PSIBLAST alignment of GI: 254780700 and protein with PDB id: 3gcn

>gi|226192717|pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY Dfp In Complex With Omp Peptide (Yqf) Length = 340
>gi|226192719|pdb|3GCO|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP In Complex With Dnrdgnvyqf Omp Peptide Length = 340
 Score = 55.9 bits (132), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/113 (13%), Positives = 34/113 (30%), Gaps = 5/113 (4%)

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIND---GNKKLVRIVALNPNRERE 421
           G      +          D  +  G   + G  +  ++    G  +L  IV    + +  
Sbjct: 218 GFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGP 277

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
               GIQ    I+SV+        +    + + +      + + +  D    +
Sbjct: 278 AANAGIQVNDLIISVDNKPAISALETMAQVAEIRPG--SVIPVVVMRDDKQLT 328