PSIBLAST alignment of GI: 254780700 and protein with PDB id: 2w4f

>gi|217035285|pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97
 Score = 59.0 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/84 (13%), Positives = 28/84 (33%), Gaps = 5/84 (5%)

Query: 394 LGMVLQD---INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
           LG+ +               I     + E      G++ G  ++ VN   +   +  E +
Sbjct: 16  LGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAV 75

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQS 474
             +A      +V +++  + +   
Sbjct: 76  --EALRGAGTAVQMRVWRERETSV 97