PSIBLAST alignment of GI: 254780700 and protein with PDB id: 2ocs

>gi|126031518|pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (Slc9a3r2) Length = 88
 Score = 51.7 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 21/65 (32%), Gaps = 5/65 (7%)

Query: 404 GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEV--SCIKDVERLIGKAKEKKRDS 461
           G K                EA  ++ G  +V VN   V       V + I   + + R  
Sbjct: 20  GEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTR-- 77

Query: 462 VLLQI 466
            LL +
Sbjct: 78  -LLVV 81