PSIBLAST alignment of GI: 254780700 and protein with PDB id: 1te0

>gi|56966065|pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318
>gi|56966066|pdb|1TE0|B Chain B, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318
 Score = 59.8 bits (142), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 89/351 (25%), Positives = 145/351 (41%), Gaps = 43/351 (12%)

Query: 35  PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF 94
            +       + R +P++V+V        S  Q+                           
Sbjct: 6   ETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQL--------------------------- 38

Query: 95  SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
                      E    GSG  +   GYI+T+ H++ D     V L D     A LVG+D+
Sbjct: 39  -----------EIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDS 87

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI--P 212
           L DLAVL +++      +         +G+ V  IGNP+ L  T++ GI+SA  R    P
Sbjct: 88  LTDLAVLIIKATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNP 147

Query: 213 DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVG---LIIPLSIIKK 269
                F Q DA IN GNSGG   N+LG ++G+N +                 IP  +  K
Sbjct: 148 TGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATK 207

Query: 270 AIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDV 329
            +  LI  GRV  G+ GI  + +    A   G+   +G ++  V  + PA  AG++V D+
Sbjct: 208 IMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDL 267

Query: 330 ICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
           I  +D +   S  + + Q+A   P   + + + ++  + ++ V +   P  
Sbjct: 268 IISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT 318