +  DG +LT+ H+V D +  +V L D  E  AK++G D L D+AVLK+  D 
Sbjct: 121 RGTGSGFIVKADGVVLTNAHVVADASEVTVKLKDKREFKAKVLGIDKLSDVAVLKI--DA 178

Query: 168 KFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPI 225
           K +P V+  D  N RVGE V  IG+PF    TV+AGIVSA  R +PD     F Q D  I
Sbjct: 179 KDLPTVKIGDPKNSRVGEWVVAIGSPFGFENTVTAGIVSAKSRSLPDEGYVPFLQTDVAI 238

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N GNSGGP FN  G VIG+N+ I +    + G+   IP+ +  K    L++ G+V  G  
Sbjct: 239 NPGNSGGPLFNLAGEVIGINSQIYSRSGGYQGLSFAIPIDVAMKVEGQLLAHGKVSRGRL 298

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q ++ ELA   GL    G+L+ +V K S ADKAG++ GDVI   +G  I    +  
Sbjct: 299 GVTIQEVSPELAESFGLDKPAGALVNSVDKGSAADKAGLQAGDVILKFNGTAISQSSELP 358

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGN 405
             ++  +P     +S+ ++G    +++ LG   + K          + LG+ ++ +N   
Sbjct: 359 PLVSDTAPGSNAALSVWRQGKPKELSITLGQMESGKVAAESAAPQDKQLGLAVRPLNRQE 418

Query: 406 KKLVRI--------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK 457
           +   ++        VA  P +       G++ G  I+SVN    S    ++  +G+ ++K
Sbjct: 419 RAEAQVAGGLVVEDVADGPAKR-----AGLRSGDVILSVNGELASSPDTLKSQLGQGRKK 473


>gi|221124326|ref|XP_002162245.1| PREDICTED: similar to Serine protease HTRA2, mitochondrial [Hydra
           magnipapillata]
          Length = 438

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 137/420 (32%), Positives = 210/420 (50%), Gaps = 31/420 (7%)

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVER 107
           P++V++ V+   K S            +P+  P     R  F++FF   + P  SD    
Sbjct: 20  PAVVNISVQGAVKTSARS--------GVPQLDP-----RDPFYEFFRRFQPPAESDNAPT 66

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSGF +  DG +LT+ H+V D +  +V L D  E  AK++G D L D+AVLK+  D 
Sbjct: 67  RGTGSGFIVKADGVVLTNAHVVADASEVTVKLKDKREFKAKVLGIDKLSDVAVLKI--DA 124

Query: 168 KFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPI 225
           K +P V+  D  N RVGE V  IG+PF    TV+AGIVSA  R +PD     F Q D  I
Sbjct: 125 KDLPTVKIGDPKNSRVGEWVVAIGSPFGFENTVTAGIVSAKSRSLPDEGYVPFLQTDVAI 184

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N GNSGGP FN  G VIG+N+ I +    + G+   IP+ +  K    L++ G+V  G  
Sbjct: 185 NPGNSGGPLFNLAGEVIGINSQIYSRSGGYQGLSFAIPIDVAMKVEGQLLAHGKVSRGRL 244

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q ++ ELA   GL    G+L+ +V K S ADKAG++ GDVI   +G  I    +  
Sbjct: 245 GVTIQEVSPELAESFGLDKPAGALVNSVDKGSAADKAGLQAGDVILKFNGTAISQSSELP 304

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGN 405
             ++  +P     +S+ ++G    +++ LG   + K          + LG+ ++ +N   
Sbjct: 305 PLVSDTAPGSNAALSVWRQGKPKELSITLGQMESGKVAAESAAPQDKQLGLAVRPLNRQE 364

Query: 406 KK--------LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK 457
           +         +V  VA  P +       G++ G  I+SVN    S    ++  +G+ ++K
Sbjct: 365 RAEAQVAGGLVVEDVADGPAKR-----AGLRSGDVILSVNGELASSPDTLKSQLGQGRKK 419


>gi|58039264|ref|YP_191228.1| serine protease [Gluconobacter oxydans 621H]
 gi|58001678|gb|AAW60572.1| Serine protease, HtrA/DegQ/DegS family [Gluconobacter oxydans 621H]
          Length = 519

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 130/382 (34%), Positives = 199/382 (52%), Gaps = 39/382 (10%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I+ DGY++T+NH+V      +V L D T LPAK++G D   D+A+L+V+   K  
Sbjct: 121 GSGFIISSDGYVVTNNHVVNGATKVTVTLDDGTTLPAKIIGRDPKTDVALLRVKPTGKLP 180

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            +E  D++ ++ GE V  +GNP+ L GTV+AGIVSAL RD+       F Q+DAPIN GN
Sbjct: 181 FIELGDSDEVQPGEWVIAVGNPYGLGGTVTAGIVSALGRDLHSGAYNDFIQVDAPINHGN 240

Query: 230 SGGPCFNALGHVIGVNAMIVT-SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           SGGP F   G V+G+N+MI++ +G   +G+G  IP   +K  +  L   G V  G+ GI 
Sbjct: 241 SGGPLFTQDGKVVGINSMIISPNGGGSIGIGFAIPSDTVKSVVSQLEKTGHVTRGYLGIE 300

Query: 289 TQNLTQELAIPLGLRG------TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
            Q+++  +A  L L+        +G+L+ +V K SPA+KAG+K GDV+  L+G+ IK+  
Sbjct: 301 GQDISPTMAQALNLQSPEPGAPPRGTLVASVSKGSPAEKAGIKSGDVVTTLNGKPIKNGH 360

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIN 402
           D   ++ S +P     + L ++    +V   +G         +L   D    G       
Sbjct: 361 DLAVKVVSIAPGTPATLGLLRDSKPMTVNFTVG---------NLSAQDHS-SGDATDSAQ 410

Query: 403 DGNKKL-VRIVALNPNREREV--------------------EAKGIQKGMTIVSVNTHEV 441
            G  KL V + +L P   +E+                    +  GI+ G  IV+V  H  
Sbjct: 411 SGAGKLGVSLASLTPRARQELGLDDSVQGAVVADVVQGSPADQSGIRPGDIIVAVGNHVT 470

Query: 442 SCIKDVERLIGKAKEKKRDSVL 463
              K V   + +A  +K+  +L
Sbjct: 471 PSPKAVVAQVHEALGRKQPPLL 492


>gi|92118235|ref|YP_577964.1| peptidase S1C, Do [Nitrobacter hamburgensis X14]
 gi|91801129|gb|ABE63504.1| Peptidase S1C, Do [Nitrobacter hamburgensis X14]
          Length = 497

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 129/396 (32%), Positives = 210/396 (53%), Gaps = 25/396 (6%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF +   G ++T+NH++ D    +VIL+D  ++ A++VG D   DLAVLK +     
Sbjct: 108 LGSGFIVDPAGIVVTNNHVIADSDEINVILNDGIKVKAEIVGVDKKTDLAVLKFKPPHPL 167

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
             V+F D++ +R+GE V  IGNPF L GTV+AGIVSA +RDI + P  ++ Q DA IN+G
Sbjct: 168 TAVKFGDSDKLRLGEWVVAIGNPFSLGGTVTAGIVSARNRDINNGPYDSYIQTDAAINRG 227

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G V+GVN +I++     +G+G  +P   +   +  L   G +  GW G+ 
Sbjct: 228 NSGGPLFNLDGEVVGVNTLIISPSGGSIGIGFAVPSKTVAGVVDQLRQFGELRRGWLGVR 287

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +T E+A  L ++  +G+L+  V  + PA  AG++ GDVI   DG+ IK  +D    +
Sbjct: 288 IQQVTDEIADSLNIKPARGALVAGVEDKGPAKPAGIEPGDVIIAFDGKDIKEPKDLSRIV 347

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLG-------SSPTA---KNDMHLEVGDKELLGMVL 398
           A  +  + V + + ++G + +  V LG       ++P +   K D   +   ++ LG+ L
Sbjct: 348 ADTAVGKTVNVMIIRKGKQETKKVTLGRLDDSDKATPVSVKTKPDSDDKPVTQKALGLDL 407

Query: 399 QDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
             ++   +   +I       +  + + + +   K +  G  IV V    VS   D+ + I
Sbjct: 408 AALSKDLRTRYKIKDSVKGVIITDVDADSDAAEKRLSAGDVIVEVAQEAVSSASDIRKRI 467

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            + K+  + +VLL       M S      RFV+L +
Sbjct: 468 DQLKKDGKKAVLL-------MVSNGTGELRFVALSL 496


>gi|313201518|ref|YP_004040176.1| protease do [Methylovorus sp. MP688]
 gi|312440834|gb|ADQ84940.1| protease Do [Methylovorus sp. MP688]
          Length = 473

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 146/498 (29%), Positives = 240/498 (48%), Gaps = 64/498 (12%)

Query: 18  TCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLP 77
           TC I  +      AK  P   D   +  +  P++V++ +    +V   Q      F  +P
Sbjct: 8   TCAILITVSGTASAKDLP---DFTELAEKQGPAVVNISIT---QVMHGQAEGTVPFPGMP 61

Query: 78  EDHPLKNYFRKDFHKFFSGE-EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           +D  L  + R+       G+         +    GSGF I++DGYILT+ H+V +     
Sbjct: 62  DDPALGEFLRRFGIPGMPGQGNGAPQQDYKSQSLGSGFIISNDGYILTNAHVVNEADEVL 121

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRL 195
           V LSD  E  AK++G+D   D+A++K+  D   +P V   D N ++VGE V  IG+PF L
Sbjct: 122 VKLSDKREFKAKIIGSDRRTDVALIKI--DATNLPKVTIGDPNQLKVGEWVAAIGSPFGL 179

Query: 196 RGTVSAGIVSALDRDIPDR---PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
             T++AGIVSA  R +P     P  F Q D  IN GNSGGP FN  G V+G+N+ I +  
Sbjct: 180 ENTMTAGIVSAKGRALPQENFVP--FIQTDVAINPGNSGGPLFNLRGEVVGINSQIYSRS 237

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              MG+   IP+ +       L + G+V  GW GI  Q +T++LA   G++ T G+L+  
Sbjct: 238 GGSMGLSFSIPIDVAIDVSNQLKANGKVTRGWLGIGIQEITKDLADSFGMKSTNGALVAG 297

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           V K +PA+K G++ GDVI   DG+ + +  D    + +  P + V + + ++GS  ++ +
Sbjct: 298 VEKGAPAEKGGLEAGDVIVKFDGKPVLTSSDLPRIVGATKPGKTVPVEVLRKGSTKTLNI 357

Query: 373 VLGSSPTAKNDM--------HLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEA 424
            +G +PT K+ +          EV     LG+VL++             L P ++R++  
Sbjct: 358 TVGEAPTEKDGVAPTPKGSAKPEV---NRLGLVLRE-------------LTPVQKRKLSG 401

Query: 425 KG---------------IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           K                I++G  ++ +N  EV  ++   + +      K  ++L+Q    
Sbjct: 402 KNGLLVVDAQGAAAQAGIRRGDVVLGLNNTEVQSLEQFNKQLAGVASGKTVALLVQ---- 457

Query: 470 PDMQSGNDNMSRFVSLKI 487
                  D+ + +V LK+
Sbjct: 458 ------RDDNTLYVPLKL 469


>gi|40063421|gb|AAR38232.1| MucD protein [uncultured marine bacterium 580]
          Length = 466

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 138/425 (32%), Positives = 216/425 (50%), Gaps = 31/425 (7%)

Query: 60  KKVSVEQMFNAYGFGNL---PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI 116
           K V++  + NA   GN    P++  ++ +F +       G  P      +    GSGF +
Sbjct: 38  KVVNISSIKNAVNRGNQQLSPQEEHMQEFFNRFGIPMPPGMGPNDQQQKQMSATGSGFIL 97

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFE 175
             DGYI+T+ H+V +  S  V L+D  E  AKL+G D   D+A+LK+  D K +P V+  
Sbjct: 98  ESDGYIITNAHVVGEADSIIVKLADKREFQAKLLGIDKRTDVALLKI--DAKNLPAVKLG 155

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT--FTQIDAPINQGNSGGP 233
           +  NI+VGE V  IG+PF L  T++ G+VSA  R +P +     F Q D  IN GNSGGP
Sbjct: 156 NPKNIKVGEWVAAIGSPFGLENTMTVGVVSAKGRALPQQENYVPFIQTDVAINPGNSGGP 215

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
            FN  G VIG+N+ I +    +MG+   IP+ +       L + G+V  GW GI  Q +T
Sbjct: 216 LFNTNGEVIGINSQIYSRTGGYMGLSFAIPIDVAMNVADQLKNNGKVVRGWLGIAIQEVT 275

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
            EL   LGL+   G+L+ AV K +PA KAG++ GDVI   + ++IK+  D    +    P
Sbjct: 276 DELTEALGLKDKSGALVAAVNKGAPAGKAGIEAGDVILKFNNKVIKTSSDLPKYVRLTKP 335

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL-------LGMVLQDIN---- 402
              V + + + G   ++ V +G  P    D  ++  +K+        +G+VL++      
Sbjct: 336 NNIVPVEIWRNGKVKTLRVKIGEMP----DDRMQASNKKTIKESANRIGLVLKEATTKDK 391

Query: 403 ---DGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
              DG   LV   A  P    +     I++G  I+++N   V+ ++   R I K  + K 
Sbjct: 392 KMLDGRNGLVVTKASGPAVSSQ-----IREGDIILALNNTPVTSVRAFNREINKTPKGKT 446

Query: 460 DSVLL 464
            ++L+
Sbjct: 447 IALLI 451


>gi|224368971|ref|YP_002603135.1| DegP [Desulfobacterium autotrophicum HRM2]
 gi|223691688|gb|ACN14971.1| DegP [Desulfobacterium autotrophicum HRM2]
          Length = 477

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 159/467 (34%), Positives = 232/467 (49%), Gaps = 32/467 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVS----PSIVSVMVEPKKKVSVEQM 67
           +   AL  V F S  +   A L  S V +P   + ++    P++V++      K      
Sbjct: 12  LSAAALAMVAFVS--IPATAALGKSVVMVPESFSELAKHAKPAVVNIRTVKVTKEGGRVF 69

Query: 68  FNAYG--FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTS 125
            + YG  FG+       K+ FR+ F  F   ++P       +   GSGF I+ DGYI+T+
Sbjct: 70  KHFYGQPFGD-------KDPFREFFEPFLR-QQP--QKDYRQQSLGSGFIISSDGYIVTN 119

Query: 126 NHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
           NH+V +     V L DD E  AK+VGTD+  DLA++K+   +    +E  D++ + VG  
Sbjct: 120 NHVVAEADEIKVKLYDDKEYDAKMVGTDSKTDLALIKIDV-KGLDYLELGDSDVLEVGTW 178

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  IG+PF L  TV+AGIVSA  R I   P   F Q DA IN GNSGGP  N  G V+G+
Sbjct: 179 VVAIGSPFGLEQTVTAGIVSAKGRIIGSGPYDDFIQTDASINPGNSGGPLLNLEGEVVGI 238

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  IV SGQ   G+G  IP  +    +  L S G V  GW G+  Q++T ELA    L+ 
Sbjct: 239 NTAIVASGQ---GIGFAIPSKLAAGIVDQLRSSGEVTRGWMGVAIQDITPELAEYYNLKE 295

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
             G L+  V K  PADKAG+  GDVI  + G ++ S +D    IA      +V ++L ++
Sbjct: 296 KSGVLVAKVYKGDPADKAGIVPGDVITHVKGDVVTSSRDLSTAIAGLGVGSKVPVTLVRD 355

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGN-------KKLVRIVALNPN 417
           G   +V VVL     ++    L     +  G+ LQ ++  N       K++  +V  +  
Sbjct: 356 GKAKTVFVVLVKRTDSEQGEALVQSGFDEFGLNLQALDSTNAEQLGYAKEVRGLVVTDIE 415

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
            E +  A GI++G  +  VN   V  +   E +   AK KK ++V L
Sbjct: 416 PEGKAAASGIRQGDLLSEVNHIRVKTMD--EYVATLAKIKKGEAVQL 460


>gi|206603015|gb|EDZ39495.1| Peptidase S1C, Do [Leptospirillum sp. Group II '5-way CG']
          Length = 500

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 133/409 (32%), Positives = 217/409 (53%), Gaps = 35/409 (8%)

Query: 85  YFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
           +FR+ F   F+         VER + GSGF I+ DGYI+T+ H+++     +V+LSD T 
Sbjct: 93  FFRQFFGTPFNHGGGPPQKHVERSL-GSGFIISKDGYIVTNYHVIKHATKVTVVLSDKTS 151

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
             AK+VG D + D+AV+++        + +  + ++ VG  V  +G+PF L  +++ GIV
Sbjct: 152 YRAKVVGKDPMTDVAVIRIHPKHDLPVIRWGSSRDVSVGTIVLAMGSPFGLTQSITMGIV 211

Query: 205 SALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           SAL R     ++   F Q DA IN GNSGGP  N  G VIG+N  I T+   + G+G  I
Sbjct: 212 SALKRSNMGIEQYENFIQTDAAINPGNSGGPLVNLKGEVIGMNTAIYTTNGGYEGIGFAI 271

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P+ ++++ +  L++KG+V  GW G+  QN+T  +A    L G +G L++ V+  SPA KA
Sbjct: 272 PVDMVRRVLKDLMTKGKVVRGWLGVSIQNVTPVIAKQFRLPGHRGVLVSDVLPNSPAKKA 331

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-- 380
           GMK GDVI  L+G+ +    D   +++  +P     +S+ ++G + ++ V +G  P+   
Sbjct: 332 GMKRGDVILGLNGQDVMDANDLRLRVSQITPGTDATLSIIRDGRRRNITVRVGELPSKLS 391

Query: 381 --------KNDMHLEVGDKELLGMVLQDIN---------DGNKKLVRIVALNPNREREVE 423
                   K+  H    D  L G+++ ++N           N + V I A+ P      E
Sbjct: 392 MMGGAEPEKSPSHF---DNVLNGIMVMNLNRDIRGQLNLPDNTRGVVISAIAPG--SLAE 446

Query: 424 AKGIQKGMTIVSVNTHEVSCIK---DVERLIGKAKEKKRDSVLLQIKYD 469
           A G+++G  I  +N   V+ +     V R IGK+     ++VLL +  D
Sbjct: 447 ASGLKRGDVIQEINRRPVTSVHAYIRVARHIGKS-----ENVLLTVLRD 490



 Score = 39.3 bits (90), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL-RGTKGSLITAVVKESPADKA 322
           LS++  A P   S    D+   GIM  NL +++   L L   T+G +I+A+   S A+ +
Sbjct: 390 LSMMGGAEPEK-SPSHFDNVLNGIMVMNLNRDIRGQLNLPDNTRGVVISAIAPGSLAEAS 448

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           G+K GDVI  ++ R + S   ++         E V +++ ++G    V++
Sbjct: 449 GLKRGDVIQEINRRPVTSVHAYIRVARHIGKSENVLLTVLRDGHHSYVSL 498


>gi|226943494|ref|YP_002798567.1| HtrA serine protease [Azotobacter vinelandii DJ]
 gi|226718421|gb|ACO77592.1| HtrA serine protease [Azotobacter vinelandii DJ]
          Length = 473

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 134/424 (31%), Positives = 210/424 (49%), Gaps = 33/424 (7%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           KS  +V L   +     L ++A+LP    +   ++   SP++V++          +++ +
Sbjct: 7   KSFASV-LAGALLLGQSLFVQAQLP----EFTSLVEEASPAVVNISTR-------QKLPD 54

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------ERLMFGSGFFITDDGYIL 123
                 LP+   L   FR+    F     P L  T       E    GSGF I+ DGY+L
Sbjct: 55  RSTVQGLPDLEGLPPLFRE----FLERSIPQLPRTPDNGRQREAHSLGSGFIISPDGYVL 110

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+NH+V D     V LSD +EL A+LVG D L D+A+LKV+       V+    + +RVG
Sbjct: 111 TNNHVVADADEIIVRLSDRSELEAELVGADPLTDVALLKVKGS-NLPTVKLGRTDQLRVG 169

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVI 242
           E V  IG+PF    +V+AGI+SA  R +P+     F Q D  IN GNSGGP F+  G VI
Sbjct: 170 EWVLAIGSPFGFDHSVTAGIISATGRSLPNESYVPFIQTDVAINPGNSGGPLFDLDGRVI 229

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA   GL
Sbjct: 230 GINSQIFTRSGGFMGLSFAIPIEVAMGVADQLKATGKVARGWLGVIIQEVNKDLAESFGL 289

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
               G+L+  V+++ PADK G++VGDVI  LDG  I    D    +    P     + + 
Sbjct: 290 DRPAGALVAQVLEDGPADKGGLQVGDVILSLDGHPIVMSADLPHLVGGLKPGAAANLEVV 349

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREV 422
           ++G + ++A+ +G+ P   N +   +   E            N+  V +  L   +++ +
Sbjct: 350 RDGKRRNIAITVGALPEEGNGVQPSIAGTE---------QSSNRLGVTVTELTAEQKKSL 400

Query: 423 EAKG 426
           + KG
Sbjct: 401 DLKG 404


>gi|260913606|ref|ZP_05920082.1| protease DO [Pasteurella dagmatis ATCC 43325]
 gi|260632145|gb|EEX50320.1| protease DO [Pasteurella dagmatis ATCC 43325]
          Length = 459

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 136/454 (29%), Positives = 232/454 (51%), Gaps = 39/454 (8%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLP--------PSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           + ++AL   + S T ++ +A LP        PS   L P++ +V P++VS+ VE K+K  
Sbjct: 8   LTSIALGLSVLS-TPMISQASLPTYVEGQAVPS---LAPMLEKVLPAVVSISVEGKQKAR 63

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFI-TDDG 120
               F           H +   FR     FF G + I +D   R     GSG  I  + G
Sbjct: 64  GPSQF-----------HEIPEEFR-----FFFGPD-IFNDRAPRSFRGIGSGVIINAEKG 106

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y+LT+NH+++D     V L D  EL AK++GTD + D+A+++++  +    V+  D++ +
Sbjct: 107 YVLTNNHVIDDADKIIVQLQDGRELTAKVIGTDEMSDVALIQIEKPKNLTAVKIADSDKL 166

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNA 237
           RVG+    IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGGP  N 
Sbjct: 167 RVGDFTVAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGPLINL 226

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G +IG+N  I++    + G+   IP ++    +  ++  G V  G  GI    L  +LA
Sbjct: 227 QGELIGINTAIISPSGGNAGIAFAIPSNMANNLVQQILEFGEVRRGMLGIKGGELNADLA 286

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
               +   +G+ ++ V+  S A+KAG+K GDV+  ++G+ I S  +   +IA+    +++
Sbjct: 287 KAFDIEAQQGAFVSEVLPNSAAEKAGLKAGDVVIAMNGQKISSFAEMRAKIATSGAGKEI 346

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPN 417
            ++  ++G  H+  V L S    + D    +    L G  + + ++   K V I  + P 
Sbjct: 347 DLTYLRDGKTHNTKVTLQSDDQNQADASSLL--PALTGAEMTNYDEKGLKGVVITKVAP- 403

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
            +   E +G++K   I+ VN  +V  +  + +++
Sbjct: 404 -KSIAEQRGLKKDDIIIGVNRKQVENLGQLRKIL 436


>gi|253999493|ref|YP_003051556.1| protease Do [Methylovorus sp. SIP3-4]
 gi|253986172|gb|ACT51029.1| protease Do [Methylovorus sp. SIP3-4]
          Length = 473

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 146/498 (29%), Positives = 240/498 (48%), Gaps = 64/498 (12%)

Query: 18  TCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLP 77
           TC I  +      AK  P   D   +  +  P++V++ +    +V   Q      F  +P
Sbjct: 8   TCAILITVSGTASAKDLP---DFTELAEKQGPAVVNISIT---QVMHGQAEGTVPFPGMP 61

Query: 78  EDHPLKNYFRKDFHKFFSGE-EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           +D  L  + R+       G+         +    GSGF I++DGYILT+ H+V +     
Sbjct: 62  DDPALGEFLRRFGIPGMPGQGNGAPQQDYKSQSLGSGFIISNDGYILTNAHVVNEADEVL 121

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRL 195
           V LSD  E  AK++G+D   D+A++K+  D   +P V   D N ++VGE V  IG+PF L
Sbjct: 122 VKLSDKREFKAKIIGSDRRTDVALIKI--DATNLPKVTIGDPNQLKVGEWVAAIGSPFGL 179

Query: 196 RGTVSAGIVSALDRDIPDR---PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
             T++AGIVSA  R +P     P  F Q D  IN GNSGGP FN  G V+G+N+ I +  
Sbjct: 180 ENTMTAGIVSAKGRALPQENFVP--FIQTDVAINPGNSGGPLFNLRGEVVGINSQIYSRS 237

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              MG+   IP+ +       L + G+V  GW GI  Q +T++LA   G++ T G+L+  
Sbjct: 238 GGSMGLSFSIPIDVAIDVSNQLKANGKVTRGWLGIGIQEITKDLADSFGMKSTNGALVAG 297

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           V K +PA+K G++ GDVI   DG+ + +  D    + +  P + V + + ++GS  ++ +
Sbjct: 298 VEKGAPAEKGGLEAGDVIVKFDGKPVLTSSDLPRIVGATKPGKTVPVEVLRKGSTKTLNI 357

Query: 373 VLGSSPTAKNDM--------HLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEA 424
            +G +PT K+ +          EV     LG+VL++             L P ++R++  
Sbjct: 358 TVGEAPTEKDGVAPTPKGSAKPEV---NRLGLVLRE-------------LTPVQKRKLSG 401

Query: 425 KG---------------IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
           K                I++G  ++ +N  EV  ++   + +      K  ++L+Q    
Sbjct: 402 KNGLLVVDAQGAAAQAGIRRGDVVLGLNNTEVQSLEQFNKQLAGVASGKTVALLVQ---- 457

Query: 470 PDMQSGNDNMSRFVSLKI 487
                  D+ + +V LK+
Sbjct: 458 ------RDDNTLYVPLKL 469


>gi|90424750|ref|YP_533120.1| peptidase S1C, Do [Rhodopseudomonas palustris BisB18]
 gi|90106764|gb|ABD88801.1| Peptidase S1C, Do [Rhodopseudomonas palustris BisB18]
          Length = 497

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 131/396 (33%), Positives = 207/396 (52%), Gaps = 25/396 (6%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK- 168
            GSGF +   G  +T+NH++ D    ++I++D T++ A+LVG D   DLAVLK +   K 
Sbjct: 108 LGSGFIVDTAGIAVTNNHVIADADEINIIMNDGTKIKAELVGVDKKTDLAVLKFKPPAKP 167

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQ 227
            + V+F D++ +R+GE V  IGNPF L GTV+AGIVSA +RDI   P  ++ Q DA IN+
Sbjct: 168 LVAVKFGDSDKLRLGEWVIAIGNPFSLGGTVTAGIVSARNRDINSGPYDSYIQTDAAINR 227

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP FN  G VIGVN +I++     +G+G  +P   +   + SL   G +  GW G+
Sbjct: 228 GNSGGPLFNLDGEVIGVNTLIISPSGGSIGIGFAVPSKTVIGVVDSLRQFGELRRGWLGV 287

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T E+A  L ++  +G+LI  V  + PA  AG++ GDV+   DG+ IK  +D    
Sbjct: 288 RIQQVTDEIAESLNIKPARGALIAGVEDKGPAKPAGIEPGDVVIRFDGKDIKEPKDLSRV 347

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------KELLGMVL 398
           +A  +  + V + + ++G + +  V LG     +  +   V           ++ LG+ L
Sbjct: 348 VADTAVGKAVDVVIIRKGKEETKQVTLGRLDDGEKPVQASVKSQPEAEKPVTQKALGLDL 407

Query: 399 QDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
             ++   +   +I       +  + +   +   K +  G  IV V    V    DV++ I
Sbjct: 408 ASLSKEQRAKFKIKDSVKGVLITSVDNGSDAAEKRLSAGDVIVEVAQETVGNASDVKKRI 467

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
              K+  + SVLL +       S  D   RFV+L +
Sbjct: 468 EAIKKDGKKSVLLLV-------SNGDGELRFVALGV 496


>gi|75676531|ref|YP_318952.1| peptidase S1C, Do [Nitrobacter winogradskyi Nb-255]
 gi|74421401|gb|ABA05600.1| peptidase S1C, Do [Nitrobacter winogradskyi Nb-255]
          Length = 496

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 126/396 (31%), Positives = 206/396 (52%), Gaps = 25/396 (6%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF +   G ++T+NH++ D    +VIL+D T++ A+ VG D   DLAVLK +     
Sbjct: 107 LGSGFIVDAAGIVVTNNHVIADSDEINVILNDGTKVKAETVGVDKKTDLAVLKFKPPHPL 166

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
           + V+F D++ +R+GE V  IGNPF L G+VSAGIVSA +RDI + P  ++ Q DA IN+G
Sbjct: 167 MAVKFGDSDKLRLGEWVIAIGNPFSLGGSVSAGIVSARNRDINNGPYDSYIQTDAAINRG 226

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G V+GVN +I++     +G+G  +P   +   +  L   G +  GW G+ 
Sbjct: 227 NSGGPLFNLEGEVVGVNTLIISPSGGSIGIGFAVPSKTVAGVVDQLRKFGELRRGWLGVR 286

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +T E+A  L ++  +G+L+  V  + PA  AG++ GDV+   DG+ IK  +D    +
Sbjct: 287 IQQVTDEIADSLNIKPARGALVAGVEDKGPAKPAGIEPGDVVIAFDGKDIKEPKDLSRMV 346

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----------ELLGMVL 398
           A  +  + V + + ++G + +  V LG    +   + + +  K          + LG+ L
Sbjct: 347 ADTAVGKTVSVVVIRKGKEETKKVTLGRLDDSDKAIPVSIKTKPEDDDKPVTQKALGLDL 406

Query: 399 QDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
             ++   +   +I       +      + +   K +  G  IV V    V+   D+ + I
Sbjct: 407 ATLSKDLRARYKIKDSVKGVIITEVEADSDAAEKRLSAGDVIVEVAQEAVNSASDIRKRI 466

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            + K+  + +VLL       M S      RFV+L +
Sbjct: 467 DQLKKDGKKAVLL-------MVSNGAGELRFVALSL 495


>gi|92113752|ref|YP_573680.1| peptidase S1C, Do [Chromohalobacter salexigens DSM 3043]
 gi|91796842|gb|ABE58981.1| Peptidase S1C, Do [Chromohalobacter salexigens DSM 3043]
          Length = 478

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 142/426 (33%), Positives = 224/426 (52%), Gaps = 50/426 (11%)

Query: 90  FHKFFSGEEPIL-------SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
           F  FF  + P +         + ER   GSGF I+ DGYI+T+ H+V+      V L+D 
Sbjct: 71  FRHFFGDQMPPMIPGAPGYGGSEERHSLGSGFVISRDGYIMTNAHVVDGADEIVVRLNDR 130

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
            EL A LVG D   D+AVLKV +D   +PV E  D++ + VGE V  IG+PF    +V++
Sbjct: 131 RELEATLVGADKKTDVAVLKVDADD--LPVLEMGDSDALEVGEWVAAIGSPFGFDHSVTS 188

Query: 202 GIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           GIVSA+DR +P D    F Q D  IN GNSGGP FN  G V+G+N+ I T     MGV  
Sbjct: 189 GIVSAIDRTLPSDAYVPFIQTDVAINPGNSGGPLFNLDGEVVGINSQIYTRSGGFMGVSF 248

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            IP+++       L   G V+ GW G++ Q ++++LA   GL G +G+LI+ V  +SPA 
Sbjct: 249 AIPINVAMDIADQLKDSGHVNRGWLGVVIQPVSRDLAESFGLDGPRGALISDVTDDSPAS 308

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP-- 378
           +AG++ GDV+  ++   ++        +   +P E + +++ ++G +  + V +GS P  
Sbjct: 309 RAGLEAGDVVLSVNDDRVEDSSSLPRLVGRVAPGEDITLTVMRDGERRDLDVTVGSWPDE 368

Query: 379 ------TAKNDMHLEVGDKEL-LGMVLQDINDGNKK--------LVRIVALNPNREREVE 423
                 T+K D      D ++ LG+ + D+++  ++        LVR V    +      
Sbjct: 369 GKAVTGTSKKD------DSQVRLGIAISDLDEPMRRQLDVDSGVLVRQV----DPRGAAA 418

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD-SVLLQIKYDPDMQSGNDNMSRF 482
           A G+ +G  IVS N  +   I+D + L+   K+   D +V ++I          D  S F
Sbjct: 419 AAGLSRGDVIVSFNGQD---IEDTDALMEAVKDAPTDRAVPVRIV--------RDGQSLF 467

Query: 483 VSLKID 488
           V+L+++
Sbjct: 468 VALRLE 473


>gi|148549497|ref|YP_001269599.1| protease Do [Pseudomonas putida F1]
 gi|148513555|gb|ABQ80415.1| protease Do [Pseudomonas putida F1]
          Length = 477

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 141/456 (30%), Positives = 230/456 (50%), Gaps = 33/456 (7%)

Query: 11  SICTVALTCVIFSSTYL---VLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKKKVSV 64
           SI  +    ++F++  +   VL A+   +  D   ++ + SP++V++  +   P ++++ 
Sbjct: 2   SIPRLKSYLMMFAAVLMLGQVLTAQAEEALPDFTTLVEQASPAVVNISTKQKLPDRRIAA 61

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE--EPILSDTVERLMFGSGFFITDDGYI 122
            QM         P+   L   FR+ F +    +   P      E    GSGF I+ DGY+
Sbjct: 62  GQM---------PDLEGLPPMFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYV 112

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIR 181
           LT+NH+V D     V LSD +EL AKLVGTD   D+A+LKV  D K +P V+  D+  ++
Sbjct: 113 LTNNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKV--DGKNLPTVKLGDSEKLK 170

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGH 240
           VGE V  IG+PF    +V+ GIVSA  R +P D    F Q D  IN GNSGGP FN  G 
Sbjct: 171 VGEWVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGE 230

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           V+G+N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   
Sbjct: 231 VVGINSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESF 290

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL    G+L+  V++  PA K G++VGDVI  ++G+ I    D    +      E+ K+ 
Sbjct: 291 GLDKPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGEKAKLE 350

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-------ELLGMVLQDINDGNKKLVRI-- 411
           + + G + ++ + +G+ P   +D+ +  G +         LG+ + D+    KK + +  
Sbjct: 351 IIRNGKRQNLDISVGALP--DDDVEIGAGTEGGAERSSNRLGVSVADLTAEQKKSLELKG 408

Query: 412 -VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
            V +   ++      G++ G  I  +N   +   K+
Sbjct: 409 GVVIKEVQDGPAAMIGLRPGDVISHLNNQAIGSAKE 444



 Score = 37.0 bits (84), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+   +LT E    L L   KG ++   V++ PA   G++ GDVI  L+ + I S ++F
Sbjct: 389 LGVSVADLTAEQKKSLEL---KGGVVIKEVQDGPAAMIGLRPGDVISHLNNQAIGSAKEF 445

Query: 345 VWQIASRSPKEQ-VKISLCKEG 365
             +IA   PK + V + + ++G
Sbjct: 446 T-EIAKELPKNRSVSMRVLRQG 466


>gi|254486877|ref|ZP_05100082.1| protease Do [Roseobacter sp. GAI101]
 gi|214043746|gb|EEB84384.1| protease Do [Roseobacter sp. GAI101]
          Length = 494

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 146/500 (29%), Positives = 241/500 (48%), Gaps = 47/500 (9%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIV----SVMVEPKKKVSVEQM 67
           +  + L  V F     V+    P S   L P+  ++SPS+V    S MVE +        
Sbjct: 20  LLMMGLLAVAFVMLQAVMSYAKPES---LAPLAEQISPSVVNITTSTMVEGRTGPR---- 72

Query: 68  FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNH 127
                 G +PE  P +++F +   +  +GE P    +      GSGF I++DGY++T+NH
Sbjct: 73  ------GIVPEGSPFEDFFEEFRDRNNNGEAPAPRKSS---ALGSGFVISEDGYVVTNNH 123

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
           +++     ++      EL A ++GTDA  D+A+LKV++      V F D+N  RVG+ V 
Sbjct: 124 VIDGADEITIEFFSGEELKATVIGTDANTDIALLKVEASNPLPFVSFGDSNAARVGDWVI 183

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
            +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  
Sbjct: 184 AMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGAVIGVNTA 243

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I++     +G+G  +  +++ + +  L   G    GW G+  Q++TQ++A  +GL    G
Sbjct: 244 ILSPNGGSIGIGFSMASNVVTRVVDQLKEFGETRRGWLGVRIQDVTQDVADAMGLAKATG 303

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+T  V E PA +AG+  GD+I    G  ++  +  V Q+ + +    V++++ ++G  
Sbjct: 304 ALVTD-VPEGPAKEAGLLTGDIIMSFAGVDVEDTRGLVRQVGNSAVGAAVRVTILRDGKT 362

Query: 368 HSVAVVLGSSPTAKNDMHLEV-----------GDKELLGMVLQDIND------GNKKLVR 410
            ++ V LG    A+     E                +LG+ L  + D      G      
Sbjct: 363 QTLKVTLGRREDAEAPAPTEEEPAEEGTTEGPATDSMLGLTLTPLTDDLRAELGADASTS 422

Query: 411 IVALNPNRE-REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +A+    E  E   KG++ G  I       +    D+E  +  A++  R S+LL ++  
Sbjct: 423 GLAVTAVDELSEAFEKGLRVGDIITEAGQQSIMTFADLEDSVTLARDAGRKSLLLLVRRA 482

Query: 470 PDMQSGNDNMSRFVSLKIDK 489
            D         RFV+L +++
Sbjct: 483 GD--------PRFVALGLEE 494


>gi|157363262|ref|YP_001470029.1| protease Do [Thermotoga lettingae TMO]
 gi|157313866|gb|ABV32965.1| protease Do [Thermotoga lettingae TMO]
          Length = 456

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 129/387 (33%), Positives = 211/387 (54%), Gaps = 15/387 (3%)

Query: 81  PLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
           P  + F ++F K + G  P    T E    GSGF    +G ILT+ H+V+     ++ L 
Sbjct: 52  PYFDPFMEEFFKRWFGYNP-FGGTQESTSLGSGFIFDKEGLILTNEHVVDGSKDITITLL 110

Query: 141 DDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVS 200
           D T   A+ VG D   D+AVLK++ DR    +EF D++++++GE    IGNP   + TV+
Sbjct: 111 DGTTYKAEYVGGDEELDIAVLKIKPDRDLPVLEFGDSDSLKIGEWTIAIGNPLGFQHTVT 170

Query: 201 AGIVSALDRDI--PDRPGTFT---QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
            G+VSA  R I  PD  G +T   Q DA IN GNSGGP  N  G VIG+N  I+   +  
Sbjct: 171 IGVVSATGRRIPKPDGSGYYTNLIQTDAAINPGNSGGPLLNIHGQVIGINTAIINPTE-A 229

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           + +G  IP++ +K+ I  L+  G+    + G+    +T+ LA  +GL+  +G L+  V++
Sbjct: 230 VNLGFAIPINTVKRFISQLVETGKTQKAYLGVRVMTVTENLAKAMGLKVNQGVLVVQVLE 289

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
            SPA+++G+K  DVI   D   + +  + V  I S  P + VK+ + + G + ++ V LG
Sbjct: 290 NSPAERSGLKENDVIVKFDNVSVSTDAELVSLIHSHIPGDTVKLLVNRSGKEINLTVTLG 349

Query: 376 SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVA-LNPNREREVE-AKGIQKGMTI 433
           SS  A+  +      +E LG+V+ +I D +++   + A L+    R+V+ +  IQKG  I
Sbjct: 350 SS--AEEGVETAQAAQEFLGIVVDEITDSDRESYSLPASLDGVIVRQVKNSAQIQKGDVI 407

Query: 434 --VSVN--THEVSCIKDVERLIGKAKE 456
             ++VN   + +  + D   ++ K K+
Sbjct: 408 YQIAVNGKNNTIKSVNDWNNIVSKIKQ 434


>gi|85714706|ref|ZP_01045693.1| peptidase S1C, Do [Nitrobacter sp. Nb-311A]
 gi|85698591|gb|EAQ36461.1| peptidase S1C, Do [Nitrobacter sp. Nb-311A]
          Length = 496

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 148/491 (30%), Positives = 243/491 (49%), Gaps = 31/491 (6%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE--PKKKVSVEQMFNAYGFG 74
           LT +  S    ++ A   P+    P  IA V+  ++  +V     +KV V+         
Sbjct: 16  LTALCLSIASAMISA---PALARGPDGIADVAEKVIDAVVNISTTQKVDVKNGEGRRLIP 72

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            LP   P + +F   F     G+   L  T +    GSGF +   G ++T+NH++ D   
Sbjct: 73  QLPPGSPFEEFFDDFFKNRRGGKNGGLQ-THKTNSLGSGFIVDAAGIVVTNNHVIADSDE 131

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
            +VIL+D T++ A+ +G D   DLAVLK +       V+F D++ +R+GE V  IGNPF 
Sbjct: 132 INVILNDGTKVKAETIGVDKKTDLAVLKFKPPHPLTAVKFGDSDKLRLGEWVIAIGNPFS 191

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           L G+V+AGIVSA +RDI + P  ++ Q DA IN+GNSGGP FN  G ++GVN +I++   
Sbjct: 192 LGGSVTAGIVSARNRDINNGPYDSYIQTDASINRGNSGGPLFNLEGEIVGVNTLIISPSG 251

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +G+G  +P   +   +  L   G +  GW G+  Q +T E+A  L ++  +G+L+  V
Sbjct: 252 GSIGIGFAVPSKTVAGVVDQLRQFGELRRGWLGVRIQQVTDEIADSLNIKPARGALVAGV 311

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             + PA  AG++ GDVI   DG+ IK  +D    +A  +  + VK+ + ++G + +  V 
Sbjct: 312 EDKGPAKPAGIEPGDVIIAFDGKDIKEPKDLSRIVADTAVGKTVKVVIIRKGKEDTKKVT 371

Query: 374 LGSSPTAKNDMHLEV----GD------KELLGMVLQDINDGNKKLVRI-------VALNP 416
           LG    +   + + V    GD      ++ LG+ L  ++   +   +I       +  + 
Sbjct: 372 LGRLDDSDKPLPVSVKTKPGDDDKPVTQKALGLDLAALSKDLRARYKIKDSVKGVIITDV 431

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
             + +   K +  G  IV V    V    D+ + I + K+  + +VLL       M S  
Sbjct: 432 EADSDAAEKRLSAGDVIVEVAQEAVGSASDIRKRIDQLKKDGKKAVLL-------MVSNG 484

Query: 477 DNMSRFVSLKI 487
               RFV+L +
Sbjct: 485 AGELRFVALSL 495


>gi|94500828|ref|ZP_01307357.1| alginate biosynthesis negative regulator, serine protease AlgY
           [Oceanobacter sp. RED65]
 gi|94427150|gb|EAT12131.1| alginate biosynthesis negative regulator, serine protease AlgY
           [Oceanobacter sp. RED65]
          Length = 462

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 130/405 (32%), Positives = 204/405 (50%), Gaps = 35/405 (8%)

Query: 31  AKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDF 90
           +KLP    D   ++   SP++V++        + ++  N Y   +LP+  P       D 
Sbjct: 18  SKLP----DFTELVQESSPAVVNIS-------TTQKASNRYHQFDLPQGVP-------DI 59

Query: 91  HKFFSG-------EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT 143
            + F G         P      ER   GSGF +++DGY+LT+NH+++      V L+D  
Sbjct: 60  FRHFFGVPPQAPRGNPAPRSQQERSSLGSGFIVSEDGYVLTNNHVIDGADQIFVRLNDRR 119

Query: 144 ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
           EL AKL+G+D   DLA+LKV +D     VE  D+ N++VGE V  IG+PF    +V+AGI
Sbjct: 120 ELEAKLIGSDPSSDLALLKVDAD-NLPTVEIGDSENLKVGEWVVAIGSPFGFDYSVTAGI 178

Query: 204 VSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           VSA  R +P+     F Q D  IN GNSGGP FN  G V+G+N+ I T     MG+   I
Sbjct: 179 VSAKGRSLPNENYVPFIQTDVAINPGNSGGPLFNLDGEVVGINSQIYTRSGGFMGLSFAI 238

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P+++  + +  L   G V  GW G+  Q + +ELA   GL    G+L++ VV+  PAD A
Sbjct: 239 PMNVAMEVVDQLKETGTVTRGWLGVAIQEVDKELAESFGLDKAAGALVSQVVENGPADAA 298

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN 382
           G+K GD+I   +G+ +    D    +    P  + K+ + + G   ++ V +G+ P    
Sbjct: 299 GVKYGDIITEFNGKKVTLSSDLPHLVGRVRPGTKAKLRIIRHGKAKTLNVEIGALPNG-- 356

Query: 383 DMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGI 427
                 GD       +   +  N+  + +V L   + ++ +A G+
Sbjct: 357 ------GDVIASNSNMPQQSKSNRLGIEVVELTQEQRKKWDATGV 395


>gi|269104102|ref|ZP_06156799.1| outer membrane stress sensor protease DegQ [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268164000|gb|EEZ42496.1| outer membrane stress sensor protease DegQ [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 413

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 137/433 (31%), Positives = 233/433 (53%), Gaps = 39/433 (9%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ +V+P++VS+ VE  K VS +++  AY F           +F  DF      E+P   
Sbjct: 1   MLEQVTPAVVSIAVE-GKHVSKQRLPEAYRF-----------FFGPDFPTEQVREQPFRG 48

Query: 103 DTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
                   GSG  I    GY++T+NH+V+   +  V LSD  E+ AKL+GTD + D+A+L
Sbjct: 49  -------LGSGVIIDAKKGYVVTNNHVVDGADTIKVQLSDGREVKAKLLGTDKMSDIALL 101

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR---DIPDRPGTF 218
           +++  +    ++  D++N+RVG+    IGNPF L  TV++GIVSAL R   +I +    F
Sbjct: 102 QLEDAKDLTAIKLADSDNLRVGDFAVAIGNPFGLGQTVTSGIVSALGRSGLNIENFE-NF 160

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            Q DAPIN GNSGG   N  G +IG+N  I+     ++G+G  IP +++K     LI  G
Sbjct: 161 IQTDAPINSGNSGGALVNLNGELIGINTAILGPNGGNVGIGFAIPANMVKNLTDQLIEFG 220

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
           +V  G  G+    LT ELA   G +   G+ ++ V+ E  A KAG+K GD+I  ++ + I
Sbjct: 221 QVKRGVLGVTGGELTSELAETFGYKTNHGAFVSQVLPEGSAAKAGLKAGDIIVSVNNKPI 280

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK---NDMHLEVGDKELLG 395
           ++  +   +IA+    ++V + L ++G + +V V L ++   +   +D+H  +   E   
Sbjct: 281 RTFSELRAKIATLGAGKKVTLGLIRDGKELNVPVTLEAAKQTQVKADDLHESLAGAEFAN 340

Query: 396 MVLQDINDGNKKLVRIVALNPNREREVEAK-GIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
              +D   G    V++  LN   ++ + A+ G++KG  I+ +N   +  + ++     KA
Sbjct: 341 TSPEDKVHG----VKVTELN---KQSIAARYGLKKGDIIIGLNRQPIKNLGELR----KA 389

Query: 455 KEKKRDSVLLQIK 467
            EKK + + +++K
Sbjct: 390 LEKKPNVLAMEVK 402


>gi|322418239|ref|YP_004197462.1| protease Do [Geobacter sp. M18]
 gi|320124626|gb|ADW12186.1| protease Do [Geobacter sp. M18]
          Length = 477

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 142/453 (31%), Positives = 229/453 (50%), Gaps = 42/453 (9%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS--GEEPI 100
           ++  V+PS+V++    KKK+ V   F    F                F  FF   G    
Sbjct: 58  LVKSVTPSVVNISTVGKKKL-VRPFFEGSPF----------------FDDFFGDRGRPQY 100

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
             +T      GSGF +  +GYI+T++H+V D  +  V LS+++    K++G+D   D+AV
Sbjct: 101 RRET----SLGSGFILNPEGYIVTNDHVVRDAETIQVKLSNESVYTGKVIGSDPKTDIAV 156

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTF 218
           +K+ +          D+  ++VG+    IGNPF L  TV+ G+VSA  R     +    F
Sbjct: 157 IKINAKEPLPAAVLGDSTKLQVGQWAIAIGNPFGLDRTVTVGVVSATGRSNMGIETYEDF 216

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            Q DA IN GNSGGP  N  G VIG+N  IV +GQ   G+G  IP+++ K+ +  LISKG
Sbjct: 217 IQTDASINPGNSGGPLLNIYGEVIGINTAIVAAGQ---GIGFAIPVNMAKQVVTQLISKG 273

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
            V  GW G+  Q++T+E+A   GL    G+L+  VV   PA KAG+  GD+I   +G  +
Sbjct: 274 NVTRGWLGVSIQSVTEEMAKSFGLPKASGALVNDVVPGGPAAKAGIMQGDIITGFNGANV 333

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE--LLGM 396
           K  +     +   +  ++V++ L ++G K  V V    + +A+    ++  ++E  LLG+
Sbjct: 334 KDVRQLQRLVGETAIGKKVEVELYRDGKKLKVYVTTAPAESAQAQSQMQRPEREAGLLGL 393

Query: 397 VLQDINDGNKK--LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
            ++++    ++  +  +V  +       E  GIQ+G  IVSVN  +V  + + +R +  A
Sbjct: 394 SVEELGPEMRRSGMAGVVVSDLEPGGIAEQSGIQRGDIIVSVNQKKVRNLAEYQRAMKDA 453

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
               R +V L IK          N S + +LK+
Sbjct: 454 --ANRGAVALLIK--------RGNASIYFALKL 476


>gi|89055661|ref|YP_511112.1| peptidase S1C, Do [Jannaschia sp. CCS1]
 gi|88865210|gb|ABD56087.1| Peptidase S1C Do [Jannaschia sp. CCS1]
          Length = 515

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 140/434 (32%), Positives = 219/434 (50%), Gaps = 42/434 (9%)

Query: 76  LPEDHPLKNYFRKDFHKFF------SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
           +PE  PL+++F    ++F       +G  P  S        GSGF I++DGY++T+NH++
Sbjct: 100 VPEGSPLEDFF----NEFLGPDGGDNGPSPRRSQA-----LGSGFVISEDGYLVTNNHVI 150

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           E      +   +  EL A+L+GTD   D+A+L+VQSD     V F  A++ RVG+ V  +
Sbjct: 151 EGADEIMIEFRNGVELVAELIGTDPNTDIALLRVQSDEPLPYVPFGVASDHRVGDWVMVM 210

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           GNP     +VS G+VSA  R +      F Q DA INQGNSGGP FN  G VIGVN  I+
Sbjct: 211 GNPLGQGFSVSVGVVSAFGRSLSGTYDDFIQTDAAINQGNSGGPLFNLEGEVIGVNTAIL 270

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +     +G+G  +   ++   +  L   G    GW G+  Q++T E+A  LGL   +G++
Sbjct: 271 SPTGGSIGIGFAMSSDVVINVVDQLREFGETRRGWLGVRIQDVTTEMADALGLDEARGAM 330

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +T  V E PA + G++VGDVI   DG  ++  +  V  +   +  E V++ + ++G+  +
Sbjct: 331 VTD-VPEGPALEGGIEVGDVILTFDGADVEDTRGLVRVVGDSTVGETVRVVVFRDGATET 389

Query: 370 VAVVLGSSPTAKNDMHLEVGDKE-------LLGMVLQDIND---------GNKKLVRIVA 413
           + + LG   TA++    E  +         +LGM L  + D         G    + I  
Sbjct: 390 LRITLGRRETAESAAAPETPEGAEAAPSSIVLGMTLTPLTDELRGELNARGVTNGLVITE 449

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           ++P         G+Q G  I  V    V+ I D +  I  A E  ++++LL I+ D    
Sbjct: 450 IDP--VSAAAEMGLQVGDIITEVTQMPVTTIADFQLRIDAADEAGQETILLLIRRD---- 503

Query: 474 SGNDNMSRFVSLKI 487
            GN    RF++L I
Sbjct: 504 -GN---PRFMALGI 513


>gi|182413544|ref|YP_001818610.1| protease Do [Opitutus terrae PB90-1]
 gi|177840758|gb|ACB75010.1| protease Do [Opitutus terrae PB90-1]
          Length = 513

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 139/453 (30%), Positives = 220/453 (48%), Gaps = 44/453 (9%)

Query: 35  PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ----MFNAYGFGNLPEDHPLKNYFRKDF 90
           P      P++ RV+PS+V V+V  + K    Q     FN  GF         + +F   F
Sbjct: 51  PLGASYAPIVKRVAPSVVKVLVTERAKAIPAQELPPFFNHPGF---------REFFGDQF 101

Query: 91  HKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLV 150
              F G    L    +  + GSG  ++ DGYILT++H+V+   +  V   D  EL AK+V
Sbjct: 102 GHNFGGRRGTLRQPPQEGL-GSGVIVSPDGYILTNSHVVKGADTIKVTFGDGRELTAKVV 160

Query: 151 GTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR- 209
           GTD   DLAV+KV++ +    + F D++++ VG+ V  +GNPF +  TV++G+VS L R 
Sbjct: 161 GTDPQTDLAVIKVEA-KDLPAITFADSDSVEVGDRVLAVGNPFGIGQTVTSGMVSGLGRA 219

Query: 210 ----DIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLS 265
               D  D    F Q DA IN GNSGG   +A G +IGVN  I++      G+G  IP +
Sbjct: 220 MFGLDYED----FIQTDAAINPGNSGGALVDAEGRLIGVNTAILSRSGGFQGIGFAIPSN 275

Query: 266 IIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMK 325
           + +  +  L S G+V  G+ G+  Q++T ELA    L    G+L+  V  +SPA KAG+K
Sbjct: 276 LARNVMEQLASTGKVVRGYLGVTIQDITAELAEHFDLPNRAGALVAEVQPDSPAAKAGLK 335

Query: 326 VGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH 385
            GDV+  +DG+ IK  ++    + S  P E+V   + ++G   ++ + + + P  ++   
Sbjct: 336 GGDVVTKIDGKAIKDARNLKLIVGSLKPGEKVTAEVLRDGKTQTMELSVTARPNERSLSR 395

Query: 386 LEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVE--------------------AK 425
              G  +   +     + G    V +  L+ +  RE +                      
Sbjct: 396 SGGGSGDDDDLSGSAEDTGTLNGVGVGDLDADARREFDIPANVRGALITSVEPDSAAAEA 455

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           G+Q G  I+ +N   V   +D  +L  K + KK
Sbjct: 456 GLQAGNVILEINRKPVKNAEDAVKLTEKTESKK 488


>gi|307295399|ref|ZP_07575238.1| protease Do [Sphingobium chlorophenolicum L-1]
 gi|306878902|gb|EFN10121.1| protease Do [Sphingobium chlorophenolicum L-1]
          Length = 530

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 140/459 (30%), Positives = 226/459 (49%), Gaps = 53/459 (11%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           L  ++ ++ P++V++    K++V V+  F    FG+L             F +   G +P
Sbjct: 76  LADMVEKLQPAVVNIST--KQRVQVQNPFAGTPFGDL-------------FGQ--QGGKP 118

Query: 100 ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA------SFSVILSDDTELPAKLVGTD 153
               T +    GSGF I+ DGYI+T+NH+V  GA      S +V L++  E PA+L+G D
Sbjct: 119 ---QTRQAQSLGSGFIISADGYIVTNNHVVSAGAEGASVDSITVTLTNSEEYPARLIGRD 175

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              D+AVLK++  +    V+F D+   RVG+ V  IGNPF L GTV+AGI+SA+ R    
Sbjct: 176 PATDIAVLKIEPKKALPFVKFGDSTKARVGDWVIAIGNPFALSGTVTAGIISAVHRGTGG 235

Query: 214 RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
               F Q DA INQGNSGGP F+  G+VIG+N+ I++    ++G+G  IP       + +
Sbjct: 236 TYDKFIQTDASINQGNSGGPMFDMRGNVIGINSQILSPSGGNVGIGFAIPSEQAAPIVNT 295

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           L +   V  G+ GI    L ++LA  LGL   +G  +  V     ADKAG+K GDVI  +
Sbjct: 296 LRTGRTVKRGYLGIQISPLGEDLADSLGLAKNRGEFVQGVEPGKGADKAGIKAGDVIVSV 355

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL 393
            G+ +   Q+    +A++    +V I L + G + +V  V+G  P+            + 
Sbjct: 356 AGQEVTPDQNLSSIVANQPIGGRVPIVLLRNGQRQTVTAVVGERPSEDELNAFAQQQDDD 415

Query: 394 LGMVLQDINDG---------------NKKLVRIVALNPNRER-----------EVEAKGI 427
            G      + G               N  ++R + + P   R           +  AKG+
Sbjct: 416 FGQQQDGQSSGGQAAQQSLGISAIPLNSTIIRQLGI-PTDTRGIVITAVDGSTDAGAKGL 474

Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           ++G  I++ N   V+   +++  +     + R ++LLQ+
Sbjct: 475 RRGDVIITANNRPVASQAELDAQVKAVSSQGRSAILLQV 513


>gi|330812980|ref|YP_004357219.1| HtrA protease/chaperone protein [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486075|gb|AEA80480.1| HtrA protease/chaperone protein [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 489

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 143/418 (34%), Positives = 217/418 (51%), Gaps = 26/418 (6%)

Query: 88  KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
           +DF K ++ E+       +    GSGF I++DG ++T+NH+++      V  ++  E  A
Sbjct: 79  EDFFKEYN-EQQKTPQKRKSTALGSGFVISEDGIVITNNHVIQGSEGIIVRFTNKKEYNA 137

Query: 148 KLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSAL 207
           KL+GTD + D+AVL++QS  KF PV   D++  RVG+ V  IGNPF L GTV+AGI+SA+
Sbjct: 138 KLIGTDPVSDIAVLQIQSKEKFKPVTLADSSKARVGDWVLAIGNPFGLGGTVTAGIISAI 197

Query: 208 DRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
           +RDI   R   F Q DA INQGNSGGP FN  G V+G+N  I ++    +G+G  IP S 
Sbjct: 198 NRDINIGRYDNFIQTDASINQGNSGGPLFNMDGKVVGINTAIFSNSGGSVGIGFAIPSSF 257

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
            K  +  L   G    GW G+  Q +T+E+A  LG++   G+L+  V ++ PA K+G++ 
Sbjct: 258 AKNVVKQLREYGETRRGWLGVRIQEVTKEIADSLGMKEAIGALVADVNEKGPAKKSGIQN 317

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL 386
           GDVI   +G  I S +     +      +   + + +     +  +VLG    A+     
Sbjct: 318 GDVIIEFNGIKIDSMRVLPKVVGEAPVGKTATLKIWRNKKILTKKIVLGRLEDAEQFKKK 377

Query: 387 EVGDK----------ELLGMVLQDINDGN---KKLVR----IVALNPNREREVEAKGIQK 429
               K          + LG+ ++D+   +   +KL      +V L    E  +    IQ 
Sbjct: 378 SKPKKKENKEENTLLKALGIKVRDVTSKDVTSRKLTTGINGVVILEIKTEGALSDSPIQV 437

Query: 430 GMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           G  I+ +   +V  + D+E  + K K+ K  SVLL I    D Q    N SRFV +KI
Sbjct: 438 GNIIIGLQNEKVKNVSDLESKLKKLKKSKNISVLLTI---IDSQ----NRSRFVGVKI 488


>gi|311693670|gb|ADP96543.1| serine protease MucD precursor [marine bacterium HP15]
          Length = 474

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 139/430 (32%), Positives = 208/430 (48%), Gaps = 32/430 (7%)

Query: 52  VSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS----DTVER 107
           +S   EP ++ S        G   +P D        + F  FF G +        ++  R
Sbjct: 43  ISTTTEPTRRNS--------GAPGMPFDERQLEQLPEFFQDFFRGPQSPFGGGPGNSQPR 94

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSGF ++ DGY+LT+NH+VE      V L+D  ELPA LVGTD   D+AVLK+++  
Sbjct: 95  RSMGSGFIVSSDGYVLTNNHVVEGADEIIVRLNDRRELPATLVGTDPRSDMAVLKIENGD 154

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPIN 226
               V+   + +++VGE VF IG+PF    TV+AGIVSAL R +P      F Q D  IN
Sbjct: 155 DLPVVQVGRSRDLKVGEWVFAIGSPFGFDYTVTAGIVSALGRSLPSENYVPFIQTDVAIN 214

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP FN  G V+G+N+ I T     MGV   IP+         L   G V  GW G
Sbjct: 215 PGNSGGPLFNLEGEVVGINSQIYTRSGGFMGVSFAIPIDDAMNVFRQLRDNGSVSRGWLG 274

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           ++ Q + ++LA   GL+  +G+LI  V+  SPA  AG++ GD++   DG  ++   D   
Sbjct: 275 VLIQEVNRDLAESFGLKRPRGALIAEVMSGSPAQAAGLQAGDIVLSYDGDEVQLSSDLPP 334

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLG----------SSPTAKNDMHLEVGDKELLGM 396
            +      E  ++ + + G +  + V +G          S+P + +D          LGM
Sbjct: 335 MVGRTPVGETAELRVLRGGEEIELQVEIGRLPEEGSQQASAPASDSDGP----GSAPLGM 390

Query: 397 VLQ----DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
           +++    D+ D       +V  N  R    EA GI+ G  I  +N  +V+ +++    + 
Sbjct: 391 MVEPLPTDMADSMGIEGGVVVNNVARGAASEA-GIRAGDVITEMNRQKVTSVQEFREAVQ 449

Query: 453 KAKEKKRDSV 462
              E K  SV
Sbjct: 450 SLPEGKAVSV 459


>gi|283853053|ref|ZP_06370309.1| protease Do [Desulfovibrio sp. FW1012B]
 gi|283571520|gb|EFC19524.1| protease Do [Desulfovibrio sp. FW1012B]
          Length = 486

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 145/488 (29%), Positives = 247/488 (50%), Gaps = 45/488 (9%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEP--KKKVSV 64
           ++ + +  ++ T ++ + T L   A++P    D+  ++ +  P++V++      K + ++
Sbjct: 1   MAKRFLIPLSATLMLLAWTGLAA-ARIPLP--DITELVDKDGPAVVNISTTKTIKAQENM 57

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
             +F  +         P+ ++F + F KFF  +        +R M GSGF I+ DGYI+T
Sbjct: 58  RDLFEQF----HKRGGPMDDFFDQ-FEKFFGPQGRGGKPHKQRSM-GSGFVISADGYIVT 111

Query: 125 SNHIVEDGASFSVILSDDTE-LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           +NH++++     V   ++ + L AK+VG D   DLA+LK++       +EF D++ ++VG
Sbjct: 112 NNHVIDNADEVKVQFRNNEKPLSAKIVGRDQETDLALLKIEGRTNLPFLEFGDSSKVKVG 171

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVI 242
             V  IGNPF L  TV+ GIVSA  R I   P   F Q DA IN GNSGGP  +  G V+
Sbjct: 172 AWVLAIGNPFGLENTVTLGIVSAKGRIIGAGPFDNFIQTDASINPGNSGGPLIDLDGKVV 231

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N  IV SGQ   G+G  IP  + +  I  L     V  GW G+  Q++    A  LG+
Sbjct: 232 GINTAIVASGQ---GIGFAIPSDMARDVIAQLREGKSVRRGWIGVTIQDIDDNTAKALGM 288

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
             TKG+L+T+V++  PA KAG+K GDVI  + G  +      + ++A+  P E  +++L 
Sbjct: 289 ENTKGALVTSVLEGQPAAKAGVKTGDVITSVSGEKVDDSNQLLRRVATLKPGESAEMTLL 348

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVGDKE------------LLGMVLQDINDGNKKLVR 410
           ++G   +V+V LG     K       GD+             ++G+ ++ +     K   
Sbjct: 349 RKGQPMTVSVTLGERDAKKLAQQGAPGDENGEDDAAPDKAATVIGLAVRSVTAKEAK--- 405

Query: 411 IVALNPNRER-----------EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
             AL  ++ R           E E   ++ G  ++ VN   V+   + ++++ +   K++
Sbjct: 406 --ALGMDKARGVLITEVGDGTEAEQSDVRPGDVVLEVNQRAVNTPDEFKKVVAE-DGKQK 462

Query: 460 DSVLLQIK 467
             V+LQIK
Sbjct: 463 GVVMLQIK 470


>gi|291613745|ref|YP_003523902.1| protease Do [Sideroxydans lithotrophicus ES-1]
 gi|291583857|gb|ADE11515.1| protease Do [Sideroxydans lithotrophicus ES-1]
          Length = 465

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 133/407 (32%), Positives = 213/407 (52%), Gaps = 23/407 (5%)

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
           G  +LPE+ P        F++FF    P      E    GSGF I+ DGYILT+ H+++ 
Sbjct: 54  GIPSLPENDP--------FNEFFHHFAPQAPSEQESQSLGSGFIISSDGYILTNAHVIDH 105

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIG 190
               +V L+D  EL A+++G D   D+A+LK+  D   +P V     + ++VGE V  IG
Sbjct: 106 ADKITVRLTDKRELKARVIGADKRTDVALLKI--DATGLPKVTLGSPDQLKVGEWVVAIG 163

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           +PF    +V+AGIVSA  R +P      F Q D PIN GNSGGP FN  G V+G+N+ I 
Sbjct: 164 SPFGFDSSVTAGIVSAKGRSLPQENYVPFIQTDVPINPGNSGGPLFNMKGEVVGINSQIY 223

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +    +MG+   IP+ +    +  L S G+V  G  G+  Q +T+ELA   GL    G+L
Sbjct: 224 SRSGGYMGLSFSIPIDVAMDVVNQLRSTGKVTRGRIGVTIQEVTRELADSFGLTKAGGAL 283

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           I++V K SPA+KAG++  DVI   D +++ S       +A+  P  +VK+ L ++GS   
Sbjct: 284 ISSVDKGSPAEKAGIRASDVILKFDDKVVTSSAYLPRIVAATKPGSKVKVQLWRKGSTLD 343

Query: 370 VAVVL------GSSPTAKNDMHLEVGDKE---LLGMVLQDINDGNKKLVRIVALNPNRER 420
           V++V+      G++     +     G  E    LG+V+ ++ND  K  +++       E 
Sbjct: 344 VSLVVGEMRDEGAAVQRGGNRGSAEGSSESEARLGLVVSELNDQQKAELQVAGGLIVEEL 403

Query: 421 EVEA--KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
           +  A    +Q+G  I++V   E+  +     ++ K    +  ++L++
Sbjct: 404 KGPAARSQLQRGDVILAVGNIEIHSVDQFNEVLKKVPHGRNIALLVR 450


>gi|197103242|ref|YP_002128620.1| htrA-like serine protease [Phenylobacterium zucineum HLK1]
 gi|196480518|gb|ACG80045.1| htrA-like serine protease [Phenylobacterium zucineum HLK1]
          Length = 374

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 185/339 (54%), Gaps = 29/339 (8%)

Query: 42  PVIARVSPSIVSVMVE--PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP 99
           PVI RV+P++VS+  E  P   + V           LP D P                +P
Sbjct: 53  PVIERVAPAVVSIYAEGAPTPAMLV-----------LP-DLPFL--------------QP 86

Query: 100 ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
            L     R+  GSGFFI+ DGY+LT++H+VE      V+L ++  L A+L+G+D   DLA
Sbjct: 87  ELVPPTRRMSSGSGFFISADGYVLTNHHVVEGAERVEVVLHNERRLRARLIGSDPATDLA 146

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT 219
           VLKV   R F  V+ + A + +VG+ V  IGNPF L  T +AGIVSA  RD+      + 
Sbjct: 147 VLKVSGGR-FNYVDLKRAGSPKVGDWVIAIGNPFGLGATATAGIVSAYGRDLGSAFVDYV 205

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           QIDAPIN+GNSGGP F+A G ++GVN  I++    ++G+G  IP    +     LI++  
Sbjct: 206 QIDAPINRGNSGGPSFDAEGRLVGVNTAILSPSGGNVGIGFAIPAETARSVAERLIARRP 265

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           ++ G+ G   Q+++ + A  LGL   KG+L+ +V    PA  AG+K GD I  +DGR  +
Sbjct: 266 IERGYMGAALQDISPDAAAALGLAEPKGALVASVTPGGPAAVAGLKPGDAILKVDGRDAE 325

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
             +     +  + P +++ + L + G + S+ V L + P
Sbjct: 326 DAETVTRAVTRKRPGDRITLELFRRGQRLSLDVTLVARP 364


>gi|218513161|ref|ZP_03510001.1| serine protease Do protein [Rhizobium etli 8C-3]
          Length = 265

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 153/256 (59%), Gaps = 2/256 (0%)

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNP 192
           +F  +++D TEL AKL+G D   DLAVLKV    +KF  V + D NN+RVG+ V  +GNP
Sbjct: 2   AFVAVMNDGTELDAKLIGKDPRTDLAVLKVDGKGKKFTYVNWADDNNVRVGDWVVAVGNP 61

Query: 193 FRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L GTV+AGIVSA  RDI   P   + Q+DA +N+GNSGGP FN  G V+G+N  I + 
Sbjct: 62  FGLGGTVTAGIVSARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSP 121

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+   IP S  K  +  L+  G+V  GW G+  Q +T+++A  +GL    G+L+ 
Sbjct: 122 SGGSVGIAFAIPASTAKDVVADLMKDGQVSRGWLGVQIQPVTKDIAESIGLSEPSGALVV 181

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
           A    SP DKAGMK GDV+  L+G  IK  +D   +I +  P  + ++S+ + G   S+ 
Sbjct: 182 APQAGSPGDKAGMKAGDVVTALNGETIKDARDLSRRIGAMQPGSKAELSVWRAGKAQSLT 241

Query: 372 VVLGSSPTAKNDMHLE 387
           V LG+ P  + + + +
Sbjct: 242 VELGTLPADQKEANAD 257


>gi|77165920|ref|YP_344445.1| peptidase S1C, Do [Nitrosococcus oceani ATCC 19707]
 gi|254433307|ref|ZP_05046815.1| protease Do subfamily [Nitrosococcus oceani AFC27]
 gi|76884234|gb|ABA58915.1| Peptidase S1C, Do [Nitrosococcus oceani ATCC 19707]
 gi|207089640|gb|EDZ66911.1| protease Do subfamily [Nitrosococcus oceani AFC27]
          Length = 471

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 138/436 (31%), Positives = 229/436 (52%), Gaps = 18/436 (4%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   ++   SP++V++     +K++       +G   LPE  P +++FR+ F +  +GE 
Sbjct: 29  DFTELVKNNSPAVVNIST--TQKITQGGSRLPHGLHQLPEGSPFEDFFRRFFDEG-TGE- 84

Query: 99  PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
                + E    GSGF I+ DGYI+T+NH+++D     V  SD  EL A++VG+D   DL
Sbjct: 85  ---PRSFETHSLGSGFVISSDGYIITNNHVIQDADEIIVRFSDRRELEAEVVGSDESSDL 141

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT- 217
           A+LKV++ +    +   +A+ ++VGE V  IG+PF    + +AGIVSAL R +P+     
Sbjct: 142 ALLKVEA-KDLPTLRQSNASQLKVGEWVLAIGSPFGFEHSATAGIVSALGRSLPEESYVP 200

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F Q D  IN GNSGGP FN +G V+G+N+ I +     MG+   IP+ +  + +  L  K
Sbjct: 201 FIQTDVAINPGNSGGPLFNLMGEVVGINSQIYSRTGGFMGLSFAIPIDVAMEVVDQLKEK 260

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           GRV  GW G++ Q++T+ELA   GL   +G+L+  V+ +SPA K G++VGD+I   +G+ 
Sbjct: 261 GRVTRGWLGVVIQDVTRELAESFGLGKPQGALVARVLADSPAAKGGVQVGDIILDFNGKS 320

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD-----KE 392
           +         +      E V I + + G + ++ + +G  P  K ++    G      +E
Sbjct: 321 VPRSAALPPLVGRAEIGETVDIQILRAGDEKTLKIKIGELPE-KKELEKATGKPDHIFEE 379

Query: 393 LLGMVLQDINDGNKKLVRIVA---LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
            L + + D+    +  + +V+   +    E      GI+ G  I+S+N  E+      + 
Sbjct: 380 RLALEIADLKKEERTQLDVVSGVRVTKVEEGPAFEAGIRHGDIILSINNTEIKDTAQFKE 439

Query: 450 LIGKAKEKKRDSVLLQ 465
           L  K    K   +LLQ
Sbjct: 440 LAKKLPAGKAVPLLLQ 455


>gi|68250211|ref|YP_249323.1| periplasmic serine protease do/HhoA-like [Haemophilus influenzae
           86-028NP]
 gi|68058410|gb|AAX88663.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae 86-028NP]
          Length = 463

 Score =  203 bits (516), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 131/452 (28%), Positives = 233/452 (51%), Gaps = 31/452 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + ++AL   + S+++ V +A LP        L P++ +V P++V++ VE K KV     F
Sbjct: 8   LNSIALGLSVLSTSF-VAQATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPF 66

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILTSN 126
                 ++PE+   K +F   F + F G      ++       GSG  I    GY+LT+N
Sbjct: 67  ----LDDIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLTNN 116

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+++     +V L D  E  AKLVG D   D+A+++++       ++F D++ +RVG+  
Sbjct: 117 HVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSDKLRVGDFT 176

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIG 243
             IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +IG
Sbjct: 177 VAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGELIG 236

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    + 
Sbjct: 237 INTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVS 296

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++  +
Sbjct: 297 AQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLR 356

Query: 364 EGSKHSVAVVL----GSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE 419
           +G  H V + L    GS  ++K ++        L G  L+D +    K ++I  + PN  
Sbjct: 357 DGKSHDVKMKLQADDGSQLSSKTEL------PALDGATLKDYDAKGVKGIKITKIQPN-- 408

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
                +G++ G  I+ +N   +  I+++ +++
Sbjct: 409 SLAAQRGLKSGDIIIGINRQMIENIRELNKVL 440


>gi|313500342|gb|ADR61708.1| AlgY [Pseudomonas putida BIRD-1]
          Length = 467

 Score =  202 bits (515), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 135/435 (31%), Positives = 219/435 (50%), Gaps = 28/435 (6%)

Query: 28  VLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKKKVSVEQMFNAYGFGNLPEDHPLKN 84
           VL A+   +  D   ++ + SP++V++  +   P ++++  QM         P+   L  
Sbjct: 12  VLTAQAEEALPDFTTLVEQASPAVVNISTKQKLPDRRIAANQM---------PDLEGLPP 62

Query: 85  YFRKDFHKFFSGE--EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
            FR+ F +    +   P      E    GSGF I+ DGY+LT+NH+V D     V LSD 
Sbjct: 63  MFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYVLTNNHVVADADEIIVRLSDR 122

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
           +EL AKLVGTD   D+A+LKV+  +    V+  D+  ++VGE V  IG+PF    +V+ G
Sbjct: 123 SELQAKLVGTDPRTDVALLKVEG-KNLPTVKLGDSEKLKVGEWVLAIGSPFGFDHSVTKG 181

Query: 203 IVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLI 261
           IVSA  R +P D    F Q D  IN GNSGGP FN  G V+G+N+ I T     MG+   
Sbjct: 182 IVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQIFTRSGGFMGLSFA 241

Query: 262 IPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADK 321
           IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+  V++  PA K
Sbjct: 242 IPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFGLDKPAGALVAQVLENGPAAK 301

Query: 322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK 381
            G++VGDVI  ++G+ I    D    +      E+ K+ + + G + ++ + +G+ P   
Sbjct: 302 GGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGEKAKLEIIRNGKRQNLDISVGALP--D 359

Query: 382 NDMHLEVGDK-------ELLGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGM 431
           +D+ +  G +         LG+ + D+    KK + +   V +   ++      G++ G 
Sbjct: 360 DDVDIGAGTEGSAERSSNRLGVSVADLTAEQKKSLELKGGVVIKEVQDGPAAMIGLRPGD 419

Query: 432 TIVSVNTHEVSCIKD 446
            I  +N   +   K+
Sbjct: 420 VISHLNNQAIGSAKE 434



 Score = 37.0 bits (84), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+   +LT E    L L   KG ++   V++ PA   G++ GDVI  L+ + I S ++F
Sbjct: 379 LGVSVADLTAEQKKSLEL---KGGVVIKEVQDGPAAMIGLRPGDVISHLNNQAIGSAKEF 435

Query: 345 VWQIASRSPKEQ-VKISLCKEG 365
             +IA   PK + V + + ++G
Sbjct: 436 T-EIAKELPKNRSVSMRVLRQG 456


>gi|222149079|ref|YP_002550036.1| serine protease [Agrobacterium vitis S4]
 gi|221736064|gb|ACM37027.1| serine protease [Agrobacterium vitis S4]
          Length = 528

 Score =  202 bits (515), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 131/419 (31%), Positives = 214/419 (51%), Gaps = 35/419 (8%)

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            +P+  P ++ F +DF+K   G+    +  V  L  GSGF I   GYI+T+NH++E+   
Sbjct: 103 QVPKGSPFEDLF-EDFYKNREGKGS--NHKVNSL--GSGFVIDPAGYIVTNNHVIENADD 157

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             VI SD ++L AKL+GTD   DL++LKV+       V+F D+  +R+G+ V  IGNPF 
Sbjct: 158 IEVIFSDGSKLQAKLIGTDTKTDLSLLKVEPTEPLTAVKFGDSKVMRIGDWVMAIGNPFG 217

Query: 195 LRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           L G+V+ GIVSA  R+I   P   F Q DA IN+GNSGGP FN  G VIG+N  I++   
Sbjct: 218 LGGSVTLGIVSARGRNINAGPYDNFIQTDAAINKGNSGGPLFNMRGEVIGINTAIISPSG 277

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +G+G  +P  + +  I  L   G    GW G+  Q +  +LA   G++  +G+L++++
Sbjct: 278 GSIGIGFAVPSELAENVIKQLRDFGETRRGWLGVRIQPVPDDLAKSAGIKLGRGALVSSI 337

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
           +++ P  K  +K GDVI    G+ I   +D V  +A     + + + + ++G + ++ V 
Sbjct: 338 IEDGPVAKGPLKTGDVIISFGGKDIAESRDLVRTVAESPINQDIDVVVFRDGKRETLKVK 397

Query: 374 LGSSPTAKNDMHLEVGDKE-------------------LLGMVLQDINDGN-------KK 407
           L   P   +D   E  D E                   +LGM ++ ++D         K 
Sbjct: 398 LAQLP---DDKATEAKDSEQADPKASDSEDTDEAASGMVLGMSVEALDDEKRAANSIAKS 454

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           +  ++  +  +    + KG++ G  IV V    V+  + +   I K K   R ++ L +
Sbjct: 455 VEGLLITDVQQGSAADQKGLKTGEVIVEVAQEFVATPEALAEKIDKLKSDGRRAIHLMV 513


>gi|16273177|ref|NP_439414.1| periplasmic serine protease [Haemophilus influenzae Rd KW20]
 gi|260581175|ref|ZP_05848995.1| periplasmic serine peptidase DegS [Haemophilus influenzae RdAW]
 gi|1170411|sp|P45129|HTOA_HAEIN RecName: Full=Probable periplasmic serine protease do/hhoA-like;
           Flags: Precursor
 gi|1574189|gb|AAC22906.1| periplasmic serine protease [Haemophilus influenzae Rd KW20]
 gi|260092203|gb|EEW76146.1| periplasmic serine peptidase DegS [Haemophilus influenzae RdAW]
          Length = 466

 Score =  202 bits (515), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 129/450 (28%), Positives = 232/450 (51%), Gaps = 24/450 (5%)

Query: 12  ICTVALTCVIFSSTYL--VLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           + ++AL   + S++++  V +A LP        L P++ +V P++V++ VE K KV    
Sbjct: 8   LNSIALGLSVLSTSFVAHVAQATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRS 67

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILT 124
            F      ++PE+   K +F   F + F G      ++       GSG  I    GY+LT
Sbjct: 68  PF----LDDIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLT 117

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH+++     +V L D  E  AKLVG D   D+A+++++       ++F D++ +RVG+
Sbjct: 118 NNHVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSDKLRVGD 177

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHV 241
               IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +
Sbjct: 178 FTVAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGEL 237

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           IG+N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    
Sbjct: 238 IGINTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFN 297

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           +   +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++ 
Sbjct: 298 VSAQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTY 357

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRERE 421
            ++G  H V + L +  +++     E+    L G  L+D +    K + I  + PN    
Sbjct: 358 LRDGKSHDVKMKLQADDSSQLSSKTEL--PALDGATLKDYDAKGVKGIEITKIQPN--SL 413

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
              +G++ G  I+ +N   +  I+++ +++
Sbjct: 414 AAQRGLKSGDIIIGINRQMIENIRELNKVL 443


>gi|145638830|ref|ZP_01794438.1| excinuclease ABC subunit B [Haemophilus influenzae PittII]
 gi|145271802|gb|EDK11711.1| excinuclease ABC subunit B [Haemophilus influenzae PittII]
 gi|309750813|gb|ADO80797.1| Periplasmic serine protease HtrA [Haemophilus influenzae R2866]
          Length = 463

 Score =  202 bits (515), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 129/448 (28%), Positives = 231/448 (51%), Gaps = 23/448 (5%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + ++AL   + S+++ V +A LP        L P++ +V P++V++ VE K KV     F
Sbjct: 8   LNSIALGLSVLSTSF-VAQATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPF 66

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILTSN 126
                 ++PE+   K +F   F + F G      ++       GSG  I    GY+LT+N
Sbjct: 67  ----LDDIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLTNN 116

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+++     +V L D  E  AKLVG D   D+A+++++       ++F D++ +RVG+  
Sbjct: 117 HVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSDKLRVGDFT 176

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIG 243
             IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +IG
Sbjct: 177 VAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGELIG 236

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    + 
Sbjct: 237 INTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVS 296

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++  +
Sbjct: 297 AQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLR 356

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVE 423
           +G  H V + L +  +++     E+    L G  L+D +    K + I  + PN      
Sbjct: 357 DGKSHDVKMKLQADDSSQLSSKTEL--PALDGATLKDYDAKGVKGIEITKIQPN--SLAA 412

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLI 451
            +G++ G  I+ +N   +  I+++ +++
Sbjct: 413 QRGLKSGDIIIGINRQMIENIRELNKVL 440


>gi|323139002|ref|ZP_08074062.1| protease Do [Methylocystis sp. ATCC 49242]
 gi|322395756|gb|EFX98297.1| protease Do [Methylocystis sp. ATCC 49242]
          Length = 498

 Score =  202 bits (515), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 130/403 (32%), Positives = 203/403 (50%), Gaps = 30/403 (7%)

Query: 90  FHKFFSGEE------PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT 143
           F +FF   +      P +    +    GSGF I   G ++T+NH++ D    +VI +D  
Sbjct: 81  FEEFFKRRQGQGQGMPDMPRQRKSSSLGSGFVIDPSGIVITNNHVIADANEVTVIFNDGQ 140

Query: 144 ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
           +L A+++G D   D+AVLKV+ ++    V+F D++  +VG+ V  +GNPF L G+V+AGI
Sbjct: 141 KLKAEVLGKDQKVDVAVLKVKPEKPLKAVKFGDSDKAKVGDWVLAVGNPFGLGGSVTAGI 200

Query: 204 VSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           VSA +R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  I++     +G+G   
Sbjct: 201 VSARNRNIDSGPYDNYIQTDASINKGNSGGPLFNMDGEVIGINTAILSPSGGSVGIGFAT 260

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P + ++  I  L   G    GW G+  QN+   +A  L L  T+G+L+  V  + P+  A
Sbjct: 261 PANTVQPVIEQLQQFGETRRGWLGVRIQNVDDAIAETLNLGATRGALVAGVDDKGPSKPA 320

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN 382
           G+K GDVI   DG+ IK  +D    +A+    + V++ + + G + S  V LG     + 
Sbjct: 321 GLKAGDVIIKFDGKPIKESRDLPKLVAATPVGKDVELVIVRGGKEQSKTVKLGRLEDGEK 380

Query: 383 DMHLEVGDKE-----------LLGMVLQ----------DINDGNKKLVRIVALNPNRERE 421
               + GDK+            LG+ L            I D  K  V I A++P    +
Sbjct: 381 VASRDAGDKDKPDTSGPSSQTTLGLELSRLTDELRARFQIKDTVKSGVLITAVDP--RSD 438

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
              K +Q G  ++ VN   V+   D  + I   K+  + + LL
Sbjct: 439 AAEKRLQAGEILLEVNQEAVNDPADAVKKIKALKDAGKKTALL 481


>gi|213962521|ref|ZP_03390783.1| HtrA protein [Capnocytophaga sputigena Capno]
 gi|213954847|gb|EEB66167.1| HtrA protein [Capnocytophaga sputigena Capno]
          Length = 471

 Score =  202 bits (515), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 105/273 (38%), Positives = 159/273 (58%), Gaps = 4/273 (1%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSG  IT DGYI+T+NH++ +  +  V L+++    AKL+GTDA  D+A+LK+++D K  
Sbjct: 108 GSGVIITPDGYIVTNNHVIANATTLEVTLNNNKTYAAKLIGTDAASDIALLKIEADEKLP 167

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG----TFTQIDAPIN 226
            + F D++N +VGE V  +GNPF L  TV+AGI+SA  R+I +R      +F Q DA +N
Sbjct: 168 FLTFADSDNTQVGEWVLAVGNPFNLNSTVTAGIISAKARNISERGSDKIESFIQTDAVVN 227

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGG   N  G +IG+N  I ++   +MG    +P +I KK +  LI  G V  G  G
Sbjct: 228 MGNSGGALVNLNGDLIGINTAISSTTGVYMGYSFAVPSNIAKKVVEDLIEYGNVQRGVMG 287

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q L  E+A  L ++ T+G  + +V  ES A   G+K GD+I  +D   I  + D   
Sbjct: 288 VRGQGLDSEVAKKLNIKETEGFYVDSVDDESGAGAVGLKKGDIIKQIDNVKIHKYSDLSG 347

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT 379
            IAS+ P + +K+   +EG + +  + L  + T
Sbjct: 348 HIASKRPGDMLKVIYVREGKERTANITLKKNTT 380


>gi|212633575|ref|YP_002310100.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Shewanella piezotolerans
           WP3]
 gi|212555059|gb|ACJ27513.1| Peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Shewanella piezotolerans
           WP3]
          Length = 451

 Score =  202 bits (515), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 140/436 (32%), Positives = 229/436 (52%), Gaps = 39/436 (8%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNA--YGFG-NLPEDHPLKNYFRKDFHKFFSG 96
           L P++ + +P++V+V V     VS +++ +A  Y FG N P +   +  F+         
Sbjct: 40  LAPMLQKTTPAVVAVAVS-GTHVSKQKVPDAFRYFFGPNAPREQVQERPFKG-------- 90

Query: 97  EEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
                         GSG  I   +GYI+T+NH++E      + L D  E+ AKL+G+DA 
Sbjct: 91  -------------LGSGVIIDAKEGYIVTNNHVIEGADEILIGLHDGREVEAKLIGSDAE 137

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--D 213
            D+A+L++++ +    ++  D++ ++VG+    IGNPF L  TV++GIVSA+ R     +
Sbjct: 138 SDIALLQIEA-KNLTALKRADSDELQVGDFAVAIGNPFGLGQTVTSGIVSAMGRSGLGIE 196

Query: 214 RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
               F Q DA IN GNSGG   N  G +IG+N  IV  G  ++G+G  IP +++   +  
Sbjct: 197 MLENFIQTDAAINSGNSGGALVNLNGELIGINTAIVAPGGGNVGIGFAIPANMVNNLVDQ 256

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           +I  G V  G  G++ Q+LT ELA   G+    G  I  V+ +S ADKAG+KVGD+I  +
Sbjct: 257 IIEHGEVRRGVLGVLGQDLTSELAKGFGIETQHGGFINEVMPDSAADKAGIKVGDIIVSV 316

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL 393
           +GR IKS Q+   ++A+     +V+  L ++G + +V   LG S T   +         L
Sbjct: 317 NGRKIKSFQELRAKVATMGAGSKVEFGLIRDGDEETVTATLGES-TQTAEAAAGAVHPML 375

Query: 394 LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
            G  L++ N+    +  +   +P       A G+ KG  IV VN  +V  +K ++ ++  
Sbjct: 376 QGAKLENSNNSGVVITDVAQGSP-----AAASGLIKGDVIVGVNRSKVKNLKSLKSVL-- 428

Query: 454 AKEKKRDSVLLQIKYD 469
             E ++ SV L+I+ D
Sbjct: 429 --EDQKGSVALKIQRD 442


>gi|157963412|ref|YP_001503446.1| protease Do [Shewanella pealeana ATCC 700345]
 gi|157848412|gb|ABV88911.1| protease Do [Shewanella pealeana ATCC 700345]
          Length = 451

 Score =  202 bits (515), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 152/468 (32%), Positives = 237/468 (50%), Gaps = 48/468 (10%)

Query: 17  LTCVIFSSTYL---VLEAKLPPSSVD------LPPVIARVSPSIVSVMVEPKKKVSVEQM 67
           L+  I S+T     V      P +VD      L P++   +P++V+V V     VS +++
Sbjct: 8   LSAAILSATLTLAPVASQAAIPLAVDGQELPSLAPMLQETTPAVVAVAVS-GTHVSKQKV 66

Query: 68  FNA--YGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGYIL 123
            +A  Y FG N P +   +  F+                       GSG  I   +GYI+
Sbjct: 67  PDAFRYFFGPNAPREQVQERPFKG---------------------LGSGVIIDAKEGYIV 105

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+NH++E      + L D  E+ AKL+GTDA  D+A+L++++ +    ++  D++ ++VG
Sbjct: 106 TNNHVIEGADEILIGLHDGREVEAKLIGTDAESDIALLQIKA-KNLTALKRADSDKLQVG 164

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHV 241
           +    IGNPF L  TV++GIVSA+ R     +    F Q DA IN GNSGG   N  G +
Sbjct: 165 DFAVAIGNPFGLGQTVTSGIVSAMGRSGLGIEMLENFIQTDAAINSGNSGGALVNLNGEL 224

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           IG+N  IV  G  ++G+G  IP +++   +  +I  G V  G  G+M Q+LT ELA   G
Sbjct: 225 IGINTAIVAPGGGNVGIGFAIPANMVNNLVKQIIEHGEVRRGVLGVMGQDLTSELAKGFG 284

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           +    G  I  V+ +S A KAG+KVGD+I  ++GR IKS Q+   ++A+     +V+  L
Sbjct: 285 IETQHGGFINEVMPDSAAAKAGIKVGDIIVSVNGRSIKSFQELRAKVATMGAGTKVEFGL 344

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRERE 421
            ++G + +V  VLG S  A       V    L G  L+  +    ++  +   +P     
Sbjct: 345 IRDGDEETVTAVLGESTQAAEAAAGAV-HPMLQGAKLETASSSGVEITDVAQGSP----- 398

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
             A G+ KG  IV VN  +V  +K ++     A E ++ SV L+IK D
Sbjct: 399 AAASGLIKGDIIVGVNRTKVKNLKALK----SALEDQKGSVALKIKRD 442


>gi|158522825|ref|YP_001530695.1| protease Do [Desulfococcus oleovorans Hxd3]
 gi|158511651|gb|ABW68618.1| protease Do [Desulfococcus oleovorans Hxd3]
          Length = 485

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 140/374 (37%), Positives = 202/374 (54%), Gaps = 20/374 (5%)

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I   G I+T+NH+VE+     V L D  E  A +VGTDA  DLA+L++++ R  
Sbjct: 113 LGSGFVIDSRGLIVTNNHVVENADKIIVKLKDGDEFDATVVGTDANTDLALLEIEAKRPL 172

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQG 228
             +E  D+++++VGE V  IG+PF L  TV+AGIVSA  R I   P   F Q DA IN G
Sbjct: 173 PSLELGDSDDLKVGEWVVAIGSPFGLEQTVTAGIVSAKGRVIGAGPYDDFIQTDASINPG 232

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP  N  G V+G+N  I+ SGQ   G+G  IP ++    +  L +KG V  GW G+ 
Sbjct: 233 NSGGPLVNLAGEVVGINTAIIASGQ---GIGFAIPANLANNILEQLETKGHVIRGWLGVG 289

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +++E+A    L   KG+L+T V    PADKAG+K  D+I  ++G+ IK  +D    I
Sbjct: 290 IQPVSKEMAEYYNLESGKGALVTEVFPGDPADKAGIKTQDIILEVNGKEIKDSRDLSAMI 349

Query: 349 ASRSPKEQVKISLCKEGSKHSVAV---------VLGSSPTA-KNDMHLEVGDKELLGMVL 398
           AS    E +K+ L ++G K +V V         V G S T  ++ M LEV D  +   V 
Sbjct: 350 ASLPVGETIKVMLLRDGKKKTVTVKIKERDDTRVAGKSETGTQSAMDLEVAD--ITEEVA 407

Query: 399 QDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           + +N  + + V +  + P  +   +  GIQ G  I  +N   +    D E ++   KE  
Sbjct: 408 RKLNLNSTEGVYVSEVAPGGKG--DQAGIQPGDVIREINRQRIQNTADFEAILKGIKEG- 464

Query: 459 RDSVLLQIKYDPDM 472
            D +L+ I+    M
Sbjct: 465 -DPLLILIRKSNGM 477


>gi|26988163|ref|NP_743588.1| protease Do [Pseudomonas putida KT2440]
 gi|24982897|gb|AAN67052.1|AE016334_1 alginate biosynthesis negative regulator, serine protease AlgY
           [Pseudomonas putida KT2440]
          Length = 492

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 140/456 (30%), Positives = 230/456 (50%), Gaps = 33/456 (7%)

Query: 11  SICTVALTCVIFSSTYL---VLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKKKVSV 64
           SI  +    ++F++  +   V+ A+   +  D   ++ + SP++V++  +   P ++++ 
Sbjct: 17  SIPRLKSYLMMFAAVLMLGQVVAAQAEEALPDFTTLVEQASPAVVNISTKQKLPDRRIAA 76

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE--EPILSDTVERLMFGSGFFITDDGYI 122
            QM         P+   L   FR+ F +    +   P      E    GSGF I+ DGY+
Sbjct: 77  NQM---------PDLEGLPPMFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYV 127

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIR 181
           LT+NH+V D     V LSD +EL AKLVGTD   D+A+LKV  D K +P V+  D+  ++
Sbjct: 128 LTNNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKV--DGKNLPTVKLGDSEKLK 185

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGH 240
           VGE V  IG+PF    +V+ GIVSA  R +P D    F Q D  IN GNSGGP FN  G 
Sbjct: 186 VGEWVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGE 245

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           V+G+N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   
Sbjct: 246 VVGINSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESF 305

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL    G+L+  V++  PA K G++VGDVI  ++G+ I    D    +      E+ K+ 
Sbjct: 306 GLDKPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGEKAKLE 365

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-------ELLGMVLQDINDGNKKLVRI-- 411
           + + G + ++ + +G+ P   +D+ +  G +         LG+ + D+    KK + +  
Sbjct: 366 IIRNGKRQNLDISVGALP--DDDVDIGAGTEGSAERSSNRLGVSVADLTAEQKKSLELKG 423

Query: 412 -VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
            V +   ++      G++ G  I  +N   +   K+
Sbjct: 424 GVVIKEVQDGPAAMIGLRPGDVISHLNNQAIGSAKE 459



 Score = 36.6 bits (83), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+   +LT E    L L   KG ++   V++ PA   G++ GDVI  L+ + I S ++F
Sbjct: 404 LGVSVADLTAEQKKSLEL---KGGVVIKEVQDGPAAMIGLRPGDVISHLNNQAIGSAKEF 460

Query: 345 VWQIASRSPKEQ-VKISLCKEG 365
             +IA   PK + V + + ++G
Sbjct: 461 T-EIAKELPKNRSVSMRVLRQG 481


>gi|325280262|ref|YP_004252804.1| protease Do [Odoribacter splanchnicus DSM 20712]
 gi|324312071|gb|ADY32624.1| protease Do [Odoribacter splanchnicus DSM 20712]
          Length = 484

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 205/380 (53%), Gaps = 10/380 (2%)

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
           K Y+      +F G +P + +    +  GSG  IT+DGYI+T+NH+++      V L+D 
Sbjct: 88  KEYYGNPLEFWFGGVQPQMREVPRNMGIGSGVIITEDGYIITNNHVIDRSDKVMVTLNDK 147

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
            E  AK++GTD   D+A+LK+ ++    P+E+ +++++ +GE V  +GNP+ L  TV+AG
Sbjct: 148 REFEAKVIGTDPDTDIALLKIDAN-GLQPIEYGNSDDVVLGEWVLAVGNPYNLTSTVTAG 206

Query: 203 IVSALDRDIPDRPG--TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           I+SA  R +  +    +F Q DA +N GNSGG   NA G +IG+N  I +    + G   
Sbjct: 207 IISAKARQLGGKMNLESFLQTDAAVNPGNSGGALVNAKGELIGINTAIQSPTGSYSGYSF 266

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            +P+++ +K +  L   G+V     GI  Q LT  LA    L+   G  +  V+    A+
Sbjct: 267 AVPVNVARKVVSDLKEYGKVQRAMIGIKMQELTPALAKEYKLKEQSGIYVAEVIPGGAAE 326

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
           KAG+KVGDVI  L+G   K+      Q+A  +P   V+++L ++G +    VVL +S   
Sbjct: 327 KAGVKVGDVILQLNGYEAKTFAQLQEQLAQYTPGNTVQMTLSRDGKEKVADVVLQNS--- 383

Query: 381 KNDMHLEVGDKELLGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVN 437
             D+ L+ G   +LG  +Q +    +   R+   V +   +  ++++ G+ +G  IV +N
Sbjct: 384 YGDVSLKTGSG-ILGAEVQPLTQAERYRYRLNKGVKITDLKNGKLKSAGLTEGYIIVKIN 442

Query: 438 THEVSCIKDVERLIGKAKEK 457
              +   +D+ER +  A ++
Sbjct: 443 DMVIYDSEDLERALKAAGDE 462


>gi|224825218|ref|ZP_03698324.1| protease Do [Lutiella nitroferrum 2002]
 gi|224602889|gb|EEG09066.1| protease Do [Lutiella nitroferrum 2002]
          Length = 473

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 194/368 (52%), Gaps = 23/368 (6%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           K I +  L  V+ S      EA++ P   D   ++ +   ++V++        +V +  N
Sbjct: 5   KLIASAMLAAVVVSGPVYAAEARVLP---DFTQIVEQEGKAVVNI----STTQTVRETIN 57

Query: 70  AYGFGNLPEDHPLKNYFRKD-FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
           A     +PE+      F  D F +FF    P      +    GSGF ++ DGY++T++H+
Sbjct: 58  A-----VPEE------FNGDPFFEFFRRFAPPQQQERKERSLGSGFIVSADGYVMTNSHV 106

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVF 187
           V      +V L D     A+LVG+DA  D+A+LK+ +    +PV     + N++VGE V 
Sbjct: 107 VARADEITVTLGDKRTFKARLVGSDARTDVALLKINASH--LPVAHIGSSANLKVGEWVL 164

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IG+PF    +V++GIVSA  R +PD     F Q DA +N GNSGGP FN  G V+G+N+
Sbjct: 165 AIGSPFGFENSVTSGIVSAKGRSLPDENYVPFIQTDAAVNPGNSGGPLFNLKGEVVGINS 224

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
            I +     MG+   IP+ +  K    L S+G+V  G  G+  Q L+ ELA   GL    
Sbjct: 225 QIYSRSGGFMGISFAIPIDVAVKVADQLKSEGKVSRGRIGVAIQELSPELAASFGLASPN 284

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+LI +V K+ PADKAG++ GD++  +DG+ ++S  D    I +  P + V + + +  +
Sbjct: 285 GALINSVEKDGPADKAGLRAGDIVLKIDGQPVESSADMPRLIGAMRPGKPVAVEVWRNRA 344

Query: 367 KHSVAVVL 374
           +  V VVL
Sbjct: 345 RRVVTVVL 352


>gi|294677924|ref|YP_003578539.1| protease Do [Rhodobacter capsulatus SB 1003]
 gi|294476744|gb|ADE86132.1| protease Do [Rhodobacter capsulatus SB 1003]
          Length = 496

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 144/489 (29%), Positives = 236/489 (48%), Gaps = 52/489 (10%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIV-----SVMVEPKKKVS--- 63
           +  V L+  +  S   +  A+  P       ++ +V P++V     + + EP  ++    
Sbjct: 18  LMAVLLSTALALSPLAMTPAQAGPVPESFADLVVQVKPAVVMITTSTTVSEPAGRMPGFP 77

Query: 64  ----VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDD 119
                E+ F  +G  N+P+  P + + R D                     GSGF I+ D
Sbjct: 78  PGSPFEEFFKEFGMPNMPQGGPQRQH-RAD-------------------ALGSGFVISAD 117

Query: 120 GYILTSNHIV--EDGAS----FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
           GYI+T+NH++  EDG +     S+  ++  +L AK+VGTD   D+A+LKV+S      V 
Sbjct: 118 GYIVTNNHVIKGEDGNTVADEISIEFANGKKLDAKIVGTDPKTDIALLKVESKEPLPFVS 177

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGP 233
           F D++ +R G+ V  +GNP     + S GIVSA +R++    G + Q DA IN+GNSGGP
Sbjct: 178 FGDSDTMREGDWVMAMGNPLGQGFSTSVGIVSARNRELSGTYGDYIQTDAAINRGNSGGP 237

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
            F+  G VIGVN  I++     +G+G  +  +++ K +  L   G    GW G+  Q+LT
Sbjct: 238 LFSMDGKVIGVNTAILSPNGGSIGIGFSMASNVVSKVVGQLQEFGATRRGWLGVKIQDLT 297

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
            ++A  + L   +G++++  V E PA  AGMK GDVI    G  +K  +    ++A    
Sbjct: 298 PDMAEAMSLATPEGAMVSE-VPEGPAKVAGMKSGDVIISFAGAPVKDTKSLTRRVADAPV 356

Query: 354 KEQVKISLCKEGSKHSVAVVLG------SSPTAKNDMHLEVGDKELLGMVLQDINDGNKK 407
            + V + + + G   ++ V LG      SS  A       +    +LGMVL  I D  + 
Sbjct: 357 GQAVDVVVMRAGKPVTLQVTLGQRELAESSEAAAGGTAPALAGGAVLGMVLSPITDAMRA 416

Query: 408 -------LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
                  L  ++  + +       KG++ G  IV      V+ + D++  + +AKE  R 
Sbjct: 417 ERNLPEDLTGLMVTDIDATGAAFDKGLRAGDVIVEAGQQPVTSLDDLKARVAEAKEGGRK 476

Query: 461 SVLLQIKYD 469
           SVLL I+ +
Sbjct: 477 SVLLLIRRE 485


>gi|304321182|ref|YP_003854825.1| serine protease [Parvularcula bermudensis HTCC2503]
 gi|303300084|gb|ADM09683.1| serine protease [Parvularcula bermudensis HTCC2503]
          Length = 517

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 233/450 (51%), Gaps = 37/450 (8%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++  VSP++VS+  E    VS          G  PE   L+      F +F    E    
Sbjct: 63  LVEEVSPAVVSIRTEADVPVSAR-------MGIPPE---LERMLPPSFREFMPEMEEEEG 112

Query: 103 DTVER-LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
           +T  R L  GSGFFI D G+I+T+NH+++     +V+L++  EL A+LVG D   DLAVL
Sbjct: 113 ETTRRSLGQGSGFFINDRGHIVTNNHVIDGADEITVVLNNGDELTAELVGMDPWSDLAVL 172

Query: 162 KV--QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP--GT 217
           KV    D+++  V+F + +++RVG+ V  +GNPF L G+V++GIVSA+DRD   R     
Sbjct: 173 KVDPSPDQRY--VQFSEESDLRVGDYVLAVGNPFGLGGSVTSGIVSAMDRDGGARNPYSG 230

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F QIDA IN+GNSGGP F+  G+V+GVN  I++    ++G+GL +P  +    +  +I  
Sbjct: 231 FIQIDASINRGNSGGPTFDLRGNVVGVNTAIISPTGGNVGIGLAVPAELAADVVRQIIDN 290

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           G V  GW G+   ++   LA  +GL    G+++ +V  +SPA+KAG + GDV+    G+ 
Sbjct: 291 GAVTRGWLGVGIGDVDDRLAAAVGLDSPVGAIVQSVQPDSPAEKAGFEEGDVVLEFGGKS 350

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-SSPT-AKNDMHLEVGDKELLG 395
           I S       +    P +  K  + + G + ++ V L    PT A+     + G++E   
Sbjct: 351 IDSATGLTRVVGGFEPGKSYKAKVIRGGRERTLTVTLDRRDPTEARAAGGADEGERENSS 410

Query: 396 MVLQDINDG------------------NKKLVRIVALNPNREREVEAKGIQKGMTIVSVN 437
               +   G                  ++    ++    +R  E    G ++GM +   +
Sbjct: 411 AAPTETELGLGLTLSSLTTSLRERYGFDEDTTGVLIAKVDRNSESAEAGFREGMVVSRAD 470

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              ++  +D+ + +  AK++ ++++L++++
Sbjct: 471 NETITQPEDLVKAVKAAKQRGKEALLVRVQ 500


>gi|330443807|ref|YP_004376793.1| serine proteinase, HtrA/DegQ/DegS family [Chlamydophila pecorum
           E58]
 gi|328806917|gb|AEB41090.1| serine proteinase, HtrA/DegQ/DegS family [Chlamydophila pecorum
           E58]
          Length = 489

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 148/427 (34%), Positives = 227/427 (53%), Gaps = 42/427 (9%)

Query: 77  PEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
           P ++P  +YF  +F   F G     E P   + V     G+GF +++DGYI+T+NH+VE+
Sbjct: 85  PYENPF-DYFNDEFFNRFFGLPPHRERPQSKEAVR----GTGFIVSEDGYIVTNNHVVEN 139

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V L D  +  A ++G D   DLAV+K++++ K   + F +++N++VG+    IGN
Sbjct: 140 TGKIHVTLHDGQKYTATVIGLDPKTDLAVIKIKAE-KLPHLSFGNSDNLQVGDWAIAIGN 198

Query: 192 PFRLRGTVSAGIVSALDRD---IPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           PF L+ TV+ G++SA  R+   I D    F Q DA IN GNSGGP  N  G VIGVN  I
Sbjct: 199 PFGLQATVTVGVISAKGRNQLHIADFE-DFIQTDAAINPGNSGGPLLNIDGQVIGVNTAI 257

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           V+    ++G+G  IP  +  + I  LI +G+V  G+ G+  Q +  ELA    L    G+
Sbjct: 258 VSGSGGYIGIGFAIPSLMANRIIDQLIHEGQVTRGFLGVTLQPIDAELAACYKLNKIYGA 317

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           LIT VVK SPADKAG+K  DVI   +G+ + S   F   I+  SP  +V + + +EG   
Sbjct: 318 LITDVVKGSPADKAGLKQEDVIVAYNGKEVDSLSTFRNAISLMSPNSRVVLKIVREGKFL 377

Query: 369 SVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIN-DGNKKL--------VRIVALNPNRE 419
            V V++  +P  +      V   + +G+ +Q++  +  KKL        V IV++ P   
Sbjct: 378 EVPVMIAQAPKEEG-----VSSLQRVGIRVQNLTAEHAKKLGISPETKGVIIVSVEPG-- 430

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNM 479
               A GI  G  I++VN   VS + ++  ++   K+   DS+LL +            +
Sbjct: 431 STAAASGIAPGQLILAVNRQRVSSVDELNAVL---KDSGNDSILLMVS--------QGEV 479

Query: 480 SRFVSLK 486
            RFV+LK
Sbjct: 480 IRFVALK 486


>gi|297569465|ref|YP_003690809.1| protease Do [Desulfurivibrio alkaliphilus AHT2]
 gi|296925380|gb|ADH86190.1| protease Do [Desulfurivibrio alkaliphilus AHT2]
          Length = 489

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 222/448 (49%), Gaps = 35/448 (7%)

Query: 31  AKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDF 90
           A  PPS  DL     ++ PS+V++     + V      + + F    E   L   FR+ F
Sbjct: 35  AAPPPSFADL---AEKLGPSVVNIYT--TQTVQAPGSPHQFFF----EGEELPELFRRFF 85

Query: 91  -----HKFFSGEEP---ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
                H    G  P        ++R   GSG  I+ DGYI+T+NH+VE+  S ++ L++ 
Sbjct: 86  DLPSPHSRPPGGTPPRGTPPREMQRTSLGSGVVISPDGYIVTNNHVVENADSINIRLTNF 145

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
            E  A++VG D   DLA+LK++       V   D+  +RVG+ V  IGNPF    TV+AG
Sbjct: 146 EEYDAEVVGRDPKTDLALLKIEPRNPLPAVTMGDSEALRVGDWVIAIGNPFGFEQTVTAG 205

Query: 203 IVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLI 261
           IVS   R +   P   F Q DA IN GNSGGP FN  G ++G+N  I + G  ++G+G  
Sbjct: 206 IVSGKGRSLGSGPYENFIQTDASINPGNSGGPLFNLQGEMVGINTAIYSRGGGNIGIGFA 265

Query: 262 IPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADK 321
           IP+++ K  I  +   G V  GW G++ Q++T ELA    L    G+L+  V  ESPA +
Sbjct: 266 IPVNMAKNIIGQIQEHGTVTRGWLGVLIQHVTPELARQFQLDRPIGALVGEVSPESPAAE 325

Query: 322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSP-KEQVKISLCKEGSKHSVAVVLGS---- 376
           AGM+ GDVI   DG+ I +    V  + +++P   +V + + + G +  + V +G     
Sbjct: 326 AGMRPGDVIVEYDGKEI-TQMSMVPTLVAQTPVGSEVPVKVIRRGQETELLVTIGKLDED 384

Query: 377 -SPTAKNDMHLEVGDKELLGMVLQDIND------GNKKLVRIVALNPNREREVEAKGIQK 429
             P A      E    E LG+ +Q++ +      G K+ V ++  +       +  G+++
Sbjct: 385 DQPAAPRTREAE----EKLGLGVQELTEEVARSLGLKEQVGVLISHVEPGSPAQRAGLRR 440

Query: 430 GMTIVSVNTHEVSCIKDVERLIGKAKEK 457
           G  IV VN      + +   L+  A EK
Sbjct: 441 GEVIVEVNQQPAGNLTEYAELMAAALEK 468



 Score = 44.7 bits (104), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 66/130 (50%), Gaps = 15/130 (11%)

Query: 258 VGLIIPLSIIKKAIPS--LISKGRVDHG-------------WFGIMTQNLTQELAIPLGL 302
           VG  +P+ +I++   +  L++ G++D                 G+  Q LT+E+A  LGL
Sbjct: 357 VGSEVPVKVIRRGQETELLVTIGKLDEDDQPAAPRTREAEEKLGLGVQELTEEVARSLGL 416

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
           +   G LI+ V   SPA +AG++ G+VI  ++ +   +  ++   +A+   K +V + + 
Sbjct: 417 KEQVGVLISHVEPGSPAQRAGLRRGEVIVEVNQQPAGNLTEYAELMAAALEKGEVLLLVN 476

Query: 363 KEGSKHSVAV 372
           + G    VA+
Sbjct: 477 RGGQHRFVAI 486


>gi|254282425|ref|ZP_04957393.1| ATPase [gamma proteobacterium NOR51-B]
 gi|219678628|gb|EED34977.1| ATPase [gamma proteobacterium NOR51-B]
          Length = 460

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 204/384 (53%), Gaps = 34/384 (8%)

Query: 28  VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFR 87
           +L A+  P   D   ++   +P++V ++V   +K ++         G +P+   L  Y R
Sbjct: 11  ILSAQALP---DFSSIVEDATPAVVKILVSYDEKEAI---------GQVPDMQQLPEYLR 58

Query: 88  KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
           + F       +P      ER   GSGF I++DGY++T+NH+VE  +  +V L D  +  A
Sbjct: 59  RFFEGRGGNPQP-----RERASIGSGFVISEDGYVVTNNHVVEGASGVTVRLIDRRDYDA 113

Query: 148 KLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSAL 207
           +++G D   DLA+LK+ +D     ++    +  +VG+ V  IG+PF L  +VSAGIVSA 
Sbjct: 114 EIIGLDPRSDLALLKIDAD-DLATLKLGRNDKTKVGQWVLAIGSPFGLDFSVSAGIVSAK 172

Query: 208 DRDIPDRPGT----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
            R +P   G     F Q D  IN GNSGGP FN  G VIGVN+ I T     +G+   IP
Sbjct: 173 GRSLPTERGENYVPFLQTDVAINPGNSGGPLFNIDGEVIGVNSQIFTRSGGSIGLSFAIP 232

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
           +++++  +  L   G V  GW G+  Q++ + LA   GL   +G+L+  V ++SPA++AG
Sbjct: 233 VNVVRNVVEQLKENGEVVRGWLGVSIQDVDRNLAESFGLDRPQGALVAQVGEDSPAERAG 292

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-------- 375
           ++ GDVI   DG+ I +  D    +   +P   V   + ++G + ++ V +G        
Sbjct: 293 IEAGDVIIKFDGQTIDTSADLPHVVGLLAPGSMVDAQVIRDGKRITLEVEVGGLDADDRP 352

Query: 376 SSPTAKNDMHLEVGDKELLGMVLQ 399
           S  ++ ND     G+ ++LGMV++
Sbjct: 353 SVASSGND----AGNSDVLGMVVE 372



 Score = 41.6 bits (96), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 272 PSLISKGRVDHG---WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGD 328
           PS+ S G  D G     G++ ++   E    LGL G  G LITA+  +SPA  A +  GD
Sbjct: 352 PSVASSGN-DAGNSDVLGMVVESADMEAMAELGLNG--GVLITAIRPDSPAADANVMPGD 408

Query: 329 VICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           ++  L    +   +DF        P + V++ + + GS
Sbjct: 409 IVTRLGNIAVSDLEDFAEAATQLEPGKSVRLRVFRRGS 446


>gi|229846839|ref|ZP_04466946.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae 7P49H1]
 gi|229810328|gb|EEP46047.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae 7P49H1]
 gi|309972994|gb|ADO96195.1| Periplasmic serine protease HtrA [Haemophilus influenzae R2846]
          Length = 463

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/452 (28%), Positives = 232/452 (51%), Gaps = 31/452 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + ++AL   + S+++ V +A LP        L P++ +V P++V++ VE K KV     F
Sbjct: 8   LNSIALGLSVLSTSF-VAQATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPF 66

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILTSN 126
                 ++PE+   K +F   F + F G      ++       GSG  I    GY+LT+N
Sbjct: 67  ----LDDIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLTNN 116

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+++     +V L D  E  AKLVG D   D+A+++++       ++F D++ +RVG+  
Sbjct: 117 HVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSDKLRVGDFT 176

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIG 243
             IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +IG
Sbjct: 177 VAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGELIG 236

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    + 
Sbjct: 237 INTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVS 296

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++  +
Sbjct: 297 AQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLR 356

Query: 364 EGSKHSVAVVL----GSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE 419
           +G  H V + L    GS  ++K ++        L G  L+D +    K + I  + PN  
Sbjct: 357 DGKSHDVKMKLQADDGSQLSSKTEL------PALDGATLKDYDAKGVKGIEITKIQPN-- 408

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
                +G++ G  I+ +N   +  I+++ +++
Sbjct: 409 SLAAQRGLKSGDIIIGINRQMIENIRELNKVL 440


>gi|293390325|ref|ZP_06634659.1| protease DegQ [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290950859|gb|EFE00978.1| protease DegQ [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 460

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 136/470 (28%), Positives = 245/470 (52%), Gaps = 44/470 (9%)

Query: 12  ICTVALTCVIFSSTYL-------VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           + ++AL   + S+  L       ++E +  PS   L P++ +V PS+VS+ VE K+K   
Sbjct: 8   LTSIALGLSLLSTPMLSQAEIPAIVEGQQMPS---LAPMLEKVLPSVVSISVEGKQKTRS 64

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFI-TDDGY 121
            Q F+     ++PE+      FR     FF G +    D   R     GSG  I  + GY
Sbjct: 65  AQQFD-----DIPEE------FR-----FFFGPDMFDRDRAPRNFRGIGSGAIINAEKGY 108

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           +LT+NH+++D    +V L D  E  AK++G D L D+A+++++  +    ++  D++ +R
Sbjct: 109 VLTNNHVIKDADKITVQLQDGREFKAKVIGADELSDVALIQIEKPKNLTALKIADSDKLR 168

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG---TFTQIDAPINQGNSGGPCFNAL 238
           VG+    IGNPF L  TV++GIVSAL R      G    + Q DA +N+GNSGGP  N  
Sbjct: 169 VGDFTVAIGNPFGLGQTVTSGIVSALGRSTGSDSGMYENYIQTDAAVNRGNSGGPLINLN 228

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G +IG+N  I++    + G+   IP ++    +  ++  G V  G  GI    L  +LA 
Sbjct: 229 GELIGINTAIISPSGGNAGIAFAIPSNMANNLVQQILEFGEVRRGMLGIKGGELNADLAQ 288

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
              +   KG+ ++ V+  S ADKAG+K GDVI  ++G+ I S  +   +IA+    ++++
Sbjct: 289 AFDIEAKKGAFVSEVIPGSAADKAGLKAGDVITAINGQSISSFAEMRAKIATSGAGKEIE 348

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL-GMVLQDINDGNKKLVRIVALNPN 417
           ++  ++   ++  VVL      ++D  ++     LL  +   ++N+ ++K ++ V++   
Sbjct: 349 LTYLRDSKSNTTKVVL------QSDDKIQTSAGNLLPALDGAELNNYDEKGLKGVSVGKI 402

Query: 418 REREV-EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           +   + E +G++ G  I+ +N  ++  +  + + +    +KK  +V L I
Sbjct: 403 KTGSLAEQRGLKTGDVIIGINRQKIENLGQLRKEL----DKKPSAVALNI 448


>gi|269122204|ref|YP_003310381.1| protease Do [Sebaldella termitidis ATCC 33386]
 gi|268616082|gb|ACZ10450.1| protease Do [Sebaldella termitidis ATCC 33386]
          Length = 467

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 183/371 (49%), Gaps = 5/371 (1%)

Query: 84  NYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT 143
           NY+     +F  G     ++  E    GSGF I+ DGY++T+NH+V       V  SD  
Sbjct: 71  NYYNP-IEQFLYGRSEPRTEKKESGSLGSGFIISTDGYVMTNNHVVNGADEIFVKFSDGR 129

Query: 144 ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGI 203
           EL AKLVG D   D+A+LK+QS   F P EF +++NI VG+     GNP  L  T++ GI
Sbjct: 130 ELEAKLVGNDPEVDIAILKIQSKETFKPAEFGNSDNISVGQWAIAFGNPLGLNDTMTVGI 189

Query: 204 VSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLI 261
           VSA  R     ++   F Q DA INQGNSGGP  +  G VIG+N  I +     +G+G  
Sbjct: 190 VSAKGRSSLGIEKIENFIQTDAAINQGNSGGPLVDISGKVIGINTAIYSPSGGSIGIGFA 249

Query: 262 IPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADK 321
           IP ++      S+I  G+V+  + G   Q+L  +L     L  + G L+T V + SPA+K
Sbjct: 250 IPANLAVNIKDSIIRTGKVERAFLGTELQDLNPQLVKQFNLSTSNGVLVTNVTEGSPAEK 309

Query: 322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK 381
           AG+K GDVI  L+   + S    V QIAS      + ++  ++G  +    VL       
Sbjct: 310 AGLKSGDVITQLNDSRVNSASQLVAQIASLRVGSNISLTYIRDGKTYKANTVLTKRAETP 369

Query: 382 NDMHLEVGDKELLGMVLQDIND--GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTH 439
                      L  +  QDI     +  +  ++        E    GIQ GM + S+N  
Sbjct: 370 VSQAAAFSGLSLKTLTKQDIQKYGYSASMTGLIVTGVGSNTEAAKIGIQPGMIVRSINRV 429

Query: 440 EVSCIKDVERL 450
            V+ ++D +++
Sbjct: 430 SVNSVEDFKKV 440


>gi|254454827|ref|ZP_05068264.1| MucD serine protease MucD [Octadecabacter antarcticus 238]
 gi|198269233|gb|EDY93503.1| MucD serine protease MucD [Octadecabacter antarcticus 238]
          Length = 497

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 141/439 (32%), Positives = 220/439 (50%), Gaps = 44/439 (10%)

Query: 74  GNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
           G +P+  P +++F +     F  + P  S        GSGF I+ DGYI+T+NH++E   
Sbjct: 79  GIVPDGSPFEDFFDE-----FGQDGPRRSSA-----LGSGFVISADGYIVTNNHVIEGAD 128

Query: 134 SFSVILSDDTELPAKL-----VGTDALFDLAVLKVQSDRKFIPVEFEDANN--IRVGEAV 186
              +      + PAKL     VGTD   D+A+LKV+ D     V F D+N    RVG+ V
Sbjct: 129 EIEIEFFPGADQPAKLLPAVLVGTDPNTDIALLKVEYDTPLSFVSFGDSNGPGARVGDWV 188

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
             +GNP     +VSAGI+SA +R +      + Q DA IN+GNSGGP FN  G VIGVN 
Sbjct: 189 MAMGNPLGQGFSVSAGIISARNRSLQGTYDDYIQTDAAINRGNSGGPLFNMNGDVIGVNT 248

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL-GLRGT 305
            I++     +G+G  +   ++   I  L   G    GW G+  Q++T ++   + GL+  
Sbjct: 249 AILSPNGGSIGIGFAMSSDVVSNVIDQLEEFGETRRGWLGVRIQDVTVDMIDAIDGLQDA 308

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP-KEQVKISLCKE 364
           +G+++T  V   PA+ AGM+ GD+I + DG  I+  ++ V QI   SP  ++V + + + 
Sbjct: 309 RGAMVTD-VPAGPAEDAGMESGDIILLFDGIAIEDTRELV-QIVGNSPVGKEVPVEILRN 366

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGD---------KELLGMVLQDIND------GNKKLV 409
           G    + VVLG   TA+ +   E GD           +LGM L +I        G +   
Sbjct: 367 GDMVDLTVVLGRRETAETEAFPEDGDTPDEDTPITSNMLGMTLSEITPEMEESLGVEAAS 426

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +V +    + E E KG+  G  I      +++ I D E  + +A+E  R S+LL ++  
Sbjct: 427 GLVIVEVEADSEAETKGLLAGDLITEAGQQKIASIADFEARVEEAQEAGRKSLLLLVR-- 484

Query: 470 PDMQSGNDNMSRFVSLKID 488
                  D   RFV++ ++
Sbjct: 485 ------RDGAPRFVAIALE 497


>gi|73539383|ref|YP_299750.1| peptidase S1C, Do [Ralstonia eutropha JMP134]
 gi|72122720|gb|AAZ64906.1| Peptidase S1C, Do [Ralstonia eutropha JMP134]
          Length = 488

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 140/449 (31%), Positives = 228/449 (50%), Gaps = 46/449 (10%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           + +D   ++ +  P++V++ V  + + +  Q  +      +  D PL  +F++ F   F 
Sbjct: 54  TPMDFSGIVDQYGPAVVNISVTARAQRTAMQAPSG-----MDPDDPLFQFFKR-FGPQFQ 107

Query: 96  GEEPILSDTVERLM--FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
           G +     + ++L+   GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++GTD
Sbjct: 108 GPQ-----SGQQLVKGLGSGFIVSPDGLILTNAHVVDGAQEVTVKLTDRREFKAKVLGTD 162

Query: 154 ALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
              D+AV+++  D K +P V   D   ++VGE V  IG+P+    TV+AGIVSA  R +P
Sbjct: 163 PQTDVAVIRI--DAKDLPTVRLGDPARVKVGEPVLAIGSPYGFENTVTAGIVSAKSRSLP 220

Query: 213 DRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
           D     F Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   IP+++  K  
Sbjct: 221 DDTYVPFIQTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAIPINVATKVE 280

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             L++ G+V  G  GI  Q + Q LA   GL    G+L+ +V  +SPA KAG+K GDVI 
Sbjct: 281 QQLVAHGKVTRGRLGISVQEVNQALAQSFGLPKPSGALVNSVEADSPAAKAGVKPGDVIV 340

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK 391
            LD  +I    D    +A   P  Q  + + ++G   ++AV +G+   AK +   + G+ 
Sbjct: 341 QLDDDVIDHSGDLPEHVADIKPGTQTTLKIIRKGQPMTLAVKVGA---AKEESVAQKGN- 396

Query: 392 ELLGMVLQDINDGNKKLVRIVALNPNRERE---------------VEAKGIQKGMTIVSV 436
                   D   G +  + + +L P+  RE                   GIQ G  I+S+
Sbjct: 397 --------DSQAGGRLGLAVRSLTPSERRESGIDGGLVVEDVAGPAARVGIQPGDVILSL 448

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
           N   ++    +  L+  AK  K+ ++L+Q
Sbjct: 449 NGTPITSADQLRALV--AKSGKQVALLVQ 475


>gi|114326811|ref|YP_743968.1| endopeptidase degP [Granulibacter bethesdensis CGDNIH1]
 gi|114314985|gb|ABI61045.1| endopeptidase degP [Granulibacter bethesdensis CGDNIH1]
          Length = 372

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 122/373 (32%), Positives = 198/373 (53%), Gaps = 31/373 (8%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           ++ CTV L  ++ S++    +A+  P S    P++ ++ P++V++ V        E +  
Sbjct: 24  RAFCTVILAAMLLSTS--ACQARTAPDS--FAPLVKKIMPAVVNIAV-------TESLSP 72

Query: 70  AYGFGNLPEDHPLKNY-FRKDFHKFFSGEEPILSDTVERLM-FGSGFFITDDGYILTSNH 127
                 +P +  LK   F K F     G         E++M  GSGF +   G I+T+NH
Sbjct: 73  QEALAQMPPE--LKGTPFEKQFRDKLRGRR-------EQVMGAGSGFILDPSGIIITNNH 123

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
           +V       V LSD +ELPA+++G D L D+AV+KV + R    V + D++ + VG+ + 
Sbjct: 124 VVGHADRIIVSLSDGSELPARVLGIDDLTDIAVIKVNTSRPLPYVTWGDSHVVEVGDWIL 183

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
             GNPF L G+V+AGIVSA  RDI   P   F Q+DAPIN GNSGGP FN  G V+G+N 
Sbjct: 184 AAGNPFGLGGSVTAGIVSARGRDIGAGPFDDFLQLDAPINPGNSGGPTFNMAGQVVGLNT 243

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
            IV+     +G+G  IP  +    +  L SKG +D GW G+  ++ +Q            
Sbjct: 244 AIVSPTGGSVGIGFAIPAELAAHVVEILRSKGHIDRGWLGVAVEDSSQT--------DMA 295

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G LI +V K  PA ++G++ GD++  ++G  ++S +  +  IA+  P    ++++ ++G 
Sbjct: 296 GVLIASVDKNGPAARSGLRAGDLVEAVNGAAVQSARSLIRAIAAIPPGSTARLTVQRQGR 355

Query: 367 KHSVAVVLGSSPT 379
              + + +G  P 
Sbjct: 356 DVDIEITVGRRPA 368


>gi|301169997|emb|CBW29601.1| serine endoprotease, periplasmic [Haemophilus influenzae 10810]
          Length = 463

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/452 (28%), Positives = 232/452 (51%), Gaps = 31/452 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + ++AL   + S+++ V +A LP        L P++ +V P++V++ VE K KV     F
Sbjct: 8   LNSIALGLSVLSTSF-VAQATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPF 66

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILTSN 126
                 ++PE+   K +F   F + F G      ++       GSG  I    GY+LT+N
Sbjct: 67  ----LDDIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLTNN 116

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+++     +V L D  E  AKLVG D   D+A+++++       ++F D++ +RVG+  
Sbjct: 117 HVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSDKLRVGDFT 176

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIG 243
             IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +IG
Sbjct: 177 VAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGELIG 236

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    + 
Sbjct: 237 INTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVS 296

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++  +
Sbjct: 297 AQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLR 356

Query: 364 EGSKHSVAVVL----GSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE 419
           +G  H V + L    GS  ++K ++        L G  L+D +    K + I  + PN  
Sbjct: 357 DGKSHDVKMKLQADDGSQLSSKTEL------PALDGATLKDYDAKGVKGIEITKIQPN-- 408

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
                +G++ G  I+ +N   +  I+++ +++
Sbjct: 409 SLAAQRGLKSGDIIIGINRQMIENIRELNKVL 440


>gi|190892523|ref|YP_001979065.1| serine protease Do protein [Rhizobium etli CIAT 652]
 gi|190697802|gb|ACE91887.1| serine protease Do protein [Rhizobium etli CIAT 652]
          Length = 572

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/300 (36%), Positives = 167/300 (55%), Gaps = 5/300 (1%)

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           P+  P + +F   F+K   G+ P  +  V  L  GSGF I   GYI+T+NH++E      
Sbjct: 113 PDGSPFQEFFNDFFNKQQGGKGP--NHNVSSL--GSGFVIDPTGYIVTNNHVIEGADDIE 168

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V  ++ ++L AKL+GTD   DL+VLKV+       V+F D++ +R+G+ V  IGNPF   
Sbjct: 169 VNFANGSKLKAKLIGTDTKTDLSVLKVEPKAPLKAVKFGDSSTMRIGDWVMAIGNPFGFG 228

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           G+V+ GI+S   R+I   P   F Q DA IN+GNSGGP FN  G VIG+N  I++     
Sbjct: 229 GSVTVGIISGRGRNINAGPYDNFIQTDAAINKGNSGGPLFNMKGEVIGINTAIISPSGGS 288

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +P  +    +  L   G    GW G+  Q +T ++A  LGL   KG+L+  V+K
Sbjct: 289 IGIGFSVPSELASGVVEQLRQYGETRRGWLGVRIQPVTDDIADSLGLDTAKGALVAGVIK 348

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             P D   +K GDVI   DG+ +   +D    +A  +  ++V + + ++G + +V V LG
Sbjct: 349 GGPVDDGSIKAGDVILKFDGKTVNEMRDLPRVVAESTVGKEVDVVVLRDGKEQTVKVKLG 408


>gi|218532042|ref|YP_002422858.1| protease Do [Methylobacterium chloromethanicum CM4]
 gi|218524345|gb|ACK84930.1| protease Do [Methylobacterium chloromethanicum CM4]
          Length = 496

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/384 (34%), Positives = 202/384 (52%), Gaps = 16/384 (4%)

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGF I+ DGY++T+NH+V+   +  V L D   L AK++G D   D+A+LK+     +  
Sbjct: 121 SGFIISADGYVVTNNHVVDKAKTVQVTLDDGRTLDAKVIGKDPKTDIALLKITESGSYPY 180

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNS 230
           V+F      RVG+ V  IGNPF L GTV+ GIVSA  RDI   P   F QIDAPIN+GNS
Sbjct: 181 VQFGKGAP-RVGDWVLAIGNPFGLGGTVTVGIVSARGRDIGAGPYDDFLQIDAPINKGNS 239

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP FN  G V+GVN  I +     + +G  IP   ++  +  L + G+V  G+ G+  Q
Sbjct: 240 GGPTFNVNGEVVGVNTAIASPSGGSVSLGFAIPAETVQTVVDQLRTDGKVVRGYLGVQVQ 299

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            +T+++A  LGL   KG+L+      +PA KAG+K GDVI  ++G  + + +D    IA 
Sbjct: 300 PVTKDIAEGLGLDKAKGALVNDAESGTPAAKAGLKSGDVIESVNGVPVNNARDLSRLIAG 359

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSP-----TAKNDMHLEVGDKELLGMVLQDINDGN 405
             P  +VK++  + G      V LG+ P     T + D       +  LG+ L   ++  
Sbjct: 360 LKPGTEVKLAYLRGGKSEVATVELGTLPGDSKVTRRGDDAPS--GQARLGLSLAPASEIG 417

Query: 406 KKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +  ++ + +    A+GI +G  I+ V    VS   +V+  I  A+   R +VL++
Sbjct: 418 LGDEGVAVMDVDPDGPAAARGISQGDVILDVAGTSVSKPSEVQAQIRAAESSGRKAVLMR 477

Query: 466 IKYDPDMQSGNDNMSRFVSLKIDK 489
           +K            +RF+++ + K
Sbjct: 478 VKS-------ARGQTRFIAVPLTK 494


>gi|170717515|ref|YP_001784607.1| protease Do [Haemophilus somnus 2336]
 gi|168825644|gb|ACA31015.1| protease Do [Haemophilus somnus 2336]
          Length = 466

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 141/456 (30%), Positives = 236/456 (51%), Gaps = 36/456 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLP-----PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           +  +AL   + + T + ++A LP      S   L P++ +V P++VS+ VE K+K     
Sbjct: 12  LTGIALGLSVLT-TSINVQASLPMAVDEQSLPSLAPMLQKVLPAVVSIAVEGKQK----- 65

Query: 67  MFNAYGFGN-LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFI-TDDGYI 122
             N + F N +PE+      FR+ F   F  E    S    R     GSG  I  + GY+
Sbjct: 66  --NNFSFNNEIPEE------FRRFFGDSFGFEG--FSSRAPRSFRGIGSGVIIDAEKGYV 115

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           LT+NH+++     +V L D  E  AK++G D + D+A++++++ +    V+  D++ +RV
Sbjct: 116 LTNNHVIDQADKITVKLEDGREFKAKVLGKDDMSDIALIQLENPKNLTAVKIADSDKLRV 175

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALG 239
           G+    IGNPF L  T ++GIVSAL R      G +    Q DA +N+GNSGGP  N  G
Sbjct: 176 GDFTVAIGNPFGLGQTATSGIVSALGRSTGFDSGAYENYIQTDAAVNRGNSGGPLVNLNG 235

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            +IG+N  I++    + G+   IP ++    +  +I  G V  G  GI    L   LA  
Sbjct: 236 ELIGINTAIISPSGGNAGIAFAIPSNMAISLVKQIIEFGEVRRGLLGIKGGELNANLAKE 295

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
             +   +G+ ++ V+  S A+KAG++ GDVI  +DG+ + S  +   +IA+    +++K+
Sbjct: 296 FNIDVQQGAFVSEVLPNSAAEKAGLQAGDVITAIDGQKLASFAELRAKIATSGAGKEIKL 355

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL-GMVLQDINDGNKKLVRIVALNPNR 418
           +  ++G   +  V L S      D    VG+  +L G  L + N    K V I  +   +
Sbjct: 356 TYLRDGKSKTAKVKLQSDD---GDTISAVGNISILEGAELSNYNQKGTKGVEIKEV---K 409

Query: 419 EREVEAK-GIQKGMTIVSVNTHEVSCIKDVERLIGK 453
            R + A+ G++KG  I+ VN H+V  + D+ +++GK
Sbjct: 410 SRSLAAQYGLEKGDIIIGVNRHKVENLSDLRKILGK 445


>gi|170728550|ref|YP_001762576.1| protease Do [Shewanella woodyi ATCC 51908]
 gi|169813897|gb|ACA88481.1| protease Do [Shewanella woodyi ATCC 51908]
          Length = 450

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 144/434 (33%), Positives = 228/434 (52%), Gaps = 40/434 (9%)

Query: 40  LPPVIARVSPSIVSVMVEPKKKVSVEQMFNA--YGFG-NLPEDHPLKNYFRKDFHKFFSG 96
           L P++ R +P++V+V VE    VS +++ +A  Y FG N P++   +  FR         
Sbjct: 40  LAPMLERTTPAVVAVAVE-GTHVSKQKLPDAFRYFFGPNAPQEQVQERPFRG-------- 90

Query: 97  EEPILSDTVERLMFGSGFFI-TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
                         GSG  I  + GYI+T+NH+++      + L D  E+ AKL+G DA 
Sbjct: 91  -------------LGSGVIIDANKGYIVTNNHVIDGADEILIGLHDGREVEAKLIGADAE 137

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--D 213
            D+A+L++++ +  + V+  D++ ++VG+    IGNPF L  TV++GIVSA+ R     +
Sbjct: 138 SDIALLQIKA-KNLVAVKRADSDELKVGDFAVAIGNPFGLGQTVTSGIVSAMGRSGLGIE 196

Query: 214 RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
               F Q DA IN GNSGG   N  G +IG+N  IV  G  ++G+G  IP +++   +  
Sbjct: 197 MLENFIQTDAAINSGNSGGALVNLNGDLIGINTAIVAPGGGNVGIGFAIPANMVNNLVDQ 256

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           +I  G V  G  G+  ++LT ELA   GL    G  +  V+++S A+ AG+K GD+I  +
Sbjct: 257 IIEHGEVRRGVLGVSGRDLTSELAQAFGLDTQHGGFVDQVMEDSAAEDAGIKAGDIIVSV 316

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL 393
           +GR IKS Q+   ++A+     +VK  L ++G   +V+  LG +          V    L
Sbjct: 317 NGRKIKSFQELRAKVATMGAGAKVKFGLIRDGDSKTVSATLGEASQTTEASAGAV-HPML 375

Query: 394 LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
            G  L++ +DG    V I  +  N      A G++KG  IV VN    S I D+  L  K
Sbjct: 376 AGAALENGDDG----VEITDIAQN--SPAAASGLRKGDVIVGVNR---SSIDDLNSLKAK 426

Query: 454 AKEKKRDSVLLQIK 467
            KE++  +V L+I+
Sbjct: 427 LKEQQ-GTVALKIQ 439


>gi|329849812|ref|ZP_08264658.1| serine protease MucD [Asticcacaulis biprosthecum C19]
 gi|328841723|gb|EGF91293.1| serine protease MucD [Asticcacaulis biprosthecum C19]
          Length = 522

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 129/383 (33%), Positives = 200/383 (52%), Gaps = 33/383 (8%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPP------SSVDLPPVIARVSPSIVSVMVEPKK 60
           +S  ++  +     ++    L+  A L P      + +    +I RVSP++VS+  E K 
Sbjct: 35  VSAAAMTGIGQAPGLYDGARLIKAADLTPVKPPNGAPMSFADMIERVSPAVVSI--ETKG 92

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           K+ V+ + +  GF                    F G++P      E    GSGFFI+ DG
Sbjct: 93  KIKVDAVPSLPGFS-------------------FPGQDPNSGREQEVRGAGSGFFISADG 133

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y++T+NH+VE  +  +V L++D EL A ++G D   DLAVLKV+  + F  V +E     
Sbjct: 134 YVVTNNHVVEGASEITVKLTNDKELTATVIGRDEATDLAVLKVEG-KDFPFVRWELERKP 192

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT----FTQIDAPINQGNSGGPCFN 236
           RVG+ V  +GNPF    T +AGIVSA  RD+ +  GT    + QIDA IN+GNSGGP F+
Sbjct: 193 RVGDWVVAVGNPFNFSNTATAGIVSAYGRDLRES-GTSYIDYLQIDAAINRGNSGGPTFD 251

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G VIGVN  IVT    + GVG  IP     K    L++  ++  G+ G+    +++E+
Sbjct: 252 LYGKVIGVNTAIVTPSGANAGVGFAIPAETAHKITQQLMTGTKIARGYIGVSILPVSKEI 311

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  L +  T G+ +  + +  PA+KAG+++GD+I  ++G  +KS  D   +IA     E+
Sbjct: 312 AESLNITDTTGAFVAELPRGGPAEKAGLQIGDIIKSINGTAVKSPTDLTRRIADIKAGEK 371

Query: 357 VKISLCKEGSKHSVAVVLGSSPT 379
           V + + + G    V V     P+
Sbjct: 372 VVVEVLRNGQMSKVTVTATLRPS 394


>gi|167035370|ref|YP_001670601.1| protease Do [Pseudomonas putida GB-1]
 gi|166861858|gb|ABZ00266.1| protease Do [Pseudomonas putida GB-1]
          Length = 477

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 141/454 (31%), Positives = 227/454 (50%), Gaps = 29/454 (6%)

Query: 11  SICTVALTCVIFSSTYL---VLEAKLPPSSVDLPPVIARVSPSIVSVMVE---PKKKVSV 64
           SI  +     +F++  +   VL A+   +  D   ++ + SP++V++  +   P ++++ 
Sbjct: 2   SIPRLKSYLTMFAAVLMLGQVLTAQAEEALPDFTSLVEQASPAVVNISTKQKLPDRRIAA 61

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE--EPILSDTVERLMFGSGFFITDDGYI 122
            QM         P+   L   FR+ F +    +   P      E    GSGF I+ DGY+
Sbjct: 62  GQM---------PDLEGLPPMFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYV 112

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIR 181
           LT+NH+V D     V LSD +EL AKLVGTD   D+A+LKV+   K +P V+  D+  ++
Sbjct: 113 LTNNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKVEG--KNLPIVKLGDSEKLK 170

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGH 240
           VGE V  IG+PF    +V+ GIVSA  R +P D    F Q D  IN GNSGGP FN  G 
Sbjct: 171 VGEWVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGE 230

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           V+G+N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   
Sbjct: 231 VVGINSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESF 290

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL    G+L+  V++  PA K G++VGDVI  ++G+ I    D    +      E+ K+ 
Sbjct: 291 GLDKPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGEKAKLE 350

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEV-GDKE----LLGMVLQDINDGNKKLVRI---V 412
           + + G + ++ + +G+ P    D+     G  E     LG+ + D+    KK + +   V
Sbjct: 351 IIRNGKRQNLDISVGALPDDDADIGTGAEGSAERSSNRLGVSVADLTAEQKKSLELKGGV 410

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
            +   ++      G++ G  I  +N   +   K+
Sbjct: 411 VIKEVQDGPAAMIGLRPGDVISHLNNQAIGSAKE 444



 Score = 36.6 bits (83), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+   +LT E    L L   KG ++   V++ PA   G++ GDVI  L+ + I S ++F
Sbjct: 389 LGVSVADLTAEQKKSLEL---KGGVVIKEVQDGPAAMIGLRPGDVISHLNNQAIGSAKEF 445

Query: 345 VWQIASRSPKEQ-VKISLCKEG 365
             +IA   PK + V + + ++G
Sbjct: 446 T-EIAKELPKNRSVSMRVLRQG 466


>gi|261867841|ref|YP_003255763.1| protease DegQ [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413173|gb|ACX82544.1| protease DegQ [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 460

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 136/470 (28%), Positives = 245/470 (52%), Gaps = 44/470 (9%)

Query: 12  ICTVALTCVIFSSTYL-------VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           + ++AL   + S+  L       ++E +  PS   L P++ +V PS+VS+ VE K+K   
Sbjct: 8   LTSIALGLSLLSTPMLSQAEIPAIVEEQQMPS---LAPMLEKVLPSVVSISVEGKQKTRS 64

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFI-TDDGY 121
            Q F+     ++PE+      FR     FF G +    D   R     GSG  I  + GY
Sbjct: 65  AQQFD-----DIPEE------FR-----FFFGPDMFDRDRAPRNFRGIGSGAIINAEKGY 108

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           +LT+NH+++D    +V L D  E  AK++G D L D+A+++++  +    ++  D++ +R
Sbjct: 109 VLTNNHVIKDADKITVQLQDGREFKAKVIGADELSDVALIQIEKPKNLTALKIADSDKLR 168

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG---TFTQIDAPINQGNSGGPCFNAL 238
           VG+    IGNPF L  TV++GIVSAL R      G    + Q DA +N+GNSGGP  N  
Sbjct: 169 VGDFTVAIGNPFGLGQTVTSGIVSALGRSTGSDSGMYENYIQTDAAVNRGNSGGPLINLN 228

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G +IG+N  I++    + G+   IP ++    +  ++  G V  G  GI    L  +LA 
Sbjct: 229 GELIGINTAIISPSGGNAGIAFAIPSNMANNLVQQILEFGEVRRGMLGIKGGELNADLAQ 288

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
              +   KG+ ++ V+  S ADKAG+K GDVI  ++G+ I S  +   +IA+    ++++
Sbjct: 289 AFDIEAKKGAFVSEVIPGSAADKAGLKAGDVITAINGQSISSFAEMRAKIATSGAGKEIE 348

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL-GMVLQDINDGNKKLVRIVALNPN 417
           ++  ++   ++  VVL      ++D  ++     LL  +   ++N+ ++K ++ V++   
Sbjct: 349 LTYLRDSKSNTTKVVL------QSDDKIQTSAGNLLPALDGAELNNYDEKGLKGVSVGKI 402

Query: 418 REREV-EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
           +   + E +G++ G  I+ +N  ++  +  + + +    +KK  +V L I
Sbjct: 403 KTGSLAEQRGLKTGDVIIGINRQKIENLGQLRKEL----DKKPSAVALNI 448


>gi|254490754|ref|ZP_05103937.1| protease Do subfamily [Methylophaga thiooxidans DMS010]
 gi|224463926|gb|EEF80192.1| protease Do subfamily [Methylophaga thiooxydans DMS010]
          Length = 472

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/298 (36%), Positives = 170/298 (57%), Gaps = 6/298 (2%)

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE   + ++F+K    FF G   +     E    GSGF ++DDGYILT++H++ D    
Sbjct: 65  IPEGSGIDDFFKK----FFEGPNGMPPSPRESESLGSGFVLSDDGYILTNHHVIRDAEEI 120

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
            V  SD TE+ A+L+G+D   D+A++KV +      V+  D+N ++VGE V  IG+PF  
Sbjct: 121 IVRFSDRTEMEAELLGSDERSDVALIKVDA-TGLKSVKLGDSNKLKVGEWVLAIGSPFGF 179

Query: 196 RGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
             + +AGIVSAL R +P D    F Q D  IN GNSGGP FN  G VIG+N+ I +    
Sbjct: 180 DYSATAGIVSALGRSLPSDSYVPFIQTDVAINPGNSGGPLFNLKGEVIGINSQIYSRTGG 239

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            MGV   IP+  +   +  +  +G V  GW G++ Q++T+ELA   GL   +G+L++ VV
Sbjct: 240 FMGVSFAIPIDTVMNVVAQIKDQGYVSRGWLGVVIQDVTRELAESFGLNKPRGALVSRVV 299

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
            +SPA  AG K GDVI   DG+ +++  D    +      ++V + + ++  + ++ V
Sbjct: 300 ADSPAAAAGFKAGDVILEFDGKDVEASSDLPPIVGRTMVGKEVDVRIMRDNKRQTLQV 357


>gi|50119263|ref|YP_048430.1| exported protease [Pectobacterium atrosepticum SCRI1043]
 gi|49609789|emb|CAG73223.1| exported protease [Pectobacterium atrosepticum SCRI1043]
          Length = 456

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 137/449 (30%), Positives = 223/449 (49%), Gaps = 34/449 (7%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPP-----SSVDLPPVIARVSPSIVSVMVEPKK--KVSVE 65
             +A++  +  ST     A LP       +  L P++ +V P++VSV VE  +  +  V 
Sbjct: 9   SALAMSIGLTLSTLPAANAALPSVVQGQQTPSLAPMLEKVLPAVVSVHVEGTQVQRQRVP 68

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGYILT 124
           + F  +   N P D        K   + F G              GSG  I    GY+LT
Sbjct: 69  EEFKFFFGPNFPTD--------KQNSRPFEG-------------LGSGVIIDAAKGYVLT 107

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH++ +     V L+D  E  AKL+G D   D+A+L++   +  + V+  D++ +RVG+
Sbjct: 108 NNHVINNADKIRVQLNDGREYDAKLIGRDEQTDIALLQLNDAKNLVSVKMADSDQLRVGD 167

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG--TFTQIDAPINQGNSGGPCFNALGHVI 242
               +GNPF L  T ++GI+SAL R   +  G   F Q DA IN+GNSGG   N  G +I
Sbjct: 168 FAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGALVNLNGELI 227

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N  I+  G  ++G+G  IP ++ +     L+  G V  G  GI    +T E+A    +
Sbjct: 228 GINTAILAPGGGNIGIGFAIPSNMAQNLAQQLVEFGEVKRGLLGIKGSEMTSEMAKAFNV 287

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
              +G+ ++ V+ +S A KAG+K GDV+  LDG+ I S  +   ++ + +P + VKI L 
Sbjct: 288 DAQRGAFVSEVLPKSAASKAGIKAGDVLTTLDGKPISSFAELRAKVGTTAPGKTVKIGLL 347

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREV 422
           ++G    V+VVL +S +A           +   ++   + DG+K  V+I   N  ++   
Sbjct: 348 RDGKPQEVSVVLDNSTSASTSAETLSPSLQGASLINGQLKDGSKG-VQID--NVAKDTPA 404

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
              G+QKG  I+ VN   +  I  + +L+
Sbjct: 405 AQVGLQKGDIIIGVNRERIENITQLRKLL 433


>gi|145636876|ref|ZP_01792541.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae PittHH]
 gi|145269957|gb|EDK09895.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae PittHH]
          Length = 463

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/452 (28%), Positives = 232/452 (51%), Gaps = 31/452 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + ++AL   + S+++ V +A LP        L P++ +V P++V++ VE K KV     F
Sbjct: 8   LNSIALGLSVLSTSF-VAQATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPF 66

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILTSN 126
                 ++PE+   K +F   F + F G      ++       GSG  I    GY+LT+N
Sbjct: 67  ----LDDIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLTNN 116

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+++     +V L D  E  AKLVG D   D+A+++++       ++F D++ +RVG+  
Sbjct: 117 HVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSDKLRVGDFT 176

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIG 243
             IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +IG
Sbjct: 177 VAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGELIG 236

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    + 
Sbjct: 237 INTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVS 296

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++  +
Sbjct: 297 AQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLR 356

Query: 364 EGSKHSVAVVL----GSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE 419
           +G  H V + L    GS  ++K ++        L G  L+D +    K + I  + PN  
Sbjct: 357 DGKSHDVKMKLQADDGSQLSSKTEL------PALDGATLKDYDAKGVKGIEITKIQPN-- 408

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
                +G++ G  I+ +N   +  I+++ +++
Sbjct: 409 SLAAQRGLKSGDIIIGINRQMLENIRELNKVL 440


>gi|89898038|ref|YP_515148.1| DO serine protease [Chlamydophila felis Fe/C-56]
 gi|89331410|dbj|BAE81003.1| DO serine protease [Chlamydophila felis Fe/C-56]
          Length = 488

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 146/442 (33%), Positives = 234/442 (52%), Gaps = 40/442 (9%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-----E 97
           V  + +P +V +   PK    V       G    P D+P  +YF  +F   F G     E
Sbjct: 54  VAEQATPGVVYIESFPKCNRPVNPAPGRRG----PYDNPF-DYFNDEFFNRFFGLPSQKE 108

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
            P+  + V     G+GF ++ DGY++T+NH+VED     V L D  + PAK++G D   D
Sbjct: 109 RPMSKEAVR----GTGFIVSPDGYVVTNNHVVEDAGKIHVTLHDGQKYPAKVIGLDPKTD 164

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD---IPDR 214
           LAV+K+ ++ K   + F +++N++VG+    IGNPF L+ TV+ G++SA  R+   I D 
Sbjct: 165 LAVIKINAN-KLPHLTFGNSDNLKVGDWAIAIGNPFGLQATVTVGVISAKGRNQLHIADF 223

Query: 215 PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q DA IN GNSGGP  N  G VIGVN  IV+    ++G+G  IP  + K+ I  L
Sbjct: 224 E-DFIQTDAAINPGNSGGPLLNIDGEVIGVNTAIVSGSGGYIGIGFAIPSLMAKRIIDQL 282

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           IS G+V  G+ G+  Q +  ELA    L    G+L+T VVK SPA KAG+K  DVI   +
Sbjct: 283 ISDGQVIRGFLGVTLQPIDAELAACYKLDKVYGALVTDVVKGSPAHKAGLKQEDVIIAYN 342

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL 394
           GR ++S   F   I+  +P  +V + + +EG    + V++  +P         V   + +
Sbjct: 343 GREVESLSAFRNAISLMNPNTRVLLKVVREGQVLEIPVIVSQAPQDDG-----VSALQRV 397

Query: 395 GMVLQDINDGNKKLVRIVALNPNRER----EVEA------KGIQKGMTIVSVNTHEVSCI 444
           G+ +Q++   N +  + + + P+ +      VEA       G+  G  I++VN  +VS +
Sbjct: 398 GIRVQNL---NAETAKKLGMAPDSKGVLIVSVEAGSVAGSSGVAPGQLILAVNRQKVSSV 454

Query: 445 KDVERLIGKAKEKKRDSVLLQI 466
           +++  ++   K+   +++LL +
Sbjct: 455 EELNSVL---KDGNNENILLMV 473


>gi|74318109|ref|YP_315849.1| peptidase S1C, Do [Thiobacillus denitrificans ATCC 25259]
 gi|74057604|gb|AAZ98044.1| peptidase S1C, Do [Thiobacillus denitrificans ATCC 25259]
          Length = 464

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/459 (29%), Positives = 228/459 (49%), Gaps = 19/459 (4%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
             +A+T  +F     V EA      VD+  ++ +  P++V++      K   E    A  
Sbjct: 4   AALAMTSFVFVLAAPVAEA------VDVADLVEKQGPAVVNISTTKLVKRGAEGFPFA-- 55

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEP-ILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
              +PED  ++ +FR+ F     G  P   +        GSGF ++ DGYILT+ H+V+ 
Sbjct: 56  ---VPEDPEMQEFFRR-FFPGVPGRAPGAPAQEFPAHGAGSGFIVSSDGYILTNAHVVKG 111

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V L+D  +  AK+VG+D   D+AV+++ + R    V   D   +RVGEAV  IG+
Sbjct: 112 ADEVVVKLTDKRKFIAKVVGSDPRTDVAVIRITA-RNLPAVRLGDPEKLRVGEAVAAIGS 170

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +P      F Q D  +N GNSGGP FN  G V+G+N+ I +
Sbjct: 171 PFGFENSVTAGIVSAKGRSLPSESYVPFIQTDVAVNPGNSGGPLFNMRGEVVGINSQIYS 230

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
               + GV   IP+ I  + +  L + G+V  GW G+M Q ++ +LA   GL   +G+L+
Sbjct: 231 QSGGYQGVAFAIPIDIAMEVVDQLKAGGKVSRGWLGVMIQEVSADLAESFGLDRPRGALV 290

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           + V   SPA +AG++  DVI   +G+ +++  D    + S  P  ++ + + + G   ++
Sbjct: 291 SQVQDGSPAARAGVQTADVILSFNGKPVENSGDLPRIVGSTKPGSKIPMQVWRRGKMQTL 350

Query: 371 AVVLGSSPTAKNDMHLEVGDKELL--GMVLQDINDGNKKLVRI--VALNPNREREVEAKG 426
            VVL   P+ +         K     G+ L ++N   ++ ++I    L      +    G
Sbjct: 351 QVVLAELPSEEQVAGAGKSGKSYSRGGLALSELNPEQRRELKIDHGLLVEEVTGDAARAG 410

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
           I+ G  +++VN   ++ +    + I    + K  ++L++
Sbjct: 411 IRVGDIVLAVNNARIATVDAFRQAIAAIPKGKSAALLVR 449


>gi|126663406|ref|ZP_01734404.1| serine protease precursor [Flavobacteria bacterium BAL38]
 gi|126625064|gb|EAZ95754.1| serine protease precursor [Flavobacteria bacterium BAL38]
          Length = 459

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 192/353 (54%), Gaps = 14/353 (3%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSG  IT+DGYI+T+NH+++D     V L+D+    AKLVGTD+  D+A+LKV +D K  
Sbjct: 99  GSGVIITEDGYIVTNNHVIQDATELEVTLNDNKSYKAKLVGTDSKMDIALLKVDADEKLP 158

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            V F D++ I+VGE V  +GNP+ L  TV+AGIVSA  R++ +    +F Q DA +N GN
Sbjct: 159 YVFFGDSDAIKVGEWVLAVGNPYNLNSTVTAGIVSAKARNLSNNGIQSFIQTDAAVNPGN 218

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGG   N  G ++G+N MI +    + G    +P ++ +K I  L+  G V  G  G+  
Sbjct: 219 SGGALVNTRGELVGINTMISSPTGSYAGYSFAVPSNLTRKIIEDLMQFGNVQRGVLGVEG 278

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
             L    A  LG++ T+G  I  + K S A+KAG+  GD+I  LD + I    +    I 
Sbjct: 279 GELNSNYAKELGIKETQGFYINKITKNSGAEKAGLTKGDIIVQLDDKKINGFAELSAYIN 338

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV 409
           ++ P + +++S+ ++G +  + V L    T K     E+ + E  G+  +DI+  +KK  
Sbjct: 339 TKRPNDIIQVSVLRDGKQKILPVKL----TKK-----EILNYEFNGIEFEDIDASDKKQF 389

Query: 410 RI---VALNP-NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
            I   + +   N     E   I  G  I+S++ ++   ++ V   + K + +K
Sbjct: 390 NIKEGIKIKKVNNPEYAEYSDILDGAVILSIDGNKAKDMETVSSYLAKKENQK 442


>gi|39936550|ref|NP_948826.1| peptidase S1C Do [Rhodopseudomonas palustris CGA009]
 gi|39650406|emb|CAE28929.1| probable serine protease [Rhodopseudomonas palustris CGA009]
          Length = 501

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 144/461 (31%), Positives = 233/461 (50%), Gaps = 38/461 (8%)

Query: 35  PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG--------NLPEDHPLKNYF 86
           P+S   P  IA V+  ++  +V     +S  Q  +A G G         LP   P + +F
Sbjct: 35  PASARGPEGIADVAEKVIDAVVN----ISTTQTVDAKGSGESKGGAAPQLPPGSPFEEFF 90

Query: 87  RKDF--HKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
              F   +   G  P  +++      GSGF I   G ++T+NH++ D    +VIL+D T+
Sbjct: 91  EDFFKNRRGEKGGGPRKTNS-----LGSGFIIDPAGVVVTNNHVIADSDEINVILNDGTK 145

Query: 145 LPAKLVGTDALFDLAVLKVQ--SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
           + A+LVG D   DLAVLK +  + +    V+F D++ +R+GE V  IGNPF L GTV+AG
Sbjct: 146 IKAELVGVDKKTDLAVLKFKPPAGKTLTAVKFGDSDKLRLGEWVIAIGNPFSLGGTVTAG 205

Query: 203 IVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLI 261
           IVSA +RDI   P  ++ Q DA IN+GNSGGP FN  G VIGVN +I++     +G+G  
Sbjct: 206 IVSARNRDINSGPYDSYIQTDAAINRGNSGGPLFNLAGEVIGVNTLIISPSGGSIGIGFA 265

Query: 262 IPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADK 321
           +P   +   +  L   G +  GW G+  Q +T E+A  L ++  +G+L+  V  + PA  
Sbjct: 266 VPSKTVVPVVDQLRQFGELRRGWLGVRIQQVTDEIAESLSIKPARGALVAGVDDKGPAKP 325

Query: 322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-----S 376
           AG++ GDV+   DG+ IK  +D    +A  +  + V + + ++G + +  V LG     +
Sbjct: 326 AGIEPGDVVVKFDGKDIKEPKDLSRIVADTAVGKTVDVVVIRKGKEETKQVTLGRLDDDA 385

Query: 377 SPTAKNDMHLEVGDK----ELLGMVLQDINDGNKKLVRI-------VALNPNREREVEAK 425
            P   +       DK    ++LG+ L  ++   +   +I       +    +   +   K
Sbjct: 386 KPQPASAKSQPEADKPVTQKVLGLDLAALSKDLRGRYKIKDSVKGVLVTGVDDGSDAAEK 445

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
            +  G  IV V    V    D+++ + + K+  + SVLL +
Sbjct: 446 RLSAGDVIVEVAQESVGSAADIKKRVDQLKKDGKKSVLLLV 486


>gi|149203783|ref|ZP_01880752.1| Putative trypsin-like serine protease [Roseovarius sp. TM1035]
 gi|149142900|gb|EDM30942.1| Putative trypsin-like serine protease [Roseovarius sp. TM1035]
          Length = 383

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/336 (33%), Positives = 188/336 (55%), Gaps = 17/336 (5%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF-SGEEPIL 101
           ++A VSP++V + V  K + +          G LPED P +   R+ F +    GE P  
Sbjct: 57  LVAAVSPAVVYIEVTAKSQPTNMS-------GQLPEDLPEE--LRRQFERMMPEGEMP-- 105

Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
                R   GSGF I++DG I+T+NH+VE   + +V L+D     A ++G+D L D+AVL
Sbjct: 106 ----ARQGLGSGFIISEDGKIVTNNHVVEGAETVTVKLADGRAFDATVIGSDPLTDVAVL 161

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQ 220
           ++ ++     V F  ++ +R G+ V  +GNP+ L GTV++GIVSAL R+I   P   + Q
Sbjct: 162 QLDTEEPLPFVRFGKSDTMRAGDEVVAVGNPYGLGGTVTSGIVSALSRNINSGPYDDYIQ 221

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
            DA IN+GNSGGP FN  G VIG+N  I +     +G+G  +P  +++  +  L   G +
Sbjct: 222 TDAAINRGNSGGPLFNNAGEVIGMNTAIFSPDGGSVGIGFAVPSDLVQHIVADLSDDGMI 281

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             GW G+  + + +++A  LG    +G++I  V  +SPA KAG+  GD+I   +   I  
Sbjct: 282 TRGWLGVQIKPMPEDIAQVLGYDTPRGAVIENVTPDSPAAKAGLMQGDIILSFNETAIAE 341

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
            +D    +A+  P+  V +++  +G++ ++ V +G+
Sbjct: 342 LRDLTRAVAATDPEAVVPVTVLHKGTEKTLDVTIGT 377


>gi|285019305|ref|YP_003377016.1| periplasmic protease [Xanthomonas albilineans GPE PC73]
 gi|283474523|emb|CBA17024.1| probable periplasmic protease protein [Xanthomonas albilineans]
          Length = 512

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 150/475 (31%), Positives = 237/475 (49%), Gaps = 56/475 (11%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
           L A LP    D   ++ +V P +V+V     ++ +  +       G +P+D  +  +FR+
Sbjct: 46  LVAGLP----DFTRLVEQVGPGVVNVESTISRRTAATRSD-----GGMPDDDQIPEFFRR 96

Query: 89  DFHKFFS------------GEEPILSDTVE--RLMFGSGFFITDDGYILTSNHIVEDGAS 134
               FF             G  P   D     R M GSGF I+ DGY+LT++H+++  + 
Sbjct: 97  ----FFGPDGIPGMPAQPRGRAPNDDDGAPAGRSM-GSGFIISSDGYVLTNHHVIDGASE 151

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPF 193
             V L+D  E  AK+VG+D  +D+A+LK+  D K +P V   D+N ++ G+ V  IG+PF
Sbjct: 152 VKVKLTDRREFTAKVVGSDQQYDVALLKI--DGKNLPTVRIGDSNLLKPGQWVVAIGSPF 209

Query: 194 RLRGTVSAGIVSALDRDIP---DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
            L  +V+AGIVSA  R  P    R   F Q D  INQGNSGGP  N  G V+G+N+ I +
Sbjct: 210 GLDHSVTAGIVSATGRSNPYADQRYVPFIQTDVAINQGNSGGPLLNTRGEVVGINSQIFS 269

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
           +   +MG+   IP+ +   A   L + G V  G  G+    +    A  LGL  T+G+L+
Sbjct: 270 ASGGYMGISFAIPIDLAMSAAEQLKAHGHVSRGMLGVQVGPIDSLKAQGLGLPDTRGALV 329

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             +   SPA KAG++VGDVI  +DG+ I+S+ D    I    P  +V++S+ ++G    +
Sbjct: 330 NDIPAGSPAAKAGVEVGDVIRSIDGKDIQSYSDLPPMIGLLPPGTKVRLSILRDGKPRDI 389

Query: 371 AVVL---------GSSPTAKNDMHLEVGDKELLGMVLQDINDGNK--------KLVRIVA 413
           +V L         G+     ++     G   LLG+ + D++  ++        K VRI A
Sbjct: 390 SVQLTALADDRTAGARSAGADNTAPAHGANALLGIEVADLDAASRQQLGLEPGKGVRIAA 449

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
           +     R+ +   +  GM I+ V    V  +  + + +  +  KK D V+L I Y
Sbjct: 450 VTGRSARDAQ---LVPGMVILQVGRVPVGSVAALNQQL--SGYKKGDVVMLLISY 499


>gi|218673512|ref|ZP_03523181.1| serine protease Do protein [Rhizobium etli GR56]
          Length = 463

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/300 (36%), Positives = 167/300 (55%), Gaps = 5/300 (1%)

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           P+  P + +F   F+K   G+ P  +  V  L  GSGF I   GYI+T+NH++E      
Sbjct: 4   PDGSPFQEFFNDFFNKQQGGKGP--NHNVSSL--GSGFVIDPTGYIVTNNHVIEGADDIE 59

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V  ++ ++L AKL+GTD   DL+VLKV+       V+F D++ +R+G+ V  IGNPF   
Sbjct: 60  VNFANGSKLKAKLIGTDTKTDLSVLKVEPKTPLKAVKFGDSSEMRIGDWVMAIGNPFGFG 119

Query: 197 GTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           G+V+ GI+S   R+I   P   F Q DA IN+GNSGGP FN  G VIG+N  I++     
Sbjct: 120 GSVTVGIISGRGRNINAGPYDNFIQTDAAINKGNSGGPLFNMKGEVIGINTAIISPSGGS 179

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +P  +    +  L   G    GW G+  Q +T ++A  LGL   KG+L+  V+K
Sbjct: 180 IGIGFSVPSELASGVVEQLREYGETRRGWLGVRIQPVTDDIADSLGLDTAKGALVAGVIK 239

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             P D   +K GDVI   DG+ +   +D    +A  +  ++V + + ++G + +V V LG
Sbjct: 240 GGPVDDGSIKAGDVILKFDGKTVNEMRDLPRVVAESTVGKEVDVVVLRDGKEQTVKVKLG 299


>gi|113460959|ref|YP_719026.1| periplasmic serine protease [Haemophilus somnus 129PT]
 gi|112823002|gb|ABI25091.1| periplasmic serine protease [Haemophilus somnus 129PT]
          Length = 462

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 141/456 (30%), Positives = 236/456 (51%), Gaps = 36/456 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLP-----PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           +  +AL   + + T + ++A LP      S   L P++ +V P++VS+ VE K+K     
Sbjct: 8   LTGIALGLSVLT-TSINVQASLPMAVDGQSLPSLAPMLQKVLPAVVSIAVEGKQK----- 61

Query: 67  MFNAYGFGN-LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFI-TDDGYI 122
             N + F N +PE+      FR+ F   F  E    S    R     GSG  I  + GY+
Sbjct: 62  --NDFSFNNEIPEE------FRRFFGDSFGFEG--FSSRAPRSFRGIGSGVIIDAEKGYV 111

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           LT+NH+++     +V L D  E  AK++G D + D+A++++++ +    V+  D++ +RV
Sbjct: 112 LTNNHVIDQADKITVKLEDGREFKAKVLGKDDMSDIALIQLENPKNLTAVKIADSDKLRV 171

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALG 239
           G+    IGNPF L  T ++GIVSAL R      G +    Q DA +N+GNSGGP  N  G
Sbjct: 172 GDFTVAIGNPFGLGQTATSGIVSALGRSTGFDSGAYENYIQTDAAVNRGNSGGPLVNLNG 231

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            +IG+N  I++    + G+   IP ++    +  +I  G V  G  GI    L   LA  
Sbjct: 232 ELIGINTAIISPSGGNAGIAFAIPSNMAISLVKQIIEFGEVRRGLLGIKGGELNANLAKE 291

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
             +   +G+ ++ V+  S A+KAG++ GDVI  +DG+ + S  +   +IA+    +++K+
Sbjct: 292 FNIDVQQGAFVSEVLPNSAAEKAGLQAGDVITAIDGQKLASFAELRAKIATSGAGKEIKL 351

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL-GMVLQDINDGNKKLVRIVALNPNR 418
           +  ++G   +  V L S      D    VG+  +L G  L + N    K V I  +   +
Sbjct: 352 TYLRDGKSKTAKVKLQSD---DGDTISAVGNISILEGAELSNYNQKGTKGVEIKEV---K 405

Query: 419 EREVEAK-GIQKGMTIVSVNTHEVSCIKDVERLIGK 453
            R + A+ G++KG  I+ VN H+V  + D+ +++GK
Sbjct: 406 SRSLAAQYGLEKGDIIIGVNRHKVENLSDLRKILGK 441


>gi|145633283|ref|ZP_01789014.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae 3655]
 gi|145634409|ref|ZP_01790119.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae PittAA]
 gi|148825850|ref|YP_001290603.1| periplasmic serine protease do/HhoA-like [Haemophilus influenzae
           PittEE]
 gi|229845347|ref|ZP_04465479.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae 6P18H1]
 gi|319896953|ref|YP_004135148.1| periplasmic serine protease do/hhoa-like precursor [Haemophilus
           influenzae F3031]
 gi|144986129|gb|EDJ92719.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae 3655]
 gi|145268389|gb|EDK08383.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae PittAA]
 gi|148716010|gb|ABQ98220.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae PittEE]
 gi|229811800|gb|EEP47497.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae 6P18H1]
 gi|317432457|emb|CBY80812.1| probable periplasmic serine protease do/HhoA-like precursor
           [Haemophilus influenzae F3031]
          Length = 463

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 130/452 (28%), Positives = 232/452 (51%), Gaps = 31/452 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + ++AL   + S++++  +A LP        L P++ +V P++V++ VE K KV     F
Sbjct: 8   LNSIALGLSVLSTSFIA-QATLPSFVSEQNSLAPMLEKVQPAVVTLSVEGKAKVDSRSPF 66

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM-FGSGFFI-TDDGYILTSN 126
                 ++PE+   K +F   F + F G      ++       GSG  I    GY+LT+N
Sbjct: 67  ----LDDIPEE--FKFFFGDRFAEQFGGR----GESKRNFRGLGSGVIINASKGYVLTNN 116

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+++     +V L D  E  AKLVG D   D+A+++++       ++F D++ +RVG+  
Sbjct: 117 HVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSDKLRVGDFT 176

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT---QIDAPINQGNSGGPCFNALGHVIG 243
             IGNPF L  TV++GIVSAL R      GT+    Q DA +N+GNSGG   N  G +IG
Sbjct: 177 VAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGNSGGALVNLNGELIG 236

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  I++    + G+   IP +     +  ++  G+V  G  GI    L  +LA    + 
Sbjct: 237 INTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVS 296

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+ ++ V+ +S A+KAG+K GD+I  ++G+ I S  +   +IA+    +++ ++  +
Sbjct: 297 AQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLR 356

Query: 364 EGSKHSVAVVL----GSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE 419
           +G  H V + L    GS  ++K ++        L G  L+D +    K + I  + PN  
Sbjct: 357 DGKSHDVKMKLQADDGSQLSSKTEL------PALDGATLKDYDAKGVKGIEITKIQPN-- 408

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
                +G++ G  I+ +N   +  I+++ +++
Sbjct: 409 SLAAQRGLKSGDIIIGINRQMIENIRELNKVL 440


>gi|24375430|ref|NP_719473.1| serine protease [Shewanella oneidensis MR-1]
 gi|24350274|gb|AAN56917.1|AE015826_2 serine protease, HtrA/DegQ/DegS family [Shewanella oneidensis MR-1]
          Length = 450

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 146/456 (32%), Positives = 230/456 (50%), Gaps = 49/456 (10%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPS----SV-DLPPVIARVSPSIVSVMVEPK--KKVS 63
           S+ + A+     +    V +A +P S    S+  L P++ R +P++VSV V      K  
Sbjct: 6   SVLSAAMLAATLTMMPAVSQAAIPQSVEGQSIPSLAPMLERTTPAVVSVAVSGTHVSKQR 65

Query: 64  VEQMFNAYGFG-NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI-TDDGY 121
           V  +F  Y FG N P++   +  FR                       GSG  I  D GY
Sbjct: 66  VPDVFR-YFFGPNAPQEQVQERPFRG---------------------LGSGVIIDADKGY 103

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+++      V L D  E+ AKL+GTD+  D+A+L++++ +  + ++  D++ +R
Sbjct: 104 IVTNNHVIDGADDIQVGLHDGREVKAKLIGTDSESDIALLQIEA-KNLVAIKTSDSDELR 162

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALG 239
           VG+    IGNPF L  TV++GIVSAL R     +    F Q DA IN GNSGG   N  G
Sbjct: 163 VGDFAVAIGNPFGLGQTVTSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLKG 222

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            +IG+N  IV     ++G+G  IP +++K  I  +   G V  G  GI  ++L  +LA  
Sbjct: 223 ELIGINTAIVAPNGGNVGIGFAIPANMVKNLIAQIAEHGEVRRGVLGIAGRDLDSQLAQG 282

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL    G  +  V   S A+KAG+K GD+I  +DGR IKS Q+   ++A+     +V++
Sbjct: 283 FGLDTQHGGFVNEVSAGSAAEKAGIKAGDIIVSVDGRAIKSFQELRAKVATMGAGAKVEL 342

Query: 360 SLCKEGSKHSVAVVLG----SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALN 415
            L ++G K +V V LG    ++  A   +H       L G  L++ + G  ++  +   +
Sbjct: 343 GLIRDGDKKTVNVTLGEANQTTEKAAGAVH-----PMLQGASLENASKG-VEITDVAQGS 396

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           P         G+QKG  IV +N   V  +K ++ L+
Sbjct: 397 P-----AAMSGLQKGDLIVGINRTAVKDLKSLKELL 427


>gi|146281611|ref|YP_001171764.1| serine protease MucD precursor [Pseudomonas stutzeri A1501]
 gi|145569816|gb|ABP78922.1| serine protease MucD precursor [Pseudomonas stutzeri A1501]
 gi|327479790|gb|AEA83100.1| serine protease MucD precursor [Pseudomonas stutzeri DSM 4166]
          Length = 473

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/377 (33%), Positives = 197/377 (52%), Gaps = 17/377 (4%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-- 96
           D  P++   SP++V++    K+KV             +PE   L   FR+ F +      
Sbjct: 31  DFTPLVENASPAVVNIST--KQKVPTRG-----ATAQIPELEGLPPIFREFFERSIPQMP 83

Query: 97  EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
             P      E    GSGF I+DDGY+LT+NH+V       V L D +EL AKL+G D   
Sbjct: 84  GAPGQGQQREAQSLGSGFIISDDGYVLTNNHVVAGADEIIVRLPDRSELEAKLIGADPRS 143

Query: 157 DLAVLKVQSDRKFIP-VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
           D+AVLKV+   K +P V+   ++ ++ GE V  IG+PF    TV+AGIVSA  R +P+  
Sbjct: 144 DVAVLKVEG--KGLPTVKIGRSDELKAGEWVLAIGSPFGFDHTVTAGIVSATGRSLPNES 201

Query: 216 GT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q D  IN GNSGGP FN  G VIG+N+ I T     MG+   IP+ +       L
Sbjct: 202 YVPFIQTDVAINPGNSGGPLFNLKGEVIGINSQIFTRSGGFMGLSFAIPIDVAMDVANQL 261

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
            + G+V+ GW G++ Q + ++LA   GL    G+L+  V+   PA ++G++VGDVI  L+
Sbjct: 262 RTDGKVNRGWLGVVIQEVNKDLAESFGLERPAGALVAQVMDGGPAARSGLRVGDVILSLN 321

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE-- 392
           G+ I    D    + +  P  + ++ + ++G + ++ V +G+ P     +    G +E  
Sbjct: 322 GKPIVMSADLPHLVGALKPGSKARMEVVRDGDRKTLDVSIGAMPEEGEAVAASGGGQERS 381

Query: 393 --LLGMVLQDINDGNKK 407
              LG+ + ++ +  KK
Sbjct: 382 DNRLGVKVTELTEEQKK 398


>gi|328952747|ref|YP_004370081.1| protease Do [Desulfobacca acetoxidans DSM 11109]
 gi|328453071|gb|AEB08900.1| protease Do [Desulfobacca acetoxidans DSM 11109]
          Length = 483

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 151/484 (31%), Positives = 241/484 (49%), Gaps = 33/484 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAK----LPPSSVDLPPVIARVSPSIVSVMV 56
           M  RQ+ ++  I  +A    I + T L + A     L P S  +  +  ++SP++V++  
Sbjct: 1   MLTRQLHAI-LILILAFGGFIATPTLLAVPAAAQGTLAPDSFAV--LAKQISPAVVNIST 57

Query: 57  EP--KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGF 114
           E   K+     +M    G      D P K++F K     F G+ P      +    G+GF
Sbjct: 58  EKVMKRSTPTRRMPGMPGPSPFGPDDPFKDFFEK-----FFGDMP---KEFKSRSLGTGF 109

Query: 115 FITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV-E 173
            +  +G+I+T+NH+VE      V L D  E  A + G DA+ D+A++K++S    +PV  
Sbjct: 110 ILDREGFIITNNHVVEGADKIKVKLVDGREFKANIKGRDAMTDMALIKIESPTHDLPVLV 169

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGG 232
             D++ ++VG+ V  +GNPF L  TV+ GI+SA  R I   P   F Q DA IN GNSGG
Sbjct: 170 MGDSDPVQVGDWVLAVGNPFGLSHTVTQGIISAKGRVIGAGPYDDFLQTDASINPGNSGG 229

Query: 233 PCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNL 292
           P  N  G VIG+N  IV SGQ   G+G  IP S+ K  I  L  KG V  G  G+  Q +
Sbjct: 230 PLVNLKGEVIGINTAIVASGQ---GIGFAIPSSMAKGIIAQLKQKGSVTRGILGVQIQTV 286

Query: 293 TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRS 352
           T ELA   GL+   G+L+  V   +PA KAG++ GDVI   +G +IK   +    +A  +
Sbjct: 287 TPELAKSFGLKEPVGALVAEVNPNTPAAKAGIQRGDVIIEYNGHVIKEMHELPRLVAHTA 346

Query: 353 PKEQVKISLCKEGSKHSVAVVLGS---SPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV 409
           P  +V + + ++G + +  + +        A++ M     +K  LG+++Q++     +  
Sbjct: 347 PGTKVNLKVLRQGKEKNFGLTIAEMKPEHLARSGMVEPETEKSSLGLLVQELTPQMAQRF 406

Query: 410 RI------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
           +I      + +   +       GI+ G  I  +N+  +  +KD    I  ++ K  D+V 
Sbjct: 407 QIKETSGVIVVQVEQGSPASDSGIRPGDLIEEINSVAIQSLKDYHASI--SQLKAGDAVR 464

Query: 464 LQIK 467
           + IK
Sbjct: 465 ILIK 468



 Score = 42.7 bits (99), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 47/88 (53%)

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G++ Q LT ++A    ++ T G ++  V + SPA  +G++ GD+I  ++   I+S +D+
Sbjct: 391 LGLLVQELTPQMAQRFQIKETSGVIVVQVEQGSPASDSGIRPGDLIEEINSVAIQSLKDY 450

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAV 372
              I+     + V+I + + G    V V
Sbjct: 451 HASISQLKAGDAVRILIKRRGKTMYVVV 478


>gi|296536400|ref|ZP_06898501.1| periplasmic serine protease, Do [Roseomonas cervicalis ATCC 49957]
 gi|296263269|gb|EFH09793.1| periplasmic serine protease, Do [Roseomonas cervicalis ATCC 49957]
          Length = 361

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/271 (40%), Positives = 160/271 (59%), Gaps = 4/271 (1%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I   GYI+T+NH+V +     V L + TELPA++VGTD L DLA+L+V+S     
Sbjct: 93  GSGFIIDPAGYIVTNNHVVGNAVRVVVSLQNGTELPARVVGTDELTDLALLRVESRTPLP 152

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGN 229
            V +  + N+RVG  V   GNPF L GTV++GIVSA  R+I   P   F Q DA IN GN
Sbjct: 153 AVAWGSSANLRVGAWVLAAGNPFSLGGTVTSGIVSARGREIGAGPFDDFIQTDAAINPGN 212

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP FN  G VIG+N  I +      G+G   P  + +  I  L   GRV+ GW G+  
Sbjct: 213 SGGPLFNTAGEVIGINTAIYSPSGASAGIGFATPSDLARGVIDQLKRDGRVERGWLGVAV 272

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           ++L +E A+P G    +G  + +V + SPA +AG++ GDV+  L+G  I++ +  +  +A
Sbjct: 273 EDLGEE-AVPGGR--NRGVQVRSVERNSPAARAGLRPGDVVTALNGERIETSRALIRSVA 329

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
              P + V++SL ++G    +AV +G  P+ 
Sbjct: 330 GTPPGQTVRLSLTRDGRSRDMAVQVGRRPSG 360


>gi|258543852|ref|ZP_05704086.1| S1C (protease Do) subfamily peptidase MucD [Cardiobacterium hominis
           ATCC 15826]
 gi|258520892|gb|EEV89751.1| S1C (protease Do) subfamily peptidase MucD [Cardiobacterium hominis
           ATCC 15826]
          Length = 465

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 144/433 (33%), Positives = 221/433 (51%), Gaps = 34/433 (7%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   ++A+   ++VS+ VE   +VS     N +     PE           F  FF   E
Sbjct: 35  DFTALVAKTKDAVVSIEVE--SRVSAPSTINGF----PPEI----------FEDFFGFPE 78

Query: 99  PI----LSDTVERLMFG--SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
           P      +   +R++ G  SGF I  DGYILT+ H+VE      V L+++ E  A ++G 
Sbjct: 79  PFGQQFEAPREQRILQGQGSGFIIDSDGYILTNAHVVEGAEKVRVQLNNNKEYNADVIGL 138

Query: 153 DALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI 211
           D   D+A++K+Q D   +PV +  D++ ++VG+ V  IG+PF    T + GIVSA+ R++
Sbjct: 139 DKRTDVALVKIQGDH--LPVAKIGDSDQVQVGDWVLAIGSPFGFSHTATQGIVSAVARNL 196

Query: 212 PDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT-SGQFHMGVGLIIPLSIIKK 269
           P      F Q DA IN GNSGGP FN+ G VI +N+ I + SG F+ G+   IP+++ K 
Sbjct: 197 PSGDYVPFIQTDAAINPGNSGGPLFNSKGEVIAINSQIYSRSGAFN-GLAFSIPINMAKN 255

Query: 270 AIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDV 329
               L  KG V  GW G+  Q L Q LA   G+   +G+L+ +V + SPA KAG++ GDV
Sbjct: 256 IADQLKDKGEVVRGWLGVRIQGLDQTLAESFGMEKPQGALVASVEENSPAAKAGIENGDV 315

Query: 330 ICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG 389
           I   +G+ +    D    +AS    E+V+I L ++G + +V   +G+      D      
Sbjct: 316 ILQYNGKAVSKSADLPAYVASTPIGEKVEIKLLRDGKEETVKAEIGNLNDVSGDGKASAS 375

Query: 390 DKELLGMVLQDIN----DGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
            + L    L++ +    D   K VRI  + P      E  G++ G  I++V    V   K
Sbjct: 376 IRGLSLGTLENEDREALDYRGKGVRISGVKPG--SAAEKSGLRAGDIIIAVGGKRVEDPK 433

Query: 446 DVERLIGKAKEKK 458
             +RL+ KA  K+
Sbjct: 434 TAQRLLEKANSKR 446


>gi|260222372|emb|CBA31870.1| hypothetical protein Csp_D29280 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 472

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 135/439 (30%), Positives = 216/439 (49%), Gaps = 22/439 (5%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   ++ R  P++V++ V   + VS        G G   +D      F + F + F    
Sbjct: 31  DFTQIVKRYGPAVVNISVTGTRLVSAGGKDAPKGSGPEADDSDAMQSFLRKFQEQFGATG 90

Query: 99  PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
              S TV     GSGF ++ DG +LT+ H+V   +  +V L+D  E PA+++G D   D+
Sbjct: 91  --ASMTVPVRGLGSGFIVSGDGLVLTNAHVVAHASEVTVKLTDRREFPARILGVDTKTDM 148

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT- 217
           AVLK+++ +    V       + VGE V  IG+PF L  TV+ G+VSA  R +PD     
Sbjct: 149 AVLKIEA-QHLPTVTIGSPTELNVGEWVLAIGSPFGLDNTVTTGVVSAKARTLPDDYTVP 207

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F Q DA IN GNSGGP FNA G V+G+N+ I T    + G+   IP+ + +     +++ 
Sbjct: 208 FIQTDAAINPGNSGGPLFNARGEVVGINSQIFTRSGGYQGLSFAIPIDLAQSVARQIVAT 267

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           G   HG  G+  Q +TQ LA  L L    G+L++ V   S A KAG++ GDVI  +DG  
Sbjct: 268 GHAAHGVLGVSAQEVTQALATALHLSKPAGALLSEVHAGSAAAKAGLQFGDVIVGIDGHA 327

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL-----------GSSPTAKNDMHL 386
           I++  D    IA   P +++++   + G   +    L           G+ P +     L
Sbjct: 328 IETSSDLPLWIAMAVPGQKIRVDYLRNGKAQNTIATLEAPAAALTAKAGNLPDSPILAPL 387

Query: 387 EVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
            +  + LL +  +  +     LV  VA  P+ +      GI+ G  ++++N   ++ ++ 
Sbjct: 388 GIAVRNLLPLEQRAADTKTGLLVDAVAEGPSTK-----AGIEPGDILLAINQTPLTSVEQ 442

Query: 447 VERLIGKAKEKKRDSVLLQ 465
             +L+ KA   K  +VL+Q
Sbjct: 443 ARQLLAKA--GKSVAVLVQ 459


>gi|297182923|gb|ADI19072.1| trypsin-like serine proteases, typically periplasmic, contain
           C-terminal pdz domain-protein [uncultured delta
           proteobacterium HF0070_15B21]
          Length = 476

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 132/423 (31%), Positives = 222/423 (52%), Gaps = 24/423 (5%)

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM---FGSGFFITDDGYILTSNHIVEDGA 133
           P ++P   Y  + F +FF G +P      +       GSG  I+ +GYILT++H+V +  
Sbjct: 64  PLNNPYDLYNEEFFKRFFPGIKPPERQPGQPFRQEGMGSGTIISQEGYILTNHHVVGEAD 123

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
              V L D  E+ AK+VGTD   D+AV+K++ D  +  +   ++  + VGE+V  +GNPF
Sbjct: 124 QILVKLYDGKEVRAKIVGTDPESDIAVIKIEGD-GYSALTIGNSKELMVGESVIAVGNPF 182

Query: 194 RLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
            L  TV+ GIVSA  R     +    F Q DA IN GNSGGP  N  G ++GVN+ I + 
Sbjct: 183 GLTQTVTYGIVSAKGRTNVGINEYENFIQTDAAINPGNSGGPLVNLRGEIVGVNSAIYSR 242

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
              + G+G  +P+++ ++ +  LI+KG V  GW G+  Q++TQ+LA    L   KGSLIT
Sbjct: 243 NGGYQGIGFAVPINMAQRIMDDLINKGTVSRGWLGVGIQDVTQDLAQAFNLENAKGSLIT 302

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V++++PAD+ G++ GDV+  L+G  I + + F  +IA+      +++ + +        
Sbjct: 303 GVMRDTPADRGGLQRGDVVIELNGEEILNSRQFRNEIANAGAGSDIEMKVVRNSKIMYFK 362

Query: 372 VVLGSSPT--AKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVE------ 423
           + L   P    +  M  +   + + G  + +I   +   + + + N    REV+      
Sbjct: 363 IKLDERPKELGRVSMKPDKSKENVFGFSVTNITQDDVNKLNLESSNGVLIREVKPGSLAS 422

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
            +G+  GM I  +N   +  + D  +++ ++  +K   +LL I  D     GN   +R+V
Sbjct: 423 KEGLAAGMVIQEINRRPIKSVSDFNQIMTESSPEK--GILLLIVSD-----GN---ARYV 472

Query: 484 SLK 486
           +LK
Sbjct: 473 NLK 475


>gi|254785333|ref|YP_003072762.1| serine protease HtrA/DegQ/DegS family [Teredinibacter turnerae
           T7901]
 gi|237686184|gb|ACR13448.1| serine protease, HtrA/DegQ/DegS family [Teredinibacter turnerae
           T7901]
          Length = 465

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 144/453 (31%), Positives = 225/453 (49%), Gaps = 39/453 (8%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           + TVAL   + +++Y      LP    D  P+I + SP++V +    K + S  +     
Sbjct: 12  VLTVALAIDVNAASY-----NLP----DFRPLIEKTSPAVVKINTTTKARQSEIE----- 57

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
               LP  H + + FR   H      EP      E    GSGFFI+ DGY+LT+NH+VED
Sbjct: 58  ----LPPGHQIPDIFR---HLL----EPRDLPRREMHSMGSGFFISADGYLLTNNHVVED 106

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V L D  E  A ++G D   DLA+LKV  D K   +E    ++I++GE V  IG+
Sbjct: 107 ADQIVVRLVDRREYKAIVIGRDPRSDLALLKVDED-KLPYLELAAKDDIQIGEWVVAIGS 165

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPGT----FTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           PF L  + SAGIVSA+ R IP         F Q D  IN GNSGGP FN  G V+GVN+ 
Sbjct: 166 PFGLDFSASAGIVSAIGRSIPTERNENYVPFIQTDVAINPGNSGGPLFNLDGKVVGVNSQ 225

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I T     +G+   IP S+    +  L  KGRVD GW G++ Q + ++LA   GL+   G
Sbjct: 226 IYTRSGGSIGLSFAIPSSVALNVVSQLKEKGRVDRGWLGVVIQEVDKDLADSFGLKKPAG 285

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+  +    PA  +G+ VGD+I   D + I S  D    + +  P  +V + + ++G +
Sbjct: 286 ALVAQLEPTGPAAMSGLLVGDIILRFDDQEILSSGDLPHAVGATPPDTEVPVLVMRKGKR 345

Query: 368 HSVAVVLGSSPTAKNDMHLEV---GD--KELLGMVLQDINDGNKKLVRIVA----LNPNR 418
            ++ V +G     ++D   +V   G+   + LG+V++ ++   ++   +V        + 
Sbjct: 346 KTLDVKVGRLSGHESDAPAQVLADGNVVTDRLGLVVEPVDATVEEKWHLVGGVLVTQVDP 405

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           +      GI  G  I  +   +++ + D  R++
Sbjct: 406 QGAAADAGISPGDVIAQLGFEQIATVDDYTRVM 438


>gi|260551492|ref|ZP_05825676.1| peptidase S1C [Acinetobacter sp. RUH2624]
 gi|260405486|gb|EEW98979.1| peptidase S1C [Acinetobacter sp. RUH2624]
          Length = 476

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/422 (29%), Positives = 212/422 (50%), Gaps = 26/422 (6%)

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   ++ +VSP++VSV V  K                + +D  L+    +   +FF  + 
Sbjct: 45  DFSNLVEQVSPAVVSVNVVKK----------------MTQDELLQQQVPEILKRFFGNQV 88

Query: 99  --PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
             P      E+  +GS FFI+ DGY+LT++H++E+ +  S+ L+D  E+ A +VG+D   
Sbjct: 89  IIPQQQGPQEKTAYGSAFFISKDGYLLTNHHVIENASRISITLNDRREIDATVVGSDERT 148

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG 216
           D+A+LKV  +  +  ++  + + +RVGE V  IG+PF    + SAGIVSA  R++     
Sbjct: 149 DVALLKVNGN-NYPALKVGNVDRLRVGEPVLAIGSPFGFDYSASAGIVSAKSRNMSGETS 207

Query: 217 T-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q D  +N GNSGGP FN  G V+GVN+ I +    +MG+   IP+ +       L 
Sbjct: 208 VPFIQTDVALNPGNSGGPLFNQNGEVVGVNSRIFSGTGGYMGLSFSIPIDVAMDVAEQLK 267

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
           +KG+V   + G+M Q++ + LA    L   +G+LIT V   SPA KAG++ GDVI  L+G
Sbjct: 268 TKGKVTRSYLGVMMQDIDRNLADAYKLPKPEGALITQVTPNSPAQKAGLRAGDVILKLNG 327

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP--TAKNDMHLEVGDKEL 393
             +    D ++ +    P + V+  + ++    +++  L ++P  T             +
Sbjct: 328 ASVLRTSDLLYALNKVQPNQTVQFEVLRDDKTRNISATLATAPDETPATGTQASTSKGPV 387

Query: 394 LGMVLQDINDGNKKLVR----IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
           LGM ++D+ +  K  +     I   +  R        I  G  IV VN  ++   +D  +
Sbjct: 388 LGMSIRDLAEPEKNALSVKGGIYVQDVRRGGLASLSNIIPGDVIVQVNNTQILNSQDFAK 447

Query: 450 LI 451
           ++
Sbjct: 448 VV 449


>gi|262278191|ref|ZP_06055976.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258542|gb|EEY77275.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 476

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 129/458 (28%), Positives = 230/458 (50%), Gaps = 27/458 (5%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           +R I+    + T  L   ++++ + V   +   ++VD   ++ +VSP++VSV V  K   
Sbjct: 10  RRPIVGEHQMKTRYLQQGMYAAVFTVAAVQ-ANATVDFSNLVEQVSPAVVSVNVVKK--- 65

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDG 120
                        + +D  L+    +   +FF  +   P      E+  +GS FFI+ DG
Sbjct: 66  -------------MTQDELLQQQVPEILKRFFGNQVIIPQQQGPQEKTAYGSAFFISKDG 112

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y+LT++H++E+ +  S+ L+D  E+ A +VG+D   D+A+LKV  +  +  ++  + + +
Sbjct: 113 YLLTNHHVIENASRISITLNDRREIDATVVGSDERTDVALLKVTGN-SYPALKVGNVDRL 171

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
           RVGE V  IG+PF    + SAGIVSA  R++       F Q D  +N GNSGGP FN  G
Sbjct: 172 RVGEPVLAIGSPFGFDYSASAGIVSAKSRNMSGETSIPFIQTDVALNPGNSGGPLFNQNG 231

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+GVN+ I +    +MG+   IP+ +       L +KG+V   + G+M Q++ + LA  
Sbjct: 232 EVVGVNSRIFSGTGGYMGLSFSIPIDVAMDVAEQLKTKGKVTRSYLGVMMQDIDRNLADA 291

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
             L   +G+LIT +   SPA KAG++ GDVI   +G  +    + ++ +    P + ++ 
Sbjct: 292 YKLPKPEGALITQISPNSPAQKAGLRAGDVILKYNGNPVSRTSELLYALNKVQPNQTIQF 351

Query: 360 SLCKEGSKHSVAVVLGSSP--TAKNDMHLEVGDKELLGMVLQDINDGNKKLVR----IVA 413
            + ++    +++  L ++P  T        V    +LGM ++D+ +  K  +     I  
Sbjct: 352 EVLRDDKTRNISATLTTAPDETPATGAQSAVSKGPVLGMSIRDLAEPEKSALSVKGGIYV 411

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
            +  R        I  G  IV VN +++   +D  +++
Sbjct: 412 QDVRRGGLASLSNIIPGDVIVQVNNNQILNSQDFAKVV 449


>gi|114328154|ref|YP_745311.1| endopeptidase degP [Granulibacter bethesdensis CGDNIH1]
 gi|114316328|gb|ABI62388.1| endopeptidase degP [Granulibacter bethesdensis CGDNIH1]
          Length = 525

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 142/449 (31%), Positives = 221/449 (49%), Gaps = 56/449 (12%)

Query: 75  NLPEDHPLKNYFRKDFHKF------FSGEEPILSDTVERLMFGSGFFI-TDDGYILTSNH 127
             P   P + +FR   ++         GEE            GSGF +   +G ++T+NH
Sbjct: 96  QFPPGSPFEKFFRDFMNRHPLPGQPHGGEE---GAPRRAQSLGSGFIVDAKEGIVVTNNH 152

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS--DRKFIPVEFEDANNIRVGEA 185
           +++     +VIL D+T L AK++G D   D+AVL+V S  D+    V+F D++  RVG+ 
Sbjct: 153 VIDGADEITVILQDNTPLKAKVLGRDERLDIAVLQVTSPKDKPLTAVQFGDSDKERVGDW 212

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  IGNPF L G+V+AGIVSA  RDI   P   F Q DA IN+GNSGGP FN  G VIG+
Sbjct: 213 VLAIGNPFGLGGSVTAGIVSARGRDIHQGPYDDFIQTDAAINRGNSGGPLFNMDGQVIGI 272

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I +     +G+G  IP  + +  +  +   GR   GW G+  Q +T E+A  LGL+ 
Sbjct: 273 NTAIYSPSGGSIGIGFAIPSKLAQNVVDQIRKFGRARRGWLGVRIQQVTPEIAESLGLKE 332

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
           T G++I  V +  PADKA ++ GD+I   + + +K        +A     E V + + + 
Sbjct: 333 TNGAMIAGVNEGGPADKAHLQNGDIILKFNNQDVKDMHSLPRIVAETPIDETVPVVVWRG 392

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGDKELLG------MVLQDINDGNKKLVRIVALNPN- 417
           G + ++   +G  P   +D+     +K   G      +V++++       V + AL+P  
Sbjct: 393 GKRVTLDARVGEMP---DDVKQAAAEKAKPGSHDSAQLVIRELG------VTVAALSPEV 443

Query: 418 RER-------------------EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           RE                      E +G++ G  IV V    V+  KD+ + +   +++ 
Sbjct: 444 REHFNLQGDQKGVVIANIASGSAAEQRGLKPGDIIVEVQQEPVAAPKDITQRLEAVRKQG 503

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           R SVLL I+       G D + R+V L +
Sbjct: 504 RKSVLLLIQ-------GQDGL-RWVPLPL 524


>gi|91774617|ref|YP_544373.1| peptidase S1 and S6, chymotrypsin/Hap [Methylobacillus flagellatus
           KT]
 gi|91708604|gb|ABE48532.1| peptidase S1 and S6, chymotrypsin/Hap [Methylobacillus flagellatus
           KT]
          Length = 396

 Score =  201 bits (510), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 187/336 (55%), Gaps = 22/336 (6%)

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPL-KNYFRKDFHKFFSGEEPILSDTVER 107
           PS+V++    K + S+         GN   D PL +++F   ++++ S  E  L      
Sbjct: 75  PSVVNIFTSKKTRQSI---------GNPFLDDPLFRHFFGDQWNEYPSQRENSL------ 119

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSG  +   G ILT++H+++      V L D    PA++VGTD   DLAVLK+   R
Sbjct: 120 ---GSGVIVNSQGLILTNHHVIDGADEIEVALPDGRTFPARIVGTDPETDLAVLKINV-R 175

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPI 225
               + F  +NNI VG+ V  IGNPF +  TV+ GI+SAL R     +    F Q DAPI
Sbjct: 176 NLPAITFAQSNNISVGDVVLAIGNPFGVGQTVTQGIISALGRSHLGINTFENFIQTDAPI 235

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N GNSGG   +  G+++G+N+ I +     MG+G  IP+S+ K+ +  +I +G V  GW 
Sbjct: 236 NPGNSGGALIDTEGNLVGINSAIYSRSGGSMGIGFAIPVSLAKQVMEQIIRQGSVIRGWI 295

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           GI  Q++T ELA    L+  +GSL+  VV+ SPADKAG++ GD++  +DGR +      +
Sbjct: 296 GIEAQDITPELAESFRLKQARGSLVAGVVRGSPADKAGLRPGDILLEIDGREVTDSSTML 355

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK 381
             I++  P+++V + + +  ++  + +V+G  PT +
Sbjct: 356 NVISNLKPEKKVLVKIARNQTELVLPIVIGKRPTPQ 391


>gi|146297785|ref|YP_001192376.1| protease Do [Flavobacterium johnsoniae UW101]
 gi|146152203|gb|ABQ03057.1| peptidase, subfamily S1B unassigned peptidases [Flavobacterium
           johnsoniae UW101]
          Length = 466

 Score =  201 bits (510), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 196/351 (55%), Gaps = 16/351 (4%)

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171