PSIBLAST alignment of GI: 254780700 and protein with PDB id: 1te0

>gi|56966065|pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318
>gi|56966066|pdb|1TE0|B Chain B, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318
 Score = 55.9 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/113 (13%), Positives = 34/113 (30%), Gaps = 5/113 (4%)

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIND---GNKKLVRIVALNPNRERE 421
           G      +          D  +  G   + G  +  ++    G  +L  IV    + +  
Sbjct: 197 GFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGP 256

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
               GIQ    I+SV+        +    + + +      + + +  D    +
Sbjct: 257 AANAGIQVNDLIISVDNKPAISALETMDQVAEIRPG--SVIPVVVMRDDKQLT 307