PSIBLAST alignment of GI: 254780700 and protein with PDB id: 1be9

>gi|3891677|pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119
>gi|3891685|pdb|1BFE|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 Length = 119
 Score = 52.1 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 37/105 (35%), Gaps = 5/105 (4%)

Query: 378 PTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKG-IQKGMTIVSV 436
                +    V  +   G+    I   + +   I           +  G ++KG  I+SV
Sbjct: 9   EDIPREPRRIVIHRGSTGLGFNIIGGEDGE--GIFISFILAGGPADLSGELRKGDQILSV 66

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSR 481
           N  ++      +  I  A +    +V +  +Y P+  S  +  SR
Sbjct: 67  NGVDLRNASHEQAAI--ALKNAGQTVTIIAQYKPEEYSRFEANSR 109