PSIBLAST alignment of GI: 254780700 and protein with PDB id: 3lh1

>gi|304445873|pdb|3LH1|A Chain A, Q191a Mutant Of The Degs-Deltapdz Length = 241
 Score = 58.6 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 65/225 (28%), Positives = 93/225 (41%), Gaps = 42/225 (18%)

Query: 23  SSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPL 82
            ST         P+S +L   + R +P++V+V        S  Q+               
Sbjct: 17  LSTPQFDSTDETPASYNLA--VRRAAPAVVNVYNRGLNTNSHNQL--------------- 59

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
                                  E    GSG  +   GYI+T+ H++ D     V L D 
Sbjct: 60  -----------------------EIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDG 96

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
               A LVG+D+L DLAVLK+ +      +         +G+ V  IGNP+ L  T++ G
Sbjct: 97  RVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQG 156

Query: 203 IVSALDRDI--PDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVN 245
           I+SA  R    P     F   DA IN GNSGG   N+LG ++G+N
Sbjct: 157 IISATGRIGLNPTGRQNFLATDASINHGNSGGALVNSLGELMGIN 201