PSIBLAST alignment of GI: 254780700 and protein with PDB id: 3mh4

>gi|299856795|pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456
>gi|299856796|pdb|3MH4|B Chain B, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456
 Score =  183 bits (463), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 124/455 (27%), Positives = 212/455 (46%), Gaps = 17/455 (3%)

Query: 26  YLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNY 85
                A        L P++ +V PS+VS+ VE    V+  +M   +      +D P    
Sbjct: 1   AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQ-QFFGDDSPFCQE 59

Query: 86  FRKDFHKFF---SGEEPILSDTVERLMFGSGFFITDD-GYILTSNHIVEDGASFSVILSD 141
                   F              + +  GSG  I  D GY++T+NH+V++     V LSD
Sbjct: 60  GSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSD 119

Query: 142 DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
             +  AK+VG D   D+A++++Q+ +    ++  D++ +RVG+    IGNPF L  TV++
Sbjct: 120 GRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTS 179

Query: 202 GIVSALDRDIPD--RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVG 259
           GIVSAL R   +      F Q DA IN+GN+GG   N  G +IG+N  I+     ++G+G
Sbjct: 180 GIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIG 239

Query: 260 LIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPA 319
             IP +++K     ++  G+V  G  GIM   L  ELA  + +   +G+ ++ V+  S A
Sbjct: 240 FAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSA 299

Query: 320 DKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT 379
            KAG+K GDVI  L+G+ I S      Q+ +     ++ + L ++G + +V + L    +
Sbjct: 300 AKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQ--S 357

Query: 380 AKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTH 439
           ++N +        + G  + +      K   +V  N          G++KG  I+  N  
Sbjct: 358 SQNQVDSSSIFNGIEGAEMSN----KGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQ 413

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
            V  I ++ +++    + K   + L I+       
Sbjct: 414 AVKNIAELRKVL----DSKPSVLALNIQRGDSTIY 444