PSIBLAST alignment of GI: 254780700 and protein with PDB id: 1soz

>gi|49259100|pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314
>gi|49259101|pdb|1SOZ|B Chain B, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314
 Score = 62.5 bits (149), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 90/350 (25%), Positives = 145/350 (41%), Gaps = 43/350 (12%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           +       + R +P++V+V        S  Q+                            
Sbjct: 2   TPASYNLAVRRAAPAVVNVYNRGLNTNSHNQL---------------------------- 33

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
                     E    GSG  +   GYI+T+ H++ D     V L D     A LVG+D+L
Sbjct: 34  ----------EIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSL 83

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI--PD 213
            DLAVLK+ +      +         +G+ V  IGNP+ L  T++ GI+SA  R    P 
Sbjct: 84  TDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPT 143

Query: 214 RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVG---LIIPLSIIKKA 270
               F Q DA IN GNSGG   N+LG ++G+N +                 IP  +  K 
Sbjct: 144 GRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKI 203

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
           +  LI  GRV  G+ GI  + +    A   G+   +G ++  V  + PA  AG++V D+I
Sbjct: 204 MDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLI 263

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
             +D +   S  + + Q+A   P   + + + ++  + ++ V +   P  
Sbjct: 264 ISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT 313