PSIBLAST alignment of GI: 254780700 and protein with PDB id: 3lgi

>gi|304445857|pdb|3LGI|A Chain A, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237
>gi|304445858|pdb|3LGI|B Chain B, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237
 Score = 59.0 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 66/225 (29%), Positives = 94/225 (41%), Gaps = 42/225 (18%)

Query: 23  SSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPL 82
            ST         P+S +L   + R +P++V+V        S  Q+               
Sbjct: 7   LSTPQFDSTDETPASYNLA--VRRAAPAVVNVYNRGLNTNSHNQL--------------- 49

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
                                  E    GSG  +   GYI+T+ H++ D     V L D 
Sbjct: 50  -----------------------EIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDG 86

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
               A LVG+D+L DLAVLK+ +      +         +G+ V  IGNP+ L  T++ G
Sbjct: 87  RVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQG 146

Query: 203 IVSALDRDI--PDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVN 245
           I+SA  R    P     F Q DA IN GNSGG   N+LG ++G+N
Sbjct: 147 IISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGIN 191