BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780700|ref|YP_003065113.1| serine protease DO-like
protease [Candidatus Liberibacter asiaticus str. psy62]
         (489 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780700|ref|YP_003065113.1| serine protease DO-like protease [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040377|gb|ACT57173.1| serine protease DO-like protease [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 489

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 489/489 (100%), Positives = 489/489 (100%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK
Sbjct: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG
Sbjct: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI
Sbjct: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
           RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH
Sbjct: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL
Sbjct: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS
Sbjct: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER 420
           LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER
Sbjct: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER 420

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
           EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS
Sbjct: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480

Query: 481 RFVSLKIDK 489
           RFVSLKIDK
Sbjct: 481 RFVSLKIDK 489


>gi|114766775|ref|ZP_01445712.1| periplasmic serine protease, DO/DeqQ family protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114541032|gb|EAU44089.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. HTCC2601]
          Length = 494

 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 146/494 (29%), Positives = 244/494 (49%), Gaps = 35/494 (7%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           ++     A++  +  S  L+  A+  P       +  R+SP++V++              
Sbjct: 19  LRLFWLAAVSMFLIVSQTLMASAQNAPE--SFAKLAERISPAVVNITTSTTVAGRTGPQ- 75

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                G +PE  P +++FR+   +     +            GSGF I++DGYI+T+NH+
Sbjct: 76  -----GIVPEGSPFEDFFREFQDRNGGPGDRP----RRSSALGSGFVISEDGYIVTNNHV 126

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           +E      +   +   LPA+LVGTD   D+A+LKV++D     V F +++N RVG+ V  
Sbjct: 127 IEGADEIEIEFFEGFTLPAELVGTDPNTDIALLKVEADEALKFVSFGNSDNARVGDWVMA 186

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I
Sbjct: 187 MGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAI 246

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           ++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  LGL  T+G+
Sbjct: 247 LSPNGGSIGIGFSMASNVVTKVVDQLKEFGETRRGWLGVRIQDVTEDMAEALGLASTEGA 306

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           +++  V E PA +AGM+ GDVI   DGR ++  +  V  + +    + V++ + + G+  
Sbjct: 307 MVSD-VPEGPAMEAGMQAGDVIVSFDGREVQDTRQLVRIVGNTEVGKSVRVVVNRNGNTE 365

Query: 369 SVAVVLGSS-------PTAKNDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVAL 414
           ++ V LG         P ++     E  + EL+G+ L  +    +  +        +   
Sbjct: 366 TLKVTLGRREEAERTYPASQEMTPEEPAESELMGLTLSPLTQELRDEMGLQSSATGLAVT 425

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
             +   E   KG++ G  I      EV  I ++E  I +AKE  R S+LL ++   D   
Sbjct: 426 GVDETSEAFEKGLRAGDIITEAGQAEVLSISELETKIEEAKEAGRKSILLLVRRGGD--- 482

Query: 475 GNDNMSRFVSLKID 488
                 RFV+L +D
Sbjct: 483 -----PRFVALSLD 491


>gi|149912789|ref|ZP_01901323.1| possible serine protease [Roseobacter sp. AzwK-3b]
 gi|149813195|gb|EDM73021.1| possible serine protease [Roseobacter sp. AzwK-3b]
          Length = 490

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 145/497 (29%), Positives = 249/497 (50%), Gaps = 40/497 (8%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM 67
           +++++   ALT  +  +  LV  A+          +  RVSP++V++             
Sbjct: 15  ALRALWLTALTMALIVAQALVALAR----PESFADLADRVSPAVVNITTSTVV------A 64

Query: 68  FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNH 127
             A     +PE  P +++FR+   +   G+ P           GSGF I++DG+++T+NH
Sbjct: 65  EGAGPSPIVPEGSPFEDFFREFRDRNGDGDRP-----RRSSALGSGFVISEDGFVVTNNH 119

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
           ++E      +      EL A+++GTD   D+A+LKV++D+    V F D++  RVG+ V 
Sbjct: 120 VIEAADEIIIEFFSGEELVAEVIGTDPKTDIALLKVKADQPLAFVTFGDSDTARVGDWVM 179

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
            +GNP     + SAGIVSA +R +      + Q DA IN+GNSGGP FN    VIGVN  
Sbjct: 180 AMGNPLGQGFSASAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDAQVIGVNTA 239

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I++     +G+G  +  +++ + I  L   G    GW G+  Q++T+++A  +GL   +G
Sbjct: 240 ILSPTGGSIGIGFSMASNVVTRVIDQLKEYGETRRGWLGVRIQDVTEDVAEAMGLEEVRG 299

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+T  V E PA +AGM+ GDVI   DG  +   +  V Q+ +    + V++++ +EG  
Sbjct: 300 ALVTD-VPEGPASEAGMQAGDVILSFDGTQVNDTRGLVRQVGNTEVGKAVRVTVFREGKT 358

Query: 368 HSVAVVLGSSPTAK---------NDMHLEVGDKELLGMVLQDINDGNKKLV-------RI 411
            ++ V LG    A+          D   E  ++E++G+ +  ++D  +  +        +
Sbjct: 359 QTLKVTLGRREVAEGAVPTAQPGPDTPAEPSEQEMMGLTISPLDDELRGQLDLGSDVTGL 418

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V  + +   E   KG++ G  I       V+ I D+E  I +A++  R S+LL I+   +
Sbjct: 419 VVTDVDDLSEAYEKGVRAGDLITEAGQQNVASISDLEDRISEARDAGRKSILLLIRRSGE 478

Query: 472 MQSGNDNMSRFVSLKID 488
                    RFV+L ID
Sbjct: 479 --------PRFVALPID 487


>gi|84500011|ref|ZP_00998277.1| periplasmic serine protease, DO/DeqQ family protein [Oceanicola
           batsensis HTCC2597]
 gi|84391945|gb|EAQ04213.1| periplasmic serine protease, DO/DeqQ family protein [Oceanicola
           batsensis HTCC2597]
          Length = 475

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 143/498 (28%), Positives = 248/498 (49%), Gaps = 38/498 (7%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE 65
           +LS +++ T+ L  ++     +   A+          +  R SPS+V++           
Sbjct: 1   MLSPRALWTLMLATLLVLVQAVQAMAR----PESFADLADRFSPSVVNITTSTMV----- 51

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTS 125
                 G   +PE  P +++FR+   +      P           GSGF I++DGYI+T+
Sbjct: 52  -AGREQGSPIVPEGSPFEDFFREFQDRNRGDRAP-----RRSSALGSGFVISEDGYIVTN 105

Query: 126 NHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
           NH++      ++   +  EL A+LVGTD   D+A+LKV++D     V F D++  RVG+ 
Sbjct: 106 NHVISGADEITIEFFNGEELDAELVGTDEKTDIALLKVETDEPLPYVNFGDSDLARVGDW 165

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVN 245
           V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN
Sbjct: 166 VVAMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNLDGEVIGVN 225

Query: 246 AMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGT 305
             I++     +G+G  +  +++K  +  L   G    GW G+  Q++T+++A  +GL   
Sbjct: 226 TAILSPTGGSIGIGFSMASNVVKGVVDQLKEYGETRRGWLGVRIQDVTEDMADAMGLEEV 285

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           +G++++  V E PA +AGMK GDVI   DG  ++  +  V Q+ +    + V++++ ++G
Sbjct: 286 RGAMVSD-VPEGPAMEAGMKAGDVITSFDGVDVEDTRGLVRQVGNTQVGKTVRVTVWRDG 344

Query: 366 SKHSVAVVLGSSPTAKNDMHL-------EVGDKELLGMVLQDINDGNKKLV-------RI 411
              ++ V LG    A+            E  +K+L+GM L  + +     +        +
Sbjct: 345 ETETLRVTLGRREEAEAQAVPAAQPGGDEPMEKDLMGMSLSAVTEDLAGQLGLDADAEGL 404

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V  + ++  +   KG++ G  I      +++ I D+E  +  A++  R S+LL I+ + +
Sbjct: 405 VVRDVDQASDAYEKGLRAGDLITEAGQQQIATIGDLEERVAAARDAGRKSILLLIRREGE 464

Query: 472 MQSGNDNMSRFVSLKIDK 489
                    RFV+L I +
Sbjct: 465 --------PRFVALPISE 474


>gi|260427244|ref|ZP_05781223.1| protease Do subfamily [Citreicella sp. SE45]
 gi|260421736|gb|EEX14987.1| protease Do subfamily [Citreicella sp. SE45]
          Length = 492

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 142/495 (28%), Positives = 242/495 (48%), Gaps = 34/495 (6%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           ++      L+  +  S  L+  A+  P       +  +VSPS+V++              
Sbjct: 16  LRLFWLATLSMFMIVSQALMASAQGAPQ--SFSVLAEKVSPSVVNITTSTMVAGRTGPQ- 72

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                G +PE  P +++FR+   +      P           GSGF I++DGYI+T+NH+
Sbjct: 73  -----GIVPEGSPFEDFFREFQDRNGG---PGEDRPRRSSALGSGFVISEDGYIVTNNHV 124

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           +E      +   +   LPA LVGTD   D+A+LKV++D     V F +++N +VG+ V  
Sbjct: 125 IEGADEIEIEFFEGFSLPATLVGTDPNTDIALLKVEADSPLKFVSFGNSDNAKVGDWVMA 184

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I
Sbjct: 185 MGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMNGEVIGVNTAI 244

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           ++     +G+G  +  +++ K +  L   G    GW G+  Q++T ++   LGL   +G+
Sbjct: 245 LSPNGGSIGIGFSMASNVVTKVVDQLREFGETRRGWLGVRIQDVTDDMVEALGLASAEGA 304

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L++  V + PA  +GM+ GDVI   DG+ ++  +  V  + +    + V++ + + G+  
Sbjct: 305 LVSD-VPDGPAKDSGMQAGDVITSFDGKEVQDTRQLVRIVGNTDVGKSVRVVVNRNGNSE 363

Query: 369 SVAVVLGSS-------PTAKNDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVAL 414
           ++ V LG         P ++     E    EL+G+ L  +    ++ +        +  +
Sbjct: 364 TLLVTLGRREDAETTFPASQEVTPGEPSQSELMGLTLSPLTQDLREELSLPDSAKGLAVV 423

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           N +   E   KG+++G  I      EV  I D+E  + +A++  R S+LL I+   D   
Sbjct: 424 NVDESSEAFEKGLRQGDVITEAGQSEVLSISDLETKVDEARDAGRKSLLLLIRRGGD--- 480

Query: 475 GNDNMSRFVSLKIDK 489
                 RFV+L +++
Sbjct: 481 -----PRFVALSLEE 490


>gi|126729291|ref|ZP_01745105.1| periplasmic serine protease, DO/DeqQ family protein [Sagittula
           stellata E-37]
 gi|126710281|gb|EBA09333.1| periplasmic serine protease, DO/DeqQ family protein [Sagittula
           stellata E-37]
          Length = 483

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 148/504 (29%), Positives = 247/504 (49%), Gaps = 37/504 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M +     ++     AL+ V+  S  L+ +A+  P       +  RVSP++V++      
Sbjct: 1   MTREDATPLRLFWLTALSMVLILSQSLMAQARGAPE--SFAELAERVSPAVVNITTSTTV 58

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
                        G +PE  P +++FR+   +   G  P           GSGF I++DG
Sbjct: 59  AGRTGPQ------GVVPEGSPFEDFFREFQDRNGQGNRP-----RRSSALGSGFVISEDG 107

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YI+T+NH++E      +   +  +LPA LVGTD   D+AVLKV++D     V F D+N  
Sbjct: 108 YIVTNNHVIEGADEIMIEFFEGFDLPATLVGTDPNTDIAVLKVEADEPLKYVNFGDSNIA 167

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
           RVG+ V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G 
Sbjct: 168 RVGDWVMAMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGE 227

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVN  I++     +G+G  +  +++ + +  L   G    GW G+  Q++T++LA  L
Sbjct: 228 VIGVNTAILSPNGGSIGIGFSMASNVVTRVVDQLKEFGETRRGWLGVRIQDVTEDLAEGL 287

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL   KG+L++  V E PA +AGM+ GDVI   DG  +   +  V  +A+    + V++ 
Sbjct: 288 GLEQAKGALVSD-VPEGPAMEAGMEAGDVIVTFDGTEVVDTRQLVRIVANTPVGKTVRVV 346

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVG--------DKELLGMVLQDINDGNKKLV--- 409
           + ++G   ++ V L     A+  +             + E LG+ L  + D  +  +   
Sbjct: 347 VNRDGETKTLKVTLSRREEAEGAIPAAAAGPDAAEPQELETLGLTLSPLTDELRAELEVP 406

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +  +  +   +   KG++ G  +       V+ + D+E  I +A+++ R S+LL 
Sbjct: 407 EGTDGLAVMAVDEASQAFEKGLRAGDVVTEAGQSAVTSVTDLEDRITEARDEGRKSILLL 466

Query: 466 IKYDPDMQSGNDNMSRFVSLKIDK 489
           ++   D         RFV+L +++
Sbjct: 467 VRRGGD--------PRFVALGLEE 482


>gi|294677924|ref|YP_003578539.1| protease Do [Rhodobacter capsulatus SB 1003]
 gi|294476744|gb|ADE86132.1| protease Do [Rhodobacter capsulatus SB 1003]
          Length = 496

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 137/496 (27%), Positives = 230/496 (46%), Gaps = 36/496 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           +  V L+  +  S   +  A+  P       ++ +V P++V +           +M    
Sbjct: 18  LMAVLLSTALALSPLAMTPAQAGPVPESFADLVVQVKPAVVMITTSTTVSEPAGRM---- 73

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
                P   P + +F++          P           GSGF I+ DGYI+T+NH+++ 
Sbjct: 74  --PGFPPGSPFEEFFKEFGMPNMPQGGPQRQH--RADALGSGFVISADGYIVTNNHVIKG 129

Query: 132 ------GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
                     S+  ++  +L AK+VGTD   D+A+LKV+S      V F D++ +R G+ 
Sbjct: 130 EDGNTVADEISIEFANGKKLDAKIVGTDPKTDIALLKVESKEPLPFVSFGDSDTMREGDW 189

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVN 245
           V  +GNP     + S GIVSA +R++    G + Q DA IN+GNSGGP F+  G VIGVN
Sbjct: 190 VMAMGNPLGQGFSTSVGIVSARNRELSGTYGDYIQTDAAINRGNSGGPLFSMDGKVIGVN 249

Query: 246 AMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGT 305
             I++     +G+G  +  +++ K +  L   G    GW G+  Q+LT ++A  + L   
Sbjct: 250 TAILSPNGGSIGIGFSMASNVVSKVVGQLQEFGATRRGWLGVKIQDLTPDMAEAMSLATP 309

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           +G++++  V E PA  AGMK GDVI    G  +K  +    ++A     + V + + + G
Sbjct: 310 EGAMVSE-VPEGPAKVAGMKSGDVIISFAGAPVKDTKSLTRRVADAPVGQAVDVVVMRAG 368

Query: 366 SKHSVAVVLGSSPTAKNDMHLEVGDKE------LLGMVLQDINDGNKKL-------VRIV 412
              ++ V LG    A++      G         +LGMVL  I D  +           ++
Sbjct: 369 KPVTLQVTLGQRELAESSEAAAGGTAPALAGGAVLGMVLSPITDAMRAERNLPEDLTGLM 428

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
             + +       KG++ G  IV      V+ + D++  + +AKE  R SVLL I+ + + 
Sbjct: 429 VTDIDATGAAFDKGLRAGDVIVEAGQQPVTSLDDLKARVAEAKEGGRKSVLLLIRREGE- 487

Query: 473 QSGNDNMSRFVSLKID 488
                   RFV++ + 
Sbjct: 488 -------PRFVAVPLQ 496


>gi|119384123|ref|YP_915179.1| protease Do [Paracoccus denitrificans PD1222]
 gi|119373890|gb|ABL69483.1| protease Do [Paracoccus denitrificans PD1222]
          Length = 514

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 144/528 (27%), Positives = 229/528 (43%), Gaps = 56/528 (10%)

Query: 1   MFK---RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSV------------------- 38
           M +   R  L+  S+  +      F+       A+    +                    
Sbjct: 1   MNRPSSRHFLTASSLALLMALTPAFAQEPATPGAEAAQEAANSNEPLTAPDSQARQQQVM 60

Query: 39  --DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
                 ++ +VSP++V++         + +         LPE  P  + FR+     F  
Sbjct: 61  PESFADLVEKVSPAVVNITTTSTVSTPLAR------GPQLPEGSPFSDLFREFGFPGFPP 114

Query: 97  E-----EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVG 151
                 +            GSGF I+ DG I+T+NH+++      V       LPA+++G
Sbjct: 115 GEGNPFQRGPQREQRSNALGSGFVISPDGLIVTNNHVIDGADEIEVEFFSGKRLPAQVIG 174

Query: 152 TDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI 211
            D   D+AVLKV+SD     V+F D++  RVG+ V  +GNP     + S GIVSA +R +
Sbjct: 175 KDDKTDVAVLKVESDDPLPFVKFGDSDRARVGDWVLALGNPLGQGFSASTGIVSARNRAL 234

Query: 212 PDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
                 F Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++ K +
Sbjct: 235 SGTYDDFIQTDAAINRGNSGGPLFNLDGEVIGVNTAILSPNGGSIGIGFSMASNVVSKVV 294

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             L   G    GW G+  Q +T ++A  LGL   KG+++T  V   PA  AGMK GDVI 
Sbjct: 295 EQLEEFGETRRGWLGVKIQPVTDDIAESLGLSEAKGAMVTD-VPAGPAADAGMKAGDVIT 353

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND-----MHL 386
             DG  +K  +D V ++A     E V + + +EG    + V LG    A+          
Sbjct: 354 SFDGGEVKYPRDLVRRVADAPVGEAVAVVVQREGEPVELQVTLGRRELAEGTGSGKVSSA 413

Query: 387 EVGDKELLGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTH 439
           E    +++GM L  +       + +       V  + +       KG+  G  I      
Sbjct: 414 EETASDVMGMTLAPLTPEIAAELGVSRDMQGLVVQSVDPSGAAADKGLVAGDVITEAGQQ 473

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            V+ + D+E  I +A+E  R S+L+ ++   +         RFV+L +
Sbjct: 474 PVATLADLEGRIKEAREAGRKSILVMVRRAGE--------PRFVALPV 513


>gi|260575476|ref|ZP_05843475.1| protease Do [Rhodobacter sp. SW2]
 gi|259022396|gb|EEW25693.1| protease Do [Rhodobacter sp. SW2]
          Length = 493

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 147/490 (30%), Positives = 247/490 (50%), Gaps = 32/490 (6%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
             +ALT  I  +   V +A           +  ++SPS+V++                  
Sbjct: 22  LFLALTLGIGLALAQVSQAVAQTMPDSFADLAEKISPSVVNITTSSVV------AGGMGD 75

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
              LP+  P +++F+    +  +G     ++       GSGF +++DG+I+T+NH++E  
Sbjct: 76  GPTLPDGSPFQDFFKDFMDRNGNG---GPAEPRRSEALGSGFVVSEDGFIVTNNHVIEGA 132

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
               +       L AKLVGTD   D+A+LKV+SD+    V F D++ +RVG+ V  +GNP
Sbjct: 133 DDIEIEFFSGDRLKAKLVGTDTKTDIALLKVESDKPLPFVTFGDSDLMRVGDWVVAMGNP 192

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
                +VSAGIVSA +R I      F Q DA IN+GNSGGP FN  G V+GVN  I++  
Sbjct: 193 LGQGFSVSAGIVSARNRAISGAFDDFIQTDAAINRGNSGGPLFNMDGQVVGVNTAIMSPN 252

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              +G+G  +  +++   +  L   G    GW G+  Q++T ++A  +GL  +KG+LIT 
Sbjct: 253 GGSIGIGFSMASNVVSDVVDQLREFGETRRGWLGVRIQDVTPDVAEAMGLTASKGALITD 312

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
            V + PA  AGM  GDVI   DG+ +   +D V ++A     + V + + +EG+  +++V
Sbjct: 313 -VPDGPAKDAGMLSGDVIVTFDGKEVADTRDLVRRVAGAPVGQAVSVVVLREGASQTLSV 371

Query: 373 VLGSSPTAKNDM-------HLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNR 418
            LG   TA+ +          E    ELLG+ + +++  + + +        +V  + + 
Sbjct: 372 TLGRRETAEGEETVTPAATPAEPAKGELLGLTVAELSPSDAEGLGLPKGSEGLVITDVDV 431

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
             E   KG+++G  I      +V  ++D++  + +AK+  R S+LL I+ D D       
Sbjct: 432 NAEAYEKGLRQGDLITEAGQQKVLKVQDLKDRVTEAKDAGRKSLLLLIRRDGD------- 484

Query: 479 MSRFVSLKID 488
             RFV+L ++
Sbjct: 485 -PRFVALSLE 493


>gi|83312591|ref|YP_422855.1| trypsin-like serine protease [Magnetospirillum magneticum AMB-1]
 gi|82947432|dbj|BAE52296.1| Trypsin-like serine protease [Magnetospirillum magneticum AMB-1]
          Length = 503

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 146/514 (28%), Positives = 234/514 (45%), Gaps = 40/514 (7%)

Query: 1   MF--KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
           MF  +R          +    VI         A  PP       +  R+ P++V++    
Sbjct: 1   MFIARRDPSLAALRRLIGALAVIALLVPGSSRAGAPPG--GFADLAERLLPAVVNISTTQ 58

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
             K S             P   PL+ +F++   +   G+ P      +    GSGF I  
Sbjct: 59  TMKPSQ----GGPELPQFPPGSPLEEFFKEFMERQQGGKSPDAPS-RKATSLGSGFIIDA 113

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDA 177
            GYI+T+NH++ D    SV L DDT   A LVG D   DLA+LK++   +  +PV F ++
Sbjct: 114 AGYIVTNNHVIADADEISVKLHDDTVFQATLVGRDPKVDLALLKIEPGKKPLVPVPFGNS 173

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFN 236
           ++ RVG+ V  IGNPF   GTV+AGIVSA  RDI   P   F Q DA IN+GNSGGP FN
Sbjct: 174 DDARVGDWVLAIGNPFGFGGTVTAGIVSARARDINAGPYDDFLQTDAAINRGNSGGPMFN 233

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G VIG+N+ I++     +G+G  +P S+    +  L   G+V  GW GI  Q+L  ++
Sbjct: 234 MRGEVIGINSAIISPSGGSIGIGFAVPASLAVPVLDDLRKFGKVRRGWLGIRIQSLDTDM 293

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  +GL   KG+L+  V    P  KAG+K GDV+   DG+ I   +     +AS    ++
Sbjct: 294 AENIGLPDQKGALVAKVDPNGPGVKAGLKDGDVVLKFDGKDITEMRRLPRYVASTPIGKK 353

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD--------------KELLGMVLQDIN 402
           V++ + ++G + ++   +G  P    +  ++                     G+ +    
Sbjct: 354 VEVVIWRDGKRQTITASVGEMPEDPAEQQVKGKPETPKPQAGKDGILTIPGAGLTVSSPT 413

Query: 403 DGNKKLVR-------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
              ++          IV      +     KG++ G  I+  +   V    D+ +LI + +
Sbjct: 414 PQLRERFGLDDEAKGIVVTEVKPDSPAAEKGMRPGDMIIEADHKPVRSPADLGKLIEEGR 473

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
                S+LL+++        N    R+++L + +
Sbjct: 474 RAGAKSLLLRVE--------NPQQLRYIALPLAE 499


>gi|77463926|ref|YP_353430.1| serine protease [Rhodobacter sphaeroides 2.4.1]
 gi|221639783|ref|YP_002526045.1| protease Do [Rhodobacter sphaeroides KD131]
 gi|77388344|gb|ABA79529.1| possible serine protease [Rhodobacter sphaeroides 2.4.1]
 gi|221160564|gb|ACM01544.1| Protease Do precursor [Rhodobacter sphaeroides KD131]
          Length = 493

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 141/472 (29%), Positives = 231/472 (48%), Gaps = 35/472 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK 92
              +      +  ++SP++V++          +          +PE  P +++FR     
Sbjct: 42  AQNAPASFAGLAEKISPAVVNITTSTVVAAPTQNS------PLVPEGSPFEDFFRDFMDP 95

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
              GE P           GSGF I++DGYI+T+NH++E      +      +L AKLVGT
Sbjct: 96  QNRGEGP-----RRSEALGSGFVISEDGYIVTNNHVIEGADDIQIEFFSGKKLEAKLVGT 150

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   D+A+LKV  ++    V F +++  RVG+ V  +GNP     +VSAGIVSA +R + 
Sbjct: 151 DPKTDIALLKVDGNQPLPFVSFGNSDLARVGDWVVAMGNPLGQGFSVSAGIVSARNRALS 210

Query: 213 DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
                + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++ K + 
Sbjct: 211 GTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAILSPNGGSIGIGFSMASNVVVKVVQ 270

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L   G    GW G+  Q++T ++A  +GL   KG+L+T  V E PA +AGM+ GDVI  
Sbjct: 271 QLREFGETRRGWLGVRIQDVTPDVAEAMGLTEAKGALVTD-VPEGPAKEAGMQSGDVIVT 329

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND--------M 384
            D   +   +D V ++A     E V++ + +EG   +++V LG    A+N+         
Sbjct: 330 FDSAPVADTRDLVRRVADAPIGEAVRVIVMREGKTRTLSVTLGRREEAENEGPEAPGATE 389

Query: 385 HLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVN 437
             E    +LLG+ +  +       +        +   + +   E  +KG+++G  I    
Sbjct: 390 PTEPSTADLLGLTVAPLTAEQAGELGLPGGTEGLAVTDVDPASEAYSKGLREGDVITEAG 449

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             +V  IKD++  + +A+E  R S+LL I+   D         RFV+L + +
Sbjct: 450 QQKVVSIKDLQDRVTEAREAGRKSLLLLIRRGGD--------PRFVALTVSE 493


>gi|126462761|ref|YP_001043875.1| protease Do [Rhodobacter sphaeroides ATCC 17029]
 gi|126104425|gb|ABN77103.1| protease Do [Rhodobacter sphaeroides ATCC 17029]
          Length = 506

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 141/472 (29%), Positives = 231/472 (48%), Gaps = 35/472 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK 92
              +      +  ++SP++V++          +          +PE  P +++FR     
Sbjct: 55  AQNAPASFAGLAEKISPAVVNITTSTVVAAPTQNS------PLVPEGSPFEDFFRDFMDP 108

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
              GE P           GSGF I++DGYI+T+NH++E      +      +L AKLVGT
Sbjct: 109 QNRGEGP-----RRSEALGSGFVISEDGYIVTNNHVIEGADDIQIEFFSGKKLEAKLVGT 163

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   D+A+LKV  ++    V F +++  RVG+ V  +GNP     +VSAGIVSA +R + 
Sbjct: 164 DPKTDIALLKVDGNQPLPFVSFGNSDLARVGDWVVAMGNPLGQGFSVSAGIVSARNRALS 223

Query: 213 DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
                + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++ K + 
Sbjct: 224 GTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAILSPNGGSIGIGFSMASNVVVKVVQ 283

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L   G    GW G+  Q++T ++A  +GL   KG+L+T  V E PA +AGM+ GDVI  
Sbjct: 284 QLREFGETRRGWLGVRIQDVTPDVAEAMGLTEAKGALVTD-VPEGPAKEAGMQSGDVIVT 342

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND--------M 384
            D   +   +D V ++A     E V++ + +EG   +++V LG    A+N+         
Sbjct: 343 FDSAPVADTRDLVRRVADAPIGEAVRVIVMREGKTRTLSVTLGRREEAENEGPEAPGAAE 402

Query: 385 HLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVN 437
             E    +LLG+ +  +       +        +   + +   E  +KG+++G  I    
Sbjct: 403 PTEPSTADLLGLTVAPLTAEQAGELGLPGGTEGLAVTDVDPASEAYSKGLREGDVITEAG 462

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             +V  IKD++  + +A+E  R S+LL I+   D         RFV+L + +
Sbjct: 463 QQKVVSIKDLQDRVTEAREAGRKSLLLLIRRGGD--------PRFVALTVSE 506


>gi|332558800|ref|ZP_08413122.1| protease Do [Rhodobacter sphaeroides WS8N]
 gi|332276512|gb|EGJ21827.1| protease Do [Rhodobacter sphaeroides WS8N]
          Length = 493

 Score =  239 bits (609), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 140/472 (29%), Positives = 231/472 (48%), Gaps = 35/472 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK 92
              +      +  ++SP++V++          +          +PE  P +++FR     
Sbjct: 42  AQNAPASFAGLAEKISPAVVNITTSTVVAAPTQNS------PLVPEGSPFEDFFRDFMDP 95

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
              G+ P           GSGF I++DGYI+T+NH++E      +      +L AKLVGT
Sbjct: 96  QNRGDGP-----RRSEALGSGFVISEDGYIVTNNHVIEGADDIQIEFFSGKKLEAKLVGT 150

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   D+A+LKV  ++    V F +++  RVG+ V  +GNP     +VSAGIVSA +R + 
Sbjct: 151 DPKTDIALLKVDGNQPLPFVSFGNSDLARVGDWVVAMGNPLGQGFSVSAGIVSARNRALS 210

Query: 213 DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
                + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +++ K + 
Sbjct: 211 GTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAILSPNGGSIGIGFSMASNVVVKVVQ 270

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L   G    GW G+  Q++T ++A  +GL   KG+L+T  V E PA +AGM+ GDVI  
Sbjct: 271 QLREFGETRRGWLGVRIQDVTPDVAEAMGLAEAKGALVTD-VPEGPAKEAGMQSGDVIVT 329

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND--------M 384
            D   +   +D V ++A     E V++ + +EG   +++V LG    A+N+         
Sbjct: 330 FDSAPVADTRDLVRRVADAPIGEAVRVIVMREGKTRTLSVTLGRREEAENEGPEAPGAAE 389

Query: 385 HLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVN 437
             E    +LLG+ +  +       +        +   + +   E  +KG+++G  I    
Sbjct: 390 PTEPSTADLLGLTVAPLTAEQAGELGLPGGTEGLAVTDVDPASEAYSKGLREGDVITEAG 449

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             +V  IKD++  + +A+E  R S+LL I+   D         RFV+L + +
Sbjct: 450 QQKVVSIKDLQDRVTEAREAGRKSLLLLIRRGGD--------PRFVALTVSE 493


>gi|83951312|ref|ZP_00960044.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           nubinhibens ISM]
 gi|83836318|gb|EAP75615.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           nubinhibens ISM]
          Length = 474

 Score =  239 bits (608), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 136/496 (27%), Positives = 250/496 (50%), Gaps = 40/496 (8%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           ++++   A+   +  +  L  +A+          +  +VSP++V++        + + + 
Sbjct: 1   MRALWFWAVALALVLAQTLAAQAR----PESFADLAQKVSPAVVNITTSTVVAANTDTL- 55

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                  +PE  P +++FR+   +    ++P           GSGF I++DG+I+T+NH+
Sbjct: 56  -----PMVPEGSPFEDFFREFRDRNGGEDQP-----RRTSALGSGFVISEDGFIVTNNHV 105

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           +E      +   +  EL A+++GTD   D+A+LKV +D     V F D++  RVG+ V  
Sbjct: 106 IESADEIIIEFYEGGELKAEVIGTDPKTDIALLKVTADGPLPFVSFGDSDTARVGDWVMA 165

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G V+GVN  I
Sbjct: 166 MGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMSGEVVGVNTAI 225

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           ++     +G+G  +  +++ + +  L   G    GW G+  Q++T+++A  +GL   +G+
Sbjct: 226 LSPNGGSIGIGFSMASNVVTRVVEQLKEFGETRRGWLGVRIQDVTEDVAEAIGLEQARGA 285

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+T  V E PA   GMK GDVI   DG+ ++  +  V ++ +    + V++ + ++G   
Sbjct: 286 LVTD-VPEGPAMDGGMKSGDVILSFDGKDVEDTRGLVRRVGNAEVGKAVRVVVFRDGKTT 344

Query: 369 SVAVVLGSSPTA---------KNDMHLEVGDKELLGMVLQDINDGNKKLV-------RIV 412
           ++ V LG    A         ++       ++++LG+ L +++D  ++ +        +V
Sbjct: 345 TLKVTLGRREEAEGTVPAAQTQDAEDPAPVERDVLGLTLSEMSDELRQQLDLKPEANGLV 404

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
             + + E E   KG++ G  I       ++ ++D E  I  AKE  R S+LL ++   + 
Sbjct: 405 VRDVDPESEAYEKGLRGGDVITEAGQQSLATVEDFETRIEDAKEAGRKSLLLLVRRSGE- 463

Query: 473 QSGNDNMSRFVSLKID 488
                   RFV+L +D
Sbjct: 464 -------PRFVALSLD 472


>gi|254459945|ref|ZP_05073361.1| protease DegQ [Rhodobacterales bacterium HTCC2083]
 gi|206676534|gb|EDZ41021.1| protease DegQ [Rhodobacteraceae bacterium HTCC2083]
          Length = 494

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 132/491 (26%), Positives = 237/491 (48%), Gaps = 32/491 (6%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
            T+A+   +       + A    +      +  ++SP++V++        +         
Sbjct: 21  WTLAMGLSVALLLLQTMSAAARGAPESFADLAEKISPAVVNITTSTTVARNTA------P 74

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
            G  PE  P + +FR+   +   G              GSGF I++DG+++T+NH+++  
Sbjct: 75  RGVAPEGSPFEEFFREFQDRNRGGNGDRP---RRSSALGSGFVISEDGFVVTNNHVIDGA 131

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
               +   +  ELPAK++GTD   D+A+LKV++D+    V F +++  RVG+ V  +GNP
Sbjct: 132 DEILIEFFEGGELPAKVIGTDPNTDIALLKVETDKPLSFVSFGNSDFSRVGDWVMAMGNP 191

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
                +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++  
Sbjct: 192 LGQGFSVSAGIVSARNRALSGSYDDYIQTDAAINRGNSGGPLFNMDGDVIGVNTAILSPN 251

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              +G+G  +  +++   +  L   G    GW G+  Q++T ++A  +GL    G+L+T 
Sbjct: 252 GGSIGIGFSMASNVVVNVVDQLKEFGETRRGWLGVRIQDVTDDVAEAIGLENAAGALVTD 311

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
            V E P+ +AG+K GDVI   DG+ +   +  V  + +    + V++ + ++G   ++ V
Sbjct: 312 -VPEGPSMEAGIKAGDVIMSFDGKDVSDTRSLVKTVGNTQVGKAVRVIVFRDGKTETLKV 370

Query: 373 VLGSSPTAKN-------DMHLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNR 418
            LG    A+                 E+LG+ + +I D  +  +        +V  +   
Sbjct: 371 TLGRREEAEGAVPASQPAAPAAPSKTEVLGLTISEITDELRDQLDLTDSASGLVIQDVVE 430

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
             +   KG++ G  I      +++ ++D+ + I  A+E  R S+LL ++   D       
Sbjct: 431 TSKAYEKGLRAGDLITEAGQQKLASVEDLTKQIEAAREAGRKSLLLLVRRAGD------- 483

Query: 479 MSRFVSLKIDK 489
             RFV+L +++
Sbjct: 484 -PRFVALALEE 493


>gi|239831455|ref|ZP_04679784.1| protease Do [Ochrobactrum intermedium LMG 3301]
 gi|239823722|gb|EEQ95290.1| protease Do [Ochrobactrum intermedium LMG 3301]
          Length = 519

 Score =  237 bits (603), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 178/519 (34%), Positives = 277/519 (53%), Gaps = 49/519 (9%)

Query: 8   SVKSICTVALTCVIFSSTYL----------VLEAKLPPSSVDLPPVIARVSPSIVSVMVE 57
           SV +I   A+    F +T             ++   PP +     ++ +V P++VSV V+
Sbjct: 12  SVAAIALSAVLAGGFVATGPIGALNDARADAVQVTPPPQAAGFADLVEKVRPAVVSVRVK 71

Query: 58  PKKKVSVE----QMFNAYGFGNLPEDHPLKNYFRKDF-------------HKFFSGEEPI 100
              + + +    Q     GF  LP+DHPLK +FR                 +   G+   
Sbjct: 72  KDVQQTADRGGGQFSGPQGFYQLPDDHPLKRFFRDFGMDPRGDARPDARPDRRGPGKRGP 131

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                  +  GSGFFI++DGY++T+NH+V DG ++SV++ D TEL AKL+GTD   DLAV
Sbjct: 132 RPGHERPVAQGSGFFISEDGYVVTNNHVVSDGDAYSVVMDDGTELDAKLIGTDPRTDLAV 191

Query: 161 LKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-F 218
           LKV    +KF  V F D N IRVG+ V  +GNPF L GTV++GIVSA  RDI   P   F
Sbjct: 192 LKVNDPKQKFTYVAFGDDNKIRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPYDDF 251

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            QIDA +N+GNSGGP FN  G VIG+N  I +     +G+   IP S  K+ +  LI KG
Sbjct: 252 IQIDAAVNKGNSGGPAFNLSGQVIGINTAIFSPSGGSVGIAFAIPASTAKQVVDQLIKKG 311

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
            V+ GW G+  Q +T+++A  LGL   KG+L+ +  K+ PA KAG++ GDVI  ++G  +
Sbjct: 312 SVERGWIGVQIQPVTKDIAASLGLAEEKGALVASPQKDGPAAKAGIQSGDVITAVNGETV 371

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA--------KNDMHLEVGD 390
           +  +D   ++A  +P E+  +++ ++     ++V + + P           ++   +   
Sbjct: 372 QDTRDLARKVAGVAPGEKAALTVWRKNKAEEISVTIEAMPGDLGKSASPSTDNGGGQNET 431

Query: 391 KELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
            +  G+ +    DGN     +V  + + + +   +GI+ G  IVSVN   V   KD+   
Sbjct: 432 LDSYGLTVTPSEDGN----GVVVTDVDPDSDASDRGIRSGDIIVSVNNQTVKSAKDINNA 487

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           I +A++  R +VLLQ++        +++ SRFV+L ID+
Sbjct: 488 ISEAEKSGRKAVLLQLQ--------SNDQSRFVALPIDQ 518


>gi|46201208|ref|ZP_00055558.2| COG0265: Trypsin-like serine proteases, typically periplasmic,
           contain C-terminal PDZ domain [Magnetospirillum
           magnetotacticum MS-1]
          Length = 488

 Score =  236 bits (602), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 141/498 (28%), Positives = 228/498 (45%), Gaps = 38/498 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
                V       +  A  PP       +  R+ P++V++      K S      A    
Sbjct: 2   AGALAVFTLLVPGMASAGAPPG--GFADLAERLLPAVVNISTTQTMKPSQ----GAPELP 55

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
             P   PL+ +F++   +   G+ P      +    GSGF I   GYI+T+NH++ D   
Sbjct: 56  QFPPGSPLEEFFKEFMERQQGGKSPDAPS-RKATSLGSGFIIDAAGYIVTNNHVIADADE 114

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPF 193
            SV L DDT   A LVG D   DLA+LK++   +  +PV F +++  RVG+ V  IGNPF
Sbjct: 115 ISVKLHDDTVFQATLVGRDPKVDLALLKIEPGKKPLVPVPFGNSDEARVGDWVLAIGNPF 174

Query: 194 RLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
              GTV+AGIVSA  RDI   P   F Q DA IN+GNSGG  FN  G VIG+N+ I++  
Sbjct: 175 GFGGTVTAGIVSARARDINAGPYDDFLQTDAAINRGNSGGSMFNMKGEVIGINSAIISPS 234

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              +G+G  +P ++    +  L   G+V  GW GI  Q+L  ++A  +GL   KG+L+  
Sbjct: 235 GGSIGIGFAVPAALAVPVLDDLRKFGKVRRGWLGIRIQSLDTDMAENIGLPDQKGALVAK 294

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           V    P  KAG+K GDV+   DG+ I   +     +AS    ++V + + ++G + ++  
Sbjct: 295 VDPNGPGVKAGLKDGDVVLKFDGKDITEMRRLPRYVASTPIGKKVDVVIWRDGKRQTITA 354

Query: 373 VLGSSPTAKNDMHLEVGD--------------KELLGMVLQDINDGNKKLVR-------I 411
            +G  P    +  ++                     G+ +  +    ++          I
Sbjct: 355 SVGEMPEDPAEQQVKGKPESPKPQANKDGILTIPGAGLTVSSLTAQLRERFGLDEEAKGI 414

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V      +     KG++ G  I+  +   V    D+ +LI + +     S+LL+++    
Sbjct: 415 VVTEVKPDSPAAEKGMRPGDMIIEADHKPVRSPADLGKLIDEGRRAGAKSLLLRVE---- 470

Query: 472 MQSGNDNMSRFVSLKIDK 489
               N    R+++L + +
Sbjct: 471 ----NPQQLRYIALPLAE 484


>gi|260433206|ref|ZP_05787177.1| protease Do subfamily protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417034|gb|EEX10293.1| protease Do subfamily protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 496

 Score =  236 bits (601), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 143/504 (28%), Positives = 250/504 (49%), Gaps = 43/504 (8%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE 65
           +  ++ +     T ++  +  +  +A+L      L P++ ++SP++V++      +    
Sbjct: 16  VTMMRLMWLTIATAILLLAQTVAAQARLE----SLAPLVDKISPAVVNITTTTLIEGQAG 71

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTS 125
                   G +PE  P +++FR+   +    E             GSGF I++DG+I+T+
Sbjct: 72  ------PRGIVPEGSPFEDFFREFQDRNGGDENRP----RRSNALGSGFVISEDGFIVTN 121

Query: 126 NHIVEDGASFSVILSDDT-----ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           NH++ +     V           ELPAK++GTD   D+A+LKV++      V F D++  
Sbjct: 122 NHVIAEADEILVEFFPGDGQPKKELPAKVIGTDEKTDIALLKVEAPGPLKYVTFGDSDTA 181

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
           RVG+ V  +GNP     +VSAGIVSA +R++      + Q DA IN+GNSGGP FN  G 
Sbjct: 182 RVGDWVIAMGNPLGQGFSVSAGIVSARNRELSGTYDDYIQTDAAINRGNSGGPLFNMDGQ 241

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVN  I++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  +
Sbjct: 242 VIGVNTAILSPNGGSIGIGFSMASNVVVKVVDQLREFGETRRGWLGVRIQDVTEDMAEAM 301

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL    G+LI+  V + PA +AG+  GDVI   DG  +K  +  V Q+      + V++ 
Sbjct: 302 GLDKPGGALISD-VPDGPAKEAGLLPGDVILSFDGVEVKDTRGLVRQVGETPVGKSVRVV 360

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE--------LLGMVLQDINDGNKKLV--- 409
           + ++G+  +V V LG    A+     E    E        +LG+ +  + D  ++ +   
Sbjct: 361 VMRDGATKTVLVTLGRREDAERAEIGEPESSEAPVEEDATILGLTISPLTDTLREDLGLD 420

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +V ++ +   E  AKG++ G  I      +V  I D+E  + +A+E  R S+LL 
Sbjct: 421 ADAAGLVVVDVDEASEAYAKGLRAGDLITEAGQQKVGSIADLEARMDEAREAGRKSLLLL 480

Query: 466 IKYDPDMQSGNDNMSRFVSLKIDK 489
           ++   D         RFV+L +++
Sbjct: 481 VRRGGD--------PRFVALGLEE 496


>gi|146276936|ref|YP_001167095.1| protease Do [Rhodobacter sphaeroides ATCC 17025]
 gi|145555177|gb|ABP69790.1| protease Do [Rhodobacter sphaeroides ATCC 17025]
          Length = 493

 Score =  235 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 139/478 (29%), Positives = 230/478 (48%), Gaps = 35/478 (7%)

Query: 27  LVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYF 86
             + A    +      +  ++SP++V++          +          +PE  P +++F
Sbjct: 36  QAVSAHAQGAPASFAGLAEKISPAVVNITTSTVVAAPTQSS------PLVPEGSPFEDFF 89

Query: 87  RKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELP 146
           R           P           GSGF I++DG+I+T+NH++E      +      +L 
Sbjct: 90  RDFMDPQNREGGP-----RRSEALGSGFVISEDGFIVTNNHVIEGADDIQIEFFSGNKLE 144

Query: 147 AKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           AKLVGTD   D+A+LKV S++    V F +++  RVG+ V  +GNP     +VSAGI+SA
Sbjct: 145 AKLVGTDPKTDIALLKVSSNQPLPFVSFGNSDLARVGDWVVAMGNPLGQGFSVSAGIISA 204

Query: 207 LDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
            +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  ++
Sbjct: 205 RNRALSGTYDDYIQTDAAINRGNSGGPLFNLDGQVIGVNTAILSPNGGSIGIGFSMASNV 264

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
           + K +  L   G    GW G+  Q++T ++A  +GL   KG+L+T  V + PA +AGM+ 
Sbjct: 265 VVKVVQQLREFGETRRGWLGVRIQDVTPDVAEAMGLAEAKGALVTD-VPDGPAKEAGMQS 323

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK----- 381
           GDVI   D   +   +D V ++A     E V++ + +EG   +++VVLG    A+     
Sbjct: 324 GDVIVTFDKAPVADTRDLVRRVADAPIGEAVRVVVMREGKTRTLSVVLGRREEAEGEGPA 383

Query: 382 ---NDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGM 431
                   E     LLG+ +  +       +        +   + +   E  +KG+++G 
Sbjct: 384 ASVESAPTEPSTANLLGLTVAPLTAEQAAELGLPPGTEGLAVTDVDTASEAYSKGLREGD 443

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            I      +V  IKD++  + +A+E  R S+LL I+   D         RFV+L I +
Sbjct: 444 VITEAGQQKVMTIKDLQDRVDEAREAGRKSLLLLIRRGGD--------PRFVALTITE 493


>gi|114328154|ref|YP_745311.1| endopeptidase degP [Granulibacter bethesdensis CGDNIH1]
 gi|114316328|gb|ABI62388.1| endopeptidase degP [Granulibacter bethesdensis CGDNIH1]
          Length = 525

 Score =  235 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 136/509 (26%), Positives = 230/509 (45%), Gaps = 35/509 (6%)

Query: 4   RQILSVKSICTVALTCVIFSSTY-LVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           R  L++ ++  +A   V         ++A+   +      +  ++ P +V++        
Sbjct: 26  RAGLALAAMIPLATGLVPGGLPLYPAMDAQAREAPASFADLAEKLLPGVVNISSTTTI-- 83

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSD---TVERLMFGSGFFIT-D 118
           +             P   P + +FR   ++     +P   +          GSGF +   
Sbjct: 84  ARGPEGPGPDMPQFPPGSPFEKFFRDFMNRHPLPGQPHGGEEGAPRRAQSLGSGFIVDAK 143

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED-- 176
           +G ++T+NH+++     +VIL D+T L AK++G D   D+AVL+V S +       +   
Sbjct: 144 EGIVVTNNHVIDGADEITVILQDNTPLKAKVLGRDERLDIAVLQVTSPKDKPLTAVQFGD 203

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCF 235
           ++  RVG+ V  IGNPF L G+V+AGIVSA  RDI   P   F Q DA IN+GNSGGP F
Sbjct: 204 SDKERVGDWVLAIGNPFGLGGSVTAGIVSARGRDIHQGPYDDFIQTDAAINRGNSGGPLF 263

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N  I +     +G+G  IP  + +  +  +   GR   GW G+  Q +T E
Sbjct: 264 NMDGQVIGINTAIYSPSGGSIGIGFAIPSKLAQNVVDQIRKFGRARRGWLGVRIQQVTPE 323

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           +A  LGL+ T G++I  V +  PADKA ++ GD+I   + + +K        +A     E
Sbjct: 324 IAESLGLKETNGAMIAGVNEGGPADKAHLQNGDIILKFNNQDVKDMHSLPRIVAETPIDE 383

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----------LGMVLQDINDGN 405
            V + + + G + ++   +G  P        E                LG+ +  ++   
Sbjct: 384 TVPVVVWRGGKRVTLDARVGEMPDDVKQAAAEKAKPGSHDSAQLVIRELGVTVAALSPEV 443

Query: 406 KK-------LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           ++          +V  N       E +G++ G  IV V    V+  KD+ + +   +++ 
Sbjct: 444 REHFNLQGDQKGVVIANIASGSAAEQRGLKPGDIIVEVQQEPVAAPKDITQRLEAVRKQG 503

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           R SVLL I+          +  R+V L +
Sbjct: 504 RKSVLLLIQ--------GQDGLRWVPLPL 524


>gi|84687721|ref|ZP_01015594.1| possible serine protease [Maritimibacter alkaliphilus HTCC2654]
 gi|84664304|gb|EAQ10795.1| possible serine protease [Rhodobacterales bacterium HTCC2654]
          Length = 505

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 140/496 (28%), Positives = 234/496 (47%), Gaps = 36/496 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           +       +          A           +  +VSPS+V++                 
Sbjct: 28  LIATLFALMAAMVLAATSLAHAQTRPASFADLAEKVSPSVVNITTATVVSQDTGPQ---- 83

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
               +PE  P +++FR    +   G+ P    T      GSGF I++DGYI+T+NH++E 
Sbjct: 84  --PMVPEGSPFEDFFRDFLDREGEGQPP---RTRRSSALGSGFVISEDGYIVTNNHVIEG 138

Query: 132 GASFSV-ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
                +    +  EL A ++GTD   D+A+LKV++D     V F D+  IRVG+ V  +G
Sbjct: 139 ADEIVIEFFGNRGELDATVIGTDPNTDIALLKVETDEPLPFVPFGDSEAIRVGDWVMAMG 198

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           NP     ++SAGI+SA  R++      F Q DA IN+GNSGGP FN  G VIGVN  I++
Sbjct: 199 NPLGQGFSISAGIISARGRELQGTYDDFLQTDAAINRGNSGGPLFNMDGQVIGVNTAILS 258

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                +G+G  +  +++ K +  L   G    GW G+  Q+++ ++A  +GL  T G+L+
Sbjct: 259 PNGGSIGIGFAMASNVVTKVVDQLKEFGETRRGWLGVRIQDVSDDVAEAMGLSSTNGALV 318

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           T  V + PA  AGM+ GD+I    G  + + ++ V  + +    E V++ + ++G   ++
Sbjct: 319 TD-VPDGPAKDAGMEAGDLILSFAGEEVANTRELVRIVGNSGVGETVRVVVLRDGQTQTL 377

Query: 371 AVVLGSSPTA----------KNDMHLEVGDKELLGMVLQDINDGNKKLVRI-------VA 413
            VVLG    A           +    EV  + +LGM L ++ D  ++ + +       V 
Sbjct: 378 KVVLGRREEALANDEGGSSTDSTPAPEVQQQTILGMTLSEMTDELREELGLDAGAQGLVV 437

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
                + E  AKG+ +G  I      +++ I  +E  I  A++  R S+LL ++   D  
Sbjct: 438 TAVQADSEAAAKGLIEGDVITEAGQQQLTSIAQLEERIASARDGGRQSLLLLVRRGGD-- 495

Query: 474 SGNDNMSRFVSLKIDK 489
                  RFV+L + +
Sbjct: 496 ------PRFVALPVTE 505


>gi|153009993|ref|YP_001371208.1| protease Do [Ochrobactrum anthropi ATCC 49188]
 gi|151561881|gb|ABS15379.1| protease Do [Ochrobactrum anthropi ATCC 49188]
          Length = 520

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 174/522 (33%), Positives = 274/522 (52%), Gaps = 48/522 (9%)

Query: 4   RQILSVKSICTVALTCVIFSST--------YLVLEAKLPPSSVDLPPVIARVSPSIVSVM 55
           R+ ++  ++  V     + +             ++   PP +     ++ +V P++VSV 
Sbjct: 10  RKGVAAIALSAVLAGGFVATGPLGALNDARAEAVQVTPPPQAAGFADLVEKVRPAVVSVR 69

Query: 56  VEPKKKVSVE-----QMFNAYGFGNLPEDHPLKNYFRKDF-------------HKFFSGE 97
           V+   + + +     Q     GF  LP+DHPLK +FR                 +   G+
Sbjct: 70  VKKDVQQTADRGGSGQFSGPPGFDQLPDDHPLKRFFRDFGMDPRGDARPDARPDRRGPGK 129

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                     +  GSGFFI++DGY++T+NH+V DG ++SV++ D TEL AKL+GTD   D
Sbjct: 130 RGPRPGHERPVAQGSGFFISEDGYVVTNNHVVSDGDAYSVVMDDGTELDAKLIGTDPRTD 189

Query: 158 LAVLKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG 216
           LAVLKV    +KF  V F D N IRVG+ V  +GNPF L GTV++GIVSA  RDI   P 
Sbjct: 190 LAVLKVNDPKQKFTYVAFGDDNKIRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPY 249

Query: 217 T-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F QIDA +N+GNSGGP FN  G VIG+N  I +     +G+   IP S  K+ +  LI
Sbjct: 250 DDFIQIDAAVNKGNSGGPAFNLSGQVIGINTAIFSPSGGSVGIAFAIPASTAKQVVDQLI 309

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
            KG V+ GW G+  Q +T+++A  LGL   KG+++ +  K+ PA KAG++ GDVI  ++G
Sbjct: 310 KKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQKDGPAAKAGIQSGDVITAVNG 369

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK---- 391
             ++  +D   ++A   P E+  +++ ++     V + + + P         +GD     
Sbjct: 370 ETVQDPRDLARKVAGIVPGEKAALTVWRKNKAEEVDITIEAMPGDLGKAASALGDNGGGQ 429

Query: 392 ----ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
               +  G+ +    DGN     +V  + + + +   +GI+ G  I+SVN   V   KD+
Sbjct: 430 NEALDSYGLTVTPSEDGN----GVVVTDVDPDSDASDRGIRSGDIIMSVNNQTVKSAKDI 485

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              I +A +  R +VLLQ++        +++ SRFV+L ID+
Sbjct: 486 NNAISEAAKSGRKAVLLQLQ--------SNDQSRFVALPIDQ 519


>gi|86136612|ref|ZP_01055191.1| periplasmic serine protease, DO/DeqQ family protein [Roseobacter
           sp. MED193]
 gi|85827486|gb|EAQ47682.1| periplasmic serine protease, DO/DeqQ family protein [Roseobacter
           sp. MED193]
          Length = 511

 Score =  233 bits (592), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 143/501 (28%), Positives = 247/501 (49%), Gaps = 43/501 (8%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           + +    L+ V+  +  L  +A+       L P+   VSP++V++      +        
Sbjct: 33  RVLWLGVLSLVMLMAQMLSAQAR----PESLAPLADEVSPAVVNITTTTVIEGRTGPQ-- 86

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
               G +PE  P +++FR+   +                  GSGF I++DGYI+T+NH++
Sbjct: 87  ----GIVPEGSPFEDFFREFQDRNGGNNGNRPQR---SSALGSGFVISEDGYIVTNNHVI 139

Query: 130 EDGASFSVILSDDTE-----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
            D     +            LPAK++GTD   D+A+LKV++      V F D++  RVG+
Sbjct: 140 ADADEIEIEFFPGDGQPKELLPAKVIGTDPNTDIALLKVEAPAPLKFVSFGDSDTARVGD 199

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGV 244
            V  +GNP     ++SAGIVSA +R++      + Q DA IN+GNSGGP FN  G V+GV
Sbjct: 200 WVVAMGNPLGQGFSLSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMDGDVVGV 259

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I++     +G+G  +  +++ K +  L   G    GW G+  Q+++ ++A  +GL  
Sbjct: 260 NTAILSPNGGSIGIGFSMASNVVSKVVLQLKEFGETRRGWLGVRIQDVSDDVAEAMGLDD 319

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
            KG+L+T  V + P+  AG++ GDVI   DG  +++ +  V  + +    + V++ + +E
Sbjct: 320 AKGALVTD-VPDGPSKDAGLQAGDVILSFDGEEVENTRSLVRTVGNTEVGKTVRVVVYRE 378

Query: 365 GSKHSVAVVLGSSPTAKNDM---------HLEVGDKELLGMVLQDINDGNKKLV------ 409
           G   ++ V LG    A+ +            +V +KELLG+ +  + D  +  +      
Sbjct: 379 GKTETLKVTLGRREDAEREATGSTEGETEDPKVTEKELLGLSIGILTDKIRGELNLPTGT 438

Query: 410 -RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
             +V L+ N   E   KG++ G  I      +V+ I ++E  I +AKE  R S+LL ++ 
Sbjct: 439 DGLVILSVNEVSEAWEKGLRAGDVITEAGQQKVATIGELETRISEAKEAGRKSLLLLVRR 498

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
           + +         RFV+L + K
Sbjct: 499 NGE--------PRFVALNLVK 511


>gi|259416296|ref|ZP_05740216.1| protease Do [Silicibacter sp. TrichCH4B]
 gi|259347735|gb|EEW59512.1| protease Do [Silicibacter sp. TrichCH4B]
          Length = 498

 Score =  232 bits (591), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 142/499 (28%), Positives = 239/499 (47%), Gaps = 44/499 (8%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           +      L   +     L   A+       L P+  +VSP++V++      +        
Sbjct: 24  RLFWIAVLGTALLVMQSLSAAAR----PESLAPLAEKVSPAVVNITTSTVVEGRTGPQ-- 77

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
               G +PE  P +++FR+   +   G+ P           GSGF I++DGYI+T+NH++
Sbjct: 78  ----GIVPEGSPFEDFFREFQDRNGGGDRP-----RRSSALGSGFVISEDGYIVTNNHVI 128

Query: 130 EDGASFSVILSDDTE-----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +      +            LPA +VGTD   D+A+LKV +      V+F +++  RVG+
Sbjct: 129 DGADEIEIEFFPGDGQPADLLPATVVGTDPNTDIALLKVDAPMPLKFVKFGNSDTARVGD 188

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGV 244
            V  +GNP     ++SAGIVSA +R +      + Q DA IN+GNSGGP FN  G V+GV
Sbjct: 189 WVVAMGNPLGQGFSLSAGIVSARNRALSGSYDDYIQTDAAINRGNSGGPLFNMDGEVVGV 248

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I++     +G+G  +  +++ K +  L   G    GW G+  Q++T +LA  +GL  
Sbjct: 249 NTAILSPNGGSIGIGFSMASNVVTKVVGQLKEFGETRRGWLGVRIQDVTDDLAEAIGLAN 308

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
            +G LIT  V E PA +AG+   DVI   DG  +K  +D V ++      + V++ + ++
Sbjct: 309 DEGVLITD-VPEGPAKEAGLLARDVITSFDGFEVKDTRDLVRRVGDTEVGKTVRVVVFRD 367

Query: 365 GSKHSVAVVLGSSPTA--------KNDMHLEVGDKELLGMVLQDINDGNKKLV------- 409
           G   ++ V LG    A          +   + G+KELLG+ +  + D  ++ +       
Sbjct: 368 GKTETLRVTLGRREDAVGDNAGAESGEAIPDEGEKELLGLTVGVVRDDMREDLNLDAGTT 427

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +V L+ +       KG++ G  I     +++S I D+E  I  A+E  R S+ L ++  
Sbjct: 428 GLVILSVDETSGAWEKGLRAGDVITEAGQNKLSSIADLEAQIAAAEEGGRKSIFLMVRRG 487

Query: 470 PDMQSGNDNMSRFVSLKID 488
            +         RFV+L ++
Sbjct: 488 GE--------PRFVALNLE 498


>gi|163793360|ref|ZP_02187335.1| Peptidase S1C, Do [alpha proteobacterium BAL199]
 gi|159181162|gb|EDP65677.1| Peptidase S1C, Do [alpha proteobacterium BAL199]
          Length = 511

 Score =  232 bits (591), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 153/506 (30%), Positives = 224/506 (44%), Gaps = 35/506 (6%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
            IL   +   +A          +   A           +  R+ P++V+V          
Sbjct: 19  SILRSVTRLGMAAVLATALVIPVAAPAVAKAPPESFADLAERLLPAVVNVATTQTVTDRG 78

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
             M         P   PL++ F+  F +      P           GSGF ++ DG ++T
Sbjct: 79  PAMD----MPQFPPGSPLEDLFKDFFERNGGNNRPQQP--RRAQSLGSGFIVSADGIVVT 132

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF-IPVEFEDANNIRVG 183
           +NH++ D    +V L DD E PAKL+GTD   D+AVLK+ +  +    V+F D++ +RVG
Sbjct: 133 NNHVIADADEITVRLHDDAEFPAKLLGTDPKTDVAVLKIDTGGRVLPFVKFGDSDRMRVG 192

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVI 242
           + V  IGNPF L GTV+AGIVSA  RDI   P   F Q DA IN+GNSGGP FN  G VI
Sbjct: 193 DWVVAIGNPFGLGGTVTAGIVSARGRDIGQGPYDDFIQTDASINRGNSGGPLFNLEGDVI 252

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N  I +     +G+G  I   +    +  L   GR   GW G+  Q +T E+A  LGL
Sbjct: 253 GINTAIFSQSGGSIGIGFAISSKLATNVVTQLREFGRTRRGWLGVRIQQVTDEIAESLGL 312

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
              +G+L+  V  + PA  AG++ GDVI    G+ +   ++    +A     + V + + 
Sbjct: 313 DKARGALVADVTADGPAKAAGIQSGDVILSFAGQDVSEMRELPRIVAETEVGKTVSVKVW 372

Query: 363 KEGSKHSVAVVLGSS------------PTAKNDMHLEVGDKELLGMVLQDINDGNKKLV- 409
           + G     +  LG              P          G  + LG+ L  +    +    
Sbjct: 373 RNGKPVEFSAKLGELEQAEQASLQKDKPAEAATPKGTQGRVDSLGLGLATLTPQLRAQYT 432

Query: 410 ------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
                  +V    +       KG++ G  IV V  +EV   +DV R +  A E  R SVL
Sbjct: 433 IGEQVKGVVVTQVDEAGIASEKGLRPGDVIVEVAQNEVGAPEDVVRGVKAAAESGRKSVL 492

Query: 464 LQIKYDPDMQSGNDNMSRFVSLKIDK 489
           L I    D+        RF +L+IDK
Sbjct: 493 LLIDRQGDL--------RFFALRIDK 510


>gi|56696219|ref|YP_166576.1| periplasmic serine protease [Ruegeria pomeroyi DSS-3]
 gi|56677956|gb|AAV94622.1| periplasmic serine protease, DO/DeqQ family [Ruegeria pomeroyi
           DSS-3]
          Length = 485

 Score =  232 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 145/505 (28%), Positives = 246/505 (48%), Gaps = 48/505 (9%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
            + +    L+ +      L+ +A+       L P+  +VSP++V++      + S     
Sbjct: 5   ARLMALAGLSVLFLLLQTLIAQAR----PESLAPLADKVSPAVVNITTSTLVEGSTGPQ- 59

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                G +PE  P +++FR+   +   G+ P           GSGF I++DGYI+T+NH+
Sbjct: 60  -----GIVPEGSPFEDFFREFQDRNGGGDRP-----RRSSALGSGFVISEDGYIVTNNHV 109

Query: 129 VEDGASFSVILSDD-----TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           +       +           ELPAK+VGTD   D+A+LKV++D     V+F +++  RVG
Sbjct: 110 IAKADEILIEFFPGDGQPARELPAKVVGTDENTDIALLKVEADGPLKYVKFGNSDTARVG 169

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIG 243
           + V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIG
Sbjct: 170 DWVMAMGNPLGQGFSVSAGIVSARNRALSGSYDDYIQTDAAINRGNSGGPLFNMDGEVIG 229

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           VN  I++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  +GL 
Sbjct: 230 VNTAILSPNGGSIGIGFSMASNVVTKVVGQLREYGETRRGWLGVRIQDVTEDMAEAMGLE 289

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
            T G+LI+  V E PA +AG+K GDVI   DG  ++  +D V ++      + V++ + +
Sbjct: 290 KTGGALISD-VPEGPAKEAGLKAGDVIVSFDGAEVRDTRDLVRRVGESEVGKSVRVLVFR 348

Query: 364 EGSKHSVAVVLGSSPTAKNDM------------HLEVGDKELLGMVLQDINDGNKKLVRI 411
           +G   ++ V LG    A+                 E   KE LG+ +  +    +  + +
Sbjct: 349 DGGTQTILVTLGRREDAERAGSGSEEEGEGGQTTPEASKKEFLGLTVSVLTAEMRAELGL 408

Query: 412 V-------ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
                    +  +   E   KG++ G  I      +V+ + D+E  I +A+E  R S+LL
Sbjct: 409 AEDATGLAIVAVDEASEAFEKGLRTGDVITEAGQQKVATLADLETRIDEAREAGRKSLLL 468

Query: 465 QIKYDPDMQSGNDNMSRFVSLKIDK 489
            ++   +         RFV+L + +
Sbjct: 469 LVRRGGE--------PRFVALSLGQ 485


>gi|85704110|ref|ZP_01035213.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. 217]
 gi|85671430|gb|EAQ26288.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. 217]
          Length = 490

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 140/502 (27%), Positives = 251/502 (50%), Gaps = 40/502 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           +   LS++++  +AL   +  +  L  +A+          +  ++SP++V++      + 
Sbjct: 10  RSSALSLRALWAMALMVGLLLAQALAAQAR----PDSFADLADKISPAVVNITTSTVVER 65

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
                        +PE  P +++F +   +   G+ P  S        GSGF I++DG++
Sbjct: 66  GTGPA------PIVPEGSPFEDFFEQFRDRLGEGDRPQRS-----SALGSGFVISEDGFV 114

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH++E      +       LPA+++GTD   D+A+LKV++D+    V F D++  RV
Sbjct: 115 VTNNHVIESADEIIIEFFSGETLPAEVIGTDPKTDIALLKVKADKPLPFVSFGDSDTARV 174

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVI 242
           G+ V  +GNP     ++SAGIVSA +R +      + Q DA IN+GNSGGP FN  G V+
Sbjct: 175 GDWVLAMGNPLGQGFSLSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNLDGQVV 234

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           GVN  I++     +G+G  +  +++K+ +  L   G    GW G+  Q++T+++A  +GL
Sbjct: 235 GVNTAILSPTGGSIGIGFSMASNVVKRVVDQLQQFGETRRGWLGVRIQDVTEDVAEAMGL 294

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
               G+L+T  V E PA ++GM  GDVI   DG+ +   +  V  + +    + V++ + 
Sbjct: 295 EKAAGALVTD-VPEGPAAESGMLAGDVIVSFDGQDVTDTRSLVRTVGNTEVGKTVRVVVF 353

Query: 363 KEGSKHSVAVVLGSSPTAK---------NDMHLEVGDKELLGMVLQDINDGNKKLV---- 409
           +EG   ++ + LG    A+          D      +K +LG+ +  +ND  +  +    
Sbjct: 354 REGKTVTLKITLGRREEAEGAIPVAQPGEDAPEAQVEKTILGLTVTPLNDELRGQLELDS 413

Query: 410 ---RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               +V +N +   E   KG++ G  I      +V+ I D++  I +AKE  R S+LL +
Sbjct: 414 SATGLVVVNIDELSEAFEKGMRAGDVITEAGQQKVASIADLDDRIAEAKEAGRKSLLLLV 473

Query: 467 KYDPDMQSGNDNMSRFVSLKID 488
           +        +    RFV+L I+
Sbjct: 474 R--------SSGDPRFVALSIE 487


>gi|159045273|ref|YP_001534067.1| protease do [Dinoroseobacter shibae DFL 12]
 gi|157913033|gb|ABV94466.1| protease do precursor [Dinoroseobacter shibae DFL 12]
          Length = 501

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 141/469 (30%), Positives = 233/469 (49%), Gaps = 29/469 (6%)

Query: 32  KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFH 91
           +          +  RVSP++V++                     +PE  PL+++FR    
Sbjct: 48  QAREIPGSFADLAERVSPAVVNITTSTNVATPGGPQ------PMVPEGSPLEDFFRDFMD 101

Query: 92  KFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVG 151
           +      P           GSGF I++DGYI+T+NH++E      +      EL A++VG
Sbjct: 102 RQEQDGRPAPRQ-RRSNALGSGFVISEDGYIVTNNHVIEQADEILIEFFSGEELAAEVVG 160

Query: 152 TDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI 211
           TD   D+A+LKV+SD     V F D++  RVG+ V  +GNP     +VSAGIVSA +R +
Sbjct: 161 TDPNTDIALLKVESDTPLPFVTFGDSDAARVGDWVMAVGNPLGQGFSVSAGIVSARNRAL 220

Query: 212 PDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
                 + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +   ++   +
Sbjct: 221 SGTYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPNGGSIGIGFSMAAGVVTNVV 280

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             L   G    GW G+  Q++T ++A  LGL    G+L+T  V + P+  AGM+ GDVI 
Sbjct: 281 DQLKEFGETRRGWLGVRIQDVTDDVAEALGLEQAAGALVTD-VPDGPSLDAGMEAGDVIL 339

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK------NDMH 385
             DGR ++  ++ V  + + +  + V++ + ++G+  ++ V LG    A+          
Sbjct: 340 TFDGRDVEDTRELVQIVGNTAVGKAVRVVVFRDGATQTLLVTLGRREEAERAIPASASAD 399

Query: 386 LEVGDKELLGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNT 438
            E+ +KE++G+ + ++ D  ++ + I       V  + +   E   KG++ G  IV    
Sbjct: 400 EEILEKEIMGLTVSELTDELREQLGIAASDTGLVVADIDETSEAFDKGLRAGDLIVEAAQ 459

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             V+ I++ E  +  AKE  R S+L+ ++ D D         RFV+L +
Sbjct: 460 VRVTTIEEFEERVEAAKEAGRKSILVLVRRDGD--------PRFVALSL 500


>gi|154252903|ref|YP_001413727.1| protease Do [Parvibaculum lavamentivorans DS-1]
 gi|154156853|gb|ABS64070.1| protease Do [Parvibaculum lavamentivorans DS-1]
          Length = 487

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 155/501 (30%), Positives = 249/501 (49%), Gaps = 39/501 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             R+ LS   I  V L+ V+ S   L   A+  P+      +  R+SP++V++       
Sbjct: 9   LTRRFLS--GIAGVFLSAVLISLPPLPAFAQGAPN--SFADLAERLSPAVVNISTSQVLS 64

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
                        ++P + PL ++F +        E+            GSGF I  DG 
Sbjct: 65  ------PGDMAIPSIPPESPLNDFFEEFL------EQQESMRPQRVQSLGSGFVIDPDGI 112

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           ++T+NH++E      V  +D T LPA + GTD   D+AVL+V+S +K   VE  D+N  R
Sbjct: 113 VITNNHVIEGADRIEVTFTDGTTLPATVAGTDPKTDIAVLRVESSKKLPFVELGDSNKAR 172

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGH 240
           VG+ V  IGNPF L G+V+AGIVSAL+RDI       F Q DA IN+GNSGGP F+  G 
Sbjct: 173 VGDWVIAIGNPFGLGGSVTAGIVSALNRDIHAGNYDDFIQTDAAINRGNSGGPLFDMEGR 232

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           V+GVN+ I++     +G+G  +P S +K  +  ++  G    GW G+  Q++T E+A  L
Sbjct: 233 VVGVNSAIISPSGASVGIGFAVPTSTVKPVVAQILKFGETRRGWIGVRIQSVTPEIAESL 292

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL  ++G+LI  V    PA++AG++ GDV+   D +II + +D    +A       V + 
Sbjct: 293 GLGPSRGALIAGVSPGGPAEEAGIETGDVVLAFDDKIITAMRDLPRVVAEAEIGSTVNVQ 352

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE-------LLGMVLQDINDGNKKLVRI-- 411
           L + G   +  +V+G     +       G          +LG+VL ++ND  ++   +  
Sbjct: 353 LFRGGDTLTRKIVVGRLEDEEAQPVEVPGAAGSTPDKTVVLGLVLGELNDDLRERFGVPE 412

Query: 412 -----VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
                +  + +       KGI+ G  IV V    VS   +VE ++   ++  R++VLL++
Sbjct: 413 GVPGVLITDVDPLSAAAEKGIRPGEVIVEVAQRSVSSPAEVEEIVLSEEKAGRNTVLLRL 472

Query: 467 KYDPDMQSGNDNMSRFVSLKI 487
               ++        RFV+L++
Sbjct: 473 SLGGEI--------RFVALRL 485


>gi|163746074|ref|ZP_02153433.1| periplasmic serine protease, DO/DeqQ family protein [Oceanibulbus
           indolifex HEL-45]
 gi|161380819|gb|EDQ05229.1| periplasmic serine protease, DO/DeqQ family protein [Oceanibulbus
           indolifex HEL-45]
          Length = 494

 Score =  230 bits (584), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 146/504 (28%), Positives = 243/504 (48%), Gaps = 44/504 (8%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           Q +   ++  +ALT +I         +        L P+  ++SPS+V++      +   
Sbjct: 16  QWMRAMAMGVMALTLLIL------QASMALAKPESLAPLAEKISPSVVNITTSTTVEGRT 69

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
                    G +PE  P +++FR+   +                  GSGF I++DGY++T
Sbjct: 70  GPQ------GIVPEGSPFEDFFREFQDR----NNDEGDRPRRSSALGSGFVISEDGYVVT 119

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH++E     ++      EL AK++GTD   D+A+LKV++ +    V F D+N  RVG+
Sbjct: 120 NNHVIESADEITIEFFSGEELVAKVIGTDPKTDIALLKVEASQPLPFVSFGDSNAARVGD 179

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGV 244
            V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGV
Sbjct: 180 WVIAMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGEVIGV 239

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I++     +G+G  +  +++ + I  L   G    GW G+  Q++T ++A  +GL+ 
Sbjct: 240 NTAILSPNGGSIGIGFSMASNVVTRVIDQLKEFGETRRGWLGVRIQDVTDDVADAMGLKK 299

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
             G+LIT  V E PA +AG+K GDVI   DG  +   +  V Q+ +      V++++ ++
Sbjct: 300 AVGALITD-VPEGPAREAGLKTGDVIKSFDGVEVADTRGLVRQVGNSPVGATVRVTVLRD 358

Query: 365 GSKHSVAVVLGSSPTAKNDMH------------LEVGDKELLGMVLQDINDGNKKLV--- 409
           G   ++ VVLG    A   +              E     L+G+ L  ++D  +  +   
Sbjct: 359 GKTQTIKVVLGRREDADGAVPAAMDENADEGTEAEPQSTMLMGLTLTPLSDALRAELGAD 418

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +   + ++  E   KG++ G  I      +V+ I D+E  I  AK+  R S+LL 
Sbjct: 419 DGTTGLAVADVDQTSEAYEKGLRMGDIITEAGQEKVASISDLEARIAAAKDAGRKSLLLL 478

Query: 466 IKYDPDMQSGNDNMSRFVSLKIDK 489
           ++   D         RFV+L + +
Sbjct: 479 VRRGGD--------PRFVALSLAE 494


>gi|158422760|ref|YP_001524052.1| peptidase S1C protein [Azorhizobium caulinodans ORS 571]
 gi|158329649|dbj|BAF87134.1| peptidase S1C protein [Azorhizobium caulinodans ORS 571]
          Length = 525

 Score =  229 bits (582), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 148/511 (28%), Positives = 242/511 (47%), Gaps = 33/511 (6%)

Query: 3   KRQILSVKSICTVALTCVIF---------SSTYLVLEAKLPPSSVDLPPVIARVSPSIVS 53
           KR+   +  +  +A+  V           +       A +   S     V+ +V+P++VS
Sbjct: 21  KRRTALMAGVVGLAVAGVAVGQFGYGSTPALAQATTAAPVTAQSFSFADVVQKVTPAVVS 80

Query: 54  VMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDT--------V 105
           V ++         M     FG       ++ + ++   +   G    +            
Sbjct: 81  VKIKKDVSAQQMAMGGDDEFGGADVPPQIERFLKRFGFENGQGGPGGMQRMPRGGGAGER 140

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
             +  GSGF I+ DGY++T+NH+V+  +   V ++D  E  AK++GTD   D+A++K+  
Sbjct: 141 RVVGQGSGFIISPDGYVVTNNHVVDGASEVDVTMTDGKEYTAKVIGTDPRTDVALIKIDG 200

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAP 224
                 V+       RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   F QIDAP
Sbjct: 201 KNDLPFVKLA-DGAPRVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDFVQIDAP 259

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           IN+GNSGGP F+  G+VIG+N  IV+    ++G+   IP   +K  +  L   G+V  G+
Sbjct: 260 INRGNSGGPTFDLNGNVIGMNTAIVSPSGGNVGIAFAIPSETVKTVVDQLRQDGKVARGY 319

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  Q +T +LA  LGL   +G+L+  V  ++PA KAG+K GDV+  ++G  +K  +D 
Sbjct: 320 IGVQIQPVTDDLASGLGLNAAEGALVAQVQPDTPAAKAGLKSGDVVTKVNGDAVKDARDL 379

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-----ELLGMVLQ 399
             +I    P   V +++ ++G   +  V L   PT +     +           LG+ L 
Sbjct: 380 SRKIGMMKPGASVALTVVRDGKTQAFNVKLEQLPTDQQMASADGNGPATHDVPRLGLQLA 439

Query: 400 DI-NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
              +        +V    +      A+GI+ G  I+ V    VS   DV   +  AK + 
Sbjct: 440 PAKSVQGAGAQGVVVTEVDPNGPAAARGIRSGDVILDVGGKTVSNPSDVREGLAAAKAEN 499

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           R +VL+++K +  +        RFV++ +DK
Sbjct: 500 RKAVLMRVKGEQGV--------RFVAITLDK 522


>gi|94264623|ref|ZP_01288406.1| Peptidase S1C, Do [delta proteobacterium MLMS-1]
 gi|93454918|gb|EAT05159.1| Peptidase S1C, Do [delta proteobacterium MLMS-1]
          Length = 484

 Score =  229 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 137/462 (29%), Positives = 224/462 (48%), Gaps = 24/462 (5%)

Query: 37  SVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS- 95
                 +   + PS+V++      K       + +  G   E+ P    FR+ F      
Sbjct: 35  PPSFAELAEEMGPSVVNIYTTQTVKAPRSP--HPFFGGEGFEELP--EMFRRFFDMPHPS 90

Query: 96  --GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
             GE+      ++R   GSG  I+ DGYI+T+NH+VE+  S ++ L++  E  A+++G D
Sbjct: 91  PHGEQQQPPRELQRTSLGSGVIISTDGYIVTNNHVVENADSINIRLTNFEEYDAEVIGRD 150

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              DLA+LK+ S  +   V   D+  +RVG+ V  IGNPF    TV+AGIVS   R +  
Sbjct: 151 PKTDLALLKIDSKHELPAVRMGDSEALRVGDWVLAIGNPFGFEQTVTAGIVSGKGRSLGS 210

Query: 214 RPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
            P   F Q DA IN GNSGGP F   G ++G+N  I + G  ++G+G  IP+++ K  + 
Sbjct: 211 GPYENFIQTDASINPGNSGGPLFALDGAMVGINTAIYSRGGGNIGIGFAIPVNMAKNVVE 270

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L   G V  GW G+M Q++T +LA  L L    G+L+  V    PA  AG+K GDVI  
Sbjct: 271 QLREHGTVTRGWLGVMIQHVTPDLARHLQLERPIGALVGEVDPAGPAAAAGLKAGDVIVE 330

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS-PTAKNDMHLEVGDK 391
             G+ I         +A  +P E+V++ + + G + ++ V +G      +         +
Sbjct: 331 YAGKEISQMTMVPTLVAQTTPGEEVEMVVMRRGERQTLTVTIGKLDEEDERRARSAPESE 390

Query: 392 ELLGMVLQDINDGNKKLV------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
           E LG+ +Q++     + +       ++  +          G+++G  IV VN   +  ++
Sbjct: 391 EQLGLAVQELTPEVAESLGISQDQGVLIADVKAGSAAAEAGLRRGEVIVEVNQQAIESLE 450

Query: 446 DVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
               +I +A E+   SVLL ++            SRFV+++I
Sbjct: 451 QYAAVIEEALEEG--SVLLLVR-------NRQGQSRFVAIRI 483


>gi|149200767|ref|ZP_01877742.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. TM1035]
 gi|149145100|gb|EDM33126.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. TM1035]
          Length = 470

 Score =  229 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 136/491 (27%), Positives = 241/491 (49%), Gaps = 41/491 (8%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           +AL   +  +  +   A+          +  ++SP++V++      +             
Sbjct: 1   MALMVGLLIAQAMAASAR----PDSFADLADKISPAVVNITTSTVVERGTG------PSP 50

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            +PE  P +++F +   +   G+ P  S        GSGF I++DG+++T+NH++E    
Sbjct: 51  IVPEGSPFEDFFEQFRDRLGEGDRPQRS-----SALGSGFVISEDGFVVTNNHVIESADE 105

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             +       L A+++GTD   D+A+LKV++D+    V F D++  RVG+ V  +GNP  
Sbjct: 106 IIIEFFSGETLAAEVIGTDPKTDIALLKVKADKPLPFVSFGDSDTARVGDWVLAMGNPLG 165

Query: 195 LRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
              ++SAGIVSA +R +      F Q DA IN+GNSGGP FN  G V+GVN  I++    
Sbjct: 166 QGFSLSAGIVSARNRALSGTYDDFIQTDAAINRGNSGGPLFNLDGQVVGVNTAILSPTGG 225

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+G  +  +++K+ +  L   G    GW G+  Q++T ++A  +GL    G+L+T  V
Sbjct: 226 SIGIGFSMASNVVKRVVDQLQEFGETRRGWLGVRIQDVTADVAEAMGLEKAAGALVTD-V 284

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            E PA  AGM  GDVI   DG+ +   +  V  + +    + V++ + +EG   ++ + L
Sbjct: 285 PEGPAADAGMLAGDVITSFDGQDVSDTRSLVRTVGNTEVGKTVRVVVFREGKTTTLKITL 344

Query: 375 GSSPTAKNDMHLEVGDKE----------LLGMVLQDINDGNKKLV-------RIVALNPN 417
           G    A+  + +    +E          +LG+ L  ++D  +  +        +V +N +
Sbjct: 345 GRREEAEGAIPVAQPGEEATPEAPVEKTILGLTLTPLSDELRAQLELDNSATGLVVVNID 404

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
              E   KG++ G  I      +V+ I D++  I +AKE  R S+L+ ++        + 
Sbjct: 405 ELSEAYEKGLRAGDVITEAGQQKVASISDLDDRIAEAKEAGRKSLLMLVR--------SG 456

Query: 478 NMSRFVSLKID 488
              RFV+L I+
Sbjct: 457 GDPRFVALSIE 467


>gi|99081793|ref|YP_613947.1| peptidase S1C, Do [Ruegeria sp. TM1040]
 gi|99038073|gb|ABF64685.1| Peptidase S1C Do [Ruegeria sp. TM1040]
          Length = 499

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 144/499 (28%), Positives = 238/499 (47%), Gaps = 44/499 (8%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           +      L   +     L   A+       L P+  +VSP++V++      +        
Sbjct: 24  RLFWISVLGTALLVMQSLSAAAR----PESLAPLAEKVSPAVVNITTSTVVEGRTGPQ-- 77

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
               G +PE  P +++FR+   +   G  P           GSGF I++DGYI+T+NH++
Sbjct: 78  ----GIVPEGSPFEDFFREFQDRNGGGTRP-----RRSSALGSGFVISEDGYIVTNNHVI 128

Query: 130 EDGASFSVILSDDTE-----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           E      +            LPA +VGTD   D+A+LKV +      V+F D++  RVG+
Sbjct: 129 EGADEIEIEFFPGEGQPADLLPATVVGTDPNTDIALLKVDAPMPLSFVKFGDSDKARVGD 188

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGV 244
            V  +GNP     ++SAGIVSA +R +      + Q DA IN+GNSGGP FN  G V+GV
Sbjct: 189 WVVAMGNPLGQGFSLSAGIVSARNRALSGSYDDYIQTDAAINRGNSGGPLFNMDGEVVGV 248

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I++     +G+G  +  +++ K +  L   G    GW G+  Q++T +LA  +GL  
Sbjct: 249 NTAILSPNGGSIGIGFSMASNVVTKVVSQLKEFGETRRGWLGVRIQDVTDDLAEAIGLAS 308

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
            +G LIT  V E PA +AG+   DVI   DG  +K  +D V ++      + V++ + ++
Sbjct: 309 DEGVLITD-VPEGPAKEAGLLARDVITSFDGFEVKDTRDLVRRVGDTEVGKTVRVVVFRD 367

Query: 365 GSKHSVAVVLGSSPTAK--------NDMHLEVGDKELLGMVLQDINDGNKKLV------- 409
           G   ++ V LG    A          +   + G+KELLG+ +  + D  ++ +       
Sbjct: 368 GKTETIRVTLGRREDAVGNGTEGGGAEAVPDEGEKELLGLTVGVVRDDMREDLNLDAGTT 427

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +V L+ +       KG++ G  I     +++S I D+E  I  A+E  R S+ L ++  
Sbjct: 428 GLVILSVDETSGAWEKGLRAGDVITEAGQNKLSSIADLEAQIAAAEEGGRKSIFLMVRRA 487

Query: 470 PDMQSGNDNMSRFVSLKID 488
            +         RFV+L ++
Sbjct: 488 GE--------PRFVALNLE 498


>gi|254512185|ref|ZP_05124252.1| MucD serine protease MucD [Rhodobacteraceae bacterium KLH11]
 gi|221535896|gb|EEE38884.1| MucD serine protease MucD [Rhodobacteraceae bacterium KLH11]
          Length = 477

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 137/498 (27%), Positives = 248/498 (49%), Gaps = 41/498 (8%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           +    +  ++  +  +  +A+       L P+  ++SP++V++      +          
Sbjct: 1   MWLSFVGVLLVVAQSVSAQARGE----SLAPLAEQISPAVVNITTSTLIEGQTGPQ---- 52

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
             G +PE  P +++FR+   +  + +    S        GSGF I++DGYI+T+NH++ +
Sbjct: 53  --GIVPEGSPFEDFFREFQDR--NDDGGDESRPRRSNALGSGFVISEDGYIVTNNHVIAE 108

Query: 132 GASFSVILSDDT-----ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
                V           ELPAK++GTD   D+A+LKV+++     V+F +++  RVG+ V
Sbjct: 109 ADEILVEFFPGDGQPVKELPAKVIGTDEKTDIALLKVEAEGPLKYVKFGNSDVARVGDWV 168

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
             +GNP     +VSAGI+SA +R +      + Q DA IN+GNSGGP FN  G VIGVN 
Sbjct: 169 IAMGNPLGQGFSVSAGIISARNRALSGSYDDYIQTDAAINRGNSGGPLFNMNGEVIGVNT 228

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
            I++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  +GL    
Sbjct: 229 AILSPTGGSIGIGFSMASNVVTKVVDQLREFGETRRGWLGVRIQDVTEDMAEAMGLDKPG 288

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+LI+  V + PA  AG+  GDVI   DG  ++  +  V Q+   +  + V++ + ++G 
Sbjct: 289 GALISD-VPDGPAKDAGLLAGDVILSFDGVEVEDTRALVRQVGETTVGKSVRVVVHRDGG 347

Query: 367 KHSVAVVLGSSPTAKNDMHLEVGDKE--------LLGMVLQDINDGNKKLVRI------- 411
             +V V LG    A+   + E    E        +LG+ +  ++D  ++ + +       
Sbjct: 348 TQTVLVTLGRREDAERAENGEEEAPEAQDEENKDILGLTIAPLSDTQREELGLDADAEGL 407

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           +  N +   E   KG++ G  I      +V+ I D+E  + +A+E  R S+LL ++   +
Sbjct: 408 LVTNVDEASEAFEKGLRAGDLITEAGQQKVTSISDLEARMEEAREAGRKSLLLLVRRGGE 467

Query: 472 MQSGNDNMSRFVSLKIDK 489
                    RFV+L +++
Sbjct: 468 --------PRFVALSLEE 477


>gi|296532848|ref|ZP_06895517.1| HtrA/DegQ/DegS family serine protease [Roseomonas cervicalis ATCC
           49957]
 gi|296266804|gb|EFH12760.1| HtrA/DegQ/DegS family serine protease [Roseomonas cervicalis ATCC
           49957]
          Length = 516

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 141/518 (27%), Positives = 236/518 (45%), Gaps = 39/518 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEA---------KLPPSSVDLPPVIARVSPSI 51
           M    +L   ++    L+    +      +           +  +     P+  R+ PS+
Sbjct: 1   MRLATLLLTATVAAAPLSLPFTALAQPAAQPAPAAPAPQGSVHATPESFAPLARRLLPSV 60

Query: 52  VSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVERLM 109
           V++      +    +  +A      P   P +  FR  F +     G             
Sbjct: 61  VNIQTSQTLQARANR-PDAPEMPQAPPGSPFEELFRDFFERNRPPGGGARPGQPPRRAQS 119

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I   G I+T+NH+++     +V+L D+T L A+L+GTD+  DLAVL+V+SD+  
Sbjct: 120 QGSGFIIDASGIIVTNNHVIDGADEINVVLQDNTTLRAELIGTDSRTDLAVLRVRSDKPL 179

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQG 228
             V F D+++  VG+ V  IGNP    G+V++GIVSA  R+I   P   F Q DA IN+G
Sbjct: 180 PVVPFGDSDSAEVGDWVLAIGNPLGFGGSVTSGIVSARGRNINAGPYDDFIQTDAAINRG 239

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G VIG+N  IV+     +G+G  IP ++ K  +  L   GRV  GW G+ 
Sbjct: 240 NSGGPLFNVRGEVIGINTAIVSPSGGSIGIGFAIPSNLAKNIVAQLRDGGRVRRGWLGVN 299

Query: 289 TQNLTQELAIPLG-LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
            Q +T E+A  LG   G +G+L+    ++ PA K G++ GDVI   + + ++  ++    
Sbjct: 300 IQQVTDEIAESLGLQGGARGALVARAQEDGPAAKGGIQNGDVILKFNNQDVREMRNLPRI 359

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----------LGMV 397
           +A      +V +++ + G + ++ V +   P  +         ++           LG+ 
Sbjct: 360 VAETQVGSKVPVTVWRGGREQNLEVTVAELPVDQQQAAAGSAPQQARPGAVVELSGLGLK 419

Query: 398 LQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
           +  I+   K+          +V            +GI  G  IV V  + VS  ++V+  
Sbjct: 420 VAPISPETKERFSLRDDARGVVVTEVAPNSSAAERGISAGDLIVEVQQNRVSNPQEVQEQ 479

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           + + + + R S L+ I+        N    RFV L++ 
Sbjct: 480 LARLRRQNRPSALMLIE--------NAQGQRFVPLRLQ 509


>gi|90419148|ref|ZP_01227059.1| serine protease [Aurantimonas manganoxydans SI85-9A1]
 gi|90337228|gb|EAS50933.1| serine protease [Aurantimonas manganoxydans SI85-9A1]
          Length = 503

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 171/498 (34%), Positives = 262/498 (52%), Gaps = 27/498 (5%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEA---KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           +    + +VALT V+ ++  +  E    + P  +     V+ +VSP++VSV V  +   +
Sbjct: 17  VLAAGVASVALTGVVGNTVPVFAEPVKVEAPVQNFGFADVVEKVSPAVVSVRVTQEVTPT 76

Query: 64  VEQMFNAY---GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           + Q         F +LPEDHPL+ +F                +   R+  GSGFFI+DDG
Sbjct: 77  MSQGRGPDMGSPFDSLPEDHPLRRFFDVPGRDNAPNGMRPDREPRTRMGQGSGFFISDDG 136

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           +++T+NH+VE G+ ++V++ D TE  A+L+GTD   DLA+LKV   + KF  VEF D + 
Sbjct: 137 FVVTNNHVVEGGSQYTVVMDDGTEYDAELIGTDPRTDLALLKVDESNTKFTYVEFGDDDA 196

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNAL 238
           +R+GE V  +GNPF L G+V+AGIVSA  RDI   P   F QIDA +N+GNSGGP F   
Sbjct: 197 VRIGEWVVAVGNPFGLGGSVTAGIVSARGRDIGAGPYDDFLQIDAAVNRGNSGGPAFGLD 256

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIGVN  I +    ++G+   IP S+ K  I SL   G V+ GW G+    +T ++A 
Sbjct: 257 GKVIGVNTAIFSPSGGNVGIAFAIPASVAKDVIQSLREDGSVERGWLGVQIAPVTDDIAE 316

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            +GL   KG+++T    E+PA KAG+K GDVI  ++G  +   ++    I +  P  +V 
Sbjct: 317 AVGLDQEKGAIVTLPDNETPATKAGIKTGDVITAVNGETVDGPRELARMIGNYRPDTKVD 376

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDM-------HLEVGDKELLGMVLQDINDGNKKLVRI 411
           +++ ++G    V+V LG+  +             ++       G+ L    DG      +
Sbjct: 377 VTIWRDGKAQDVSVELGNLSSLDEAASARGSGVPVDPSSLSGYGLTLTPSEDGE----GV 432

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V  +   +     KGI+ G  I++VN   V   KDV+  I  A E  R + L Q++    
Sbjct: 433 VVTDVKPDSSASEKGIKAGDIIIAVNGETVETQKDVQSAIDAAAETGRKAALFQLQ---- 488

Query: 472 MQSGNDNMSRFVSLKIDK 489
                +  +RFV+L I K
Sbjct: 489 ----TNGQNRFVALPIAK 502


>gi|220920738|ref|YP_002496039.1| protease Do [Methylobacterium nodulans ORS 2060]
 gi|219945344|gb|ACL55736.1| protease Do [Methylobacterium nodulans ORS 2060]
          Length = 500

 Score =  228 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 142/506 (28%), Positives = 223/506 (44%), Gaps = 41/506 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
            +R      +   +++   I     +            L  +  +V+ ++V++      +
Sbjct: 17  KRRLPALAGAFLALSVGTAILPGAAIAK------GPASLADLAEQVTDAVVNISASTTVE 70

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
                +        LP   P ++ F   F++    +             GSGF I   G 
Sbjct: 71  TRGRTL------PQLPPGTPFEDLFEDFFNRRQGDQPRAP---RRSNSLGSGFIIDASGI 121

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI--PVEFEDANN 179
           ++T+NH++ D     VIL D  +L A++VG D+  D+AVL+V+ D       V   D++ 
Sbjct: 122 VVTNNHVIGDANDIQVILHDGRKLKAEIVGKDSKTDIAVLRVKPDTDRPLKAVPLGDSDK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           +R G+ V  IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  
Sbjct: 182 MRPGDWVIAIGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  +P +     I  L   G    GW G+  QN+    A 
Sbjct: 242 GEVIGINTAILSPTGGSVGIGFAVPTATAAPVIEQLRQYGETRRGWLGVRIQNVDDTTAE 301

Query: 299 PLG-LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
            LG   G +G+LI  V ++ PA  AG +VGDVI   +G  +KS  D    +A+    + V
Sbjct: 302 ALGLKGGARGALIAGVDEKGPAKAAGFEVGDVIVKFNGIDVKSSSDLPRIVAATPVGKTV 361

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL--------LGMVLQDINDGNKKLV 409
            +   ++G + +  V LG            +   +         LG+ L  ++D  ++  
Sbjct: 362 DVITVRKGQEQNRPVTLGRLEDNDKAQPAALNRPQPEADVTRQALGLNLSGLSDEVRRRF 421

Query: 410 -------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
                   +V    +       K IQ G  IV V    V+   DV R I + K++ R S 
Sbjct: 422 NIKDGVKGVVVTRVDPNSTAADKRIQPGDIIVEVGQEPVNSPTDVTRRIDQIKKEGRKSA 481

Query: 463 LLQIKYDPDMQSGNDNMSRFVSLKID 488
           LL +       S      RFV+L ++
Sbjct: 482 LLLV-------SNAQGEVRFVALSLE 500


>gi|83954155|ref|ZP_00962875.1| periplasmic serine protease, DO/DeqQ family [Sulfitobacter sp.
           NAS-14.1]
 gi|83841192|gb|EAP80362.1| periplasmic serine protease, DO/DeqQ family [Sulfitobacter sp.
           NAS-14.1]
          Length = 494

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 138/490 (28%), Positives = 237/490 (48%), Gaps = 37/490 (7%)

Query: 17  LTCVIFSSTYLVLEAKLP-PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGN 75
           L   + +  +++++A +       L P+  ++SPS+V++      +            G 
Sbjct: 21  LMMGMLALAFVLMQAVVALAKPESLAPLAEKISPSVVNITTSTTVEGRTG------PRGI 74

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE  P +++F++   +   GE P      +    GSGF I++DG+++T+NH++E     
Sbjct: 75  VPEGSPFEDFFKEFRDRNNGGEAPAP---RKSSALGSGFVISEDGFVVTNNHVIEGADEI 131

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           ++      EL A+++GTD   D+A+LKV++      V F D+N  RVG+ V  +GNP   
Sbjct: 132 TIEFFTGLELKAEVIGTDPNTDIALLKVEAPSALPFVSFGDSNAARVGDWVLAMGNPLGQ 191

Query: 196 RGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
             +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     
Sbjct: 192 GFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPNGGS 251

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +  +++ + +  L   G    GW G+  Q++TQ++A  +GL    G+LIT  V 
Sbjct: 252 IGIGFSMASNVVTRVVNQLKEFGETRRGWLGVRIQDVTQDVADAMGLAKASGALITD-VP 310

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           + PA  AG+K GDVI    G  ++  +  V Q+ + +    V++++ +EG   ++ V LG
Sbjct: 311 DGPAKDAGLKTGDVILSFAGVEVEDTRGLVRQVGNSTVGASVRVTVLREGKSQTLKVKLG 370

Query: 376 SSPT-----------AKNDMHLEVGDKELLGMVLQDINDGNKKLVR-------IVALNPN 417
                                     K +LG+ +  + D  +  +        +     +
Sbjct: 371 RREDAEGAGASASAPEDEAEPEAPASKSVLGLTITPLTDDLRTELGADDSVEGLAVTEVD 430

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
              E   KG++ G  I       +  I D+E  I +AK+  R S+LL ++   D      
Sbjct: 431 EMSEAFEKGLRVGDIITEAGQQPILSITDLEDRITEAKDGGRKSLLLLVRRAGD------ 484

Query: 478 NMSRFVSLKI 487
              RFV+L +
Sbjct: 485 --PRFVALGL 492


>gi|126740009|ref|ZP_01755699.1| periplasmic serine protease, DO/DeqQ family protein [Roseobacter
           sp. SK209-2-6]
 gi|126718828|gb|EBA15540.1| periplasmic serine protease, DO/DeqQ family protein [Roseobacter
           sp. SK209-2-6]
          Length = 479

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 141/501 (28%), Positives = 247/501 (49%), Gaps = 45/501 (8%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           + +    L+ V+  +  ++ +A+       L P+  +VSP++V++      +        
Sbjct: 3   RMLWLAMLSFVLIVAQAMIAQAR----PESLAPLADKVSPAVVNITTSTVIEGRTGPQ-- 56

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
               G +PE  P + +FR+   +      P  S        GSGF I++DGYI+T+NH++
Sbjct: 57  ----GIVPEGSPFEEFFREFQDRNRGEGRPQRS-----SALGSGFVISEDGYIVTNNHVI 107

Query: 130 EDGASFSVILSDDTE-----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +      +            LPAK++GTD   D+A+LKV++      V F D++ +RVG+
Sbjct: 108 DKADEIQIEFFPGEGQPGELLPAKVIGTDPNTDIALLKVEAPMPLKFVNFGDSDVMRVGD 167

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGV 244
            V  +GNP     +VSAGIVS  +R++      + Q DA IN+GNSGGP FN  G VIGV
Sbjct: 168 WVMAVGNPLGQGFSVSAGIVSQRNRELQGAYDDYIQTDAAINRGNSGGPLFNMDGDVIGV 227

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I++     +G+G  +  +++ K +  L   G    GW G+  Q++ +++A  +GL G
Sbjct: 228 NTAILSPNGGSIGIGFSMASNVVTKVVNQLKEFGETRRGWLGVRIQDVDEDVAEAIGLEG 287

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
           T+G L+   V + PA  AGM+ GDVI   DG+ +   +  V  + +    + V++ + +E
Sbjct: 288 TEGVLVND-VPDGPAKDAGMQAGDVILSFDGKDVPDTRSLVRTVGNTEVGKTVRVVVYRE 346

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVG---------DKELLGMVLQDINDGNKKLV------ 409
           G   ++ V LG    A+     E           +KE+LG+ +  + D  +  +      
Sbjct: 347 GKTETLKVTLGRREEAERQASDEPEKSETEPTVTEKEILGLTVGVLTDSVRTELNLTDKI 406

Query: 410 -RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
             ++ L+ +   E   KG++ G  I   +  +VS I  +E  + +AKE  R S+LL ++ 
Sbjct: 407 EGLIILSVDETTEAWEKGLRAGDVITEADQQKVSTISALETRVTEAKEAGRKSLLLLVRR 466

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
           + +         RF++L + +
Sbjct: 467 NGE--------PRFMALNLKE 479


>gi|163759094|ref|ZP_02166180.1| protease precursor protein [Hoeflea phototrophica DFL-43]
 gi|162283498|gb|EDQ33783.1| protease precursor protein [Hoeflea phototrophica DFL-43]
          Length = 523

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 178/513 (34%), Positives = 272/513 (53%), Gaps = 43/513 (8%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKL---PPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           ++  +    L   + ++        +    P +     V+  VSP++VSV V+ + +   
Sbjct: 22  AIAGVAAAMLATGVPATITGAFAEPVRVEAPQAPSFADVVEAVSPAVVSVRVQAEVRPVS 81

Query: 65  EQM-----FNAYGFGNLPEDHPLKNYFRKDFHKFFS------------GEEPILSDTVER 107
                   FN  GF +LP DHP+K +F +    F               +       V  
Sbjct: 82  NDGPFSFDFNGRGFDDLPNDHPMKRFFDEFRRGFGGEPDRRAERDRRGPDGQGRPGRVRP 141

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
           +  GSGFFI+ DGY++T+NH++E+GA+F+VI+ D +EL AKL+G D+  DLAVLKV+ DR
Sbjct: 142 VSQGSGFFISGDGYLVTNNHVIENGATFTVIMDDGSELDAKLIGRDSRTDLAVLKVEEDR 201

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPIN 226
           +FI V+F D + IRVG+ V  +GNPF L GTV+AGIVSA  RDI   P   F Q+DA +N
Sbjct: 202 EFIYVDFADDSKIRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGPYDDFIQVDAAVN 261

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
           +GNSGGP FN  G VIG+N  I +    ++G+   IP S  +  I  LI  G V+ GW G
Sbjct: 262 RGNSGGPTFNLSGEVIGINTAIFSPSGGNVGIAFAIPASTARTVINDLIDSGSVERGWLG 321

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q +T ++A  LGL   +G+LITA   ++PA KAG++ GDV+  +DG  ++  +D   
Sbjct: 322 VQIQPVTADIAESLGLAEAQGALITAPQDDAPAAKAGIEAGDVVTAVDGNAVEDPRDLAK 381

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA----------KNDMHLEVGDKELLGM 396
           +IA+  P + V+I++ + G   +V V LGS PT                      +  G+
Sbjct: 382 KIAAMDPGKTVEITVWRNGKSEAVEVELGSLPTEVAALSTDEETTPSAPQAEATLDSFGL 441

Query: 397 VLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
            +     G+     ++  +   +   E +G+Q G  IV+VN  +V+   DV  +I  A  
Sbjct: 442 TVVPAETGS----GLLITSVAPDSAAEERGLQAGDVIVAVNNQDVANAADVVGIIDDAAS 497

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             R + L Q++        N++ SRFV+L ID+
Sbjct: 498 NGRKAALFQVE--------NEDRSRFVALPIDQ 522


>gi|217976793|ref|YP_002360940.1| protease Do [Methylocella silvestris BL2]
 gi|217502169|gb|ACK49578.1| protease Do [Methylocella silvestris BL2]
          Length = 523

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 145/512 (28%), Positives = 228/512 (44%), Gaps = 41/512 (8%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           R   S+ +I  V +      +  L            L  + A VS ++V++         
Sbjct: 22  RNACSLLAIAAVLMFGAASVAPGLGAPPAYAKGPDSLADLAADVSDAVVNISATQT---- 77

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE------PILSDTVERLMFGSGFFIT 117
                 + G   L    P  + F + F +   G+       P      +    GSGF + 
Sbjct: 78  -MDEKRSGGAPQLEPGTPFDDLFEEFFRRRQQGQGGPDQPTPRAPRERKSNSLGSGFVVD 136

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
             G I+T+NH++ D    +VI +D  +L A+++G D+  D+AVLKV+ D+    V+F D+
Sbjct: 137 PSGIIITNNHVIADANDVTVIFTDGQKLKAEVLGKDSKVDVAVLKVKPDKPLKAVKFGDS 196

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFN 236
           + +RVG+ V  +GNPF L GTV+AGI+SAL R+I   P   + Q DA IN+GNSGGP FN
Sbjct: 197 DKMRVGDWVIAVGNPFGLGGTVTAGIISALKRNIDSGPYDNYFQTDAAINKGNSGGPLFN 256

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N  I++     +G+G   P + +   I  L   G    GW G+  QN+   +
Sbjct: 257 MAGEVVGINTAILSPSGGSIGIGFSTPAATVTPVIDQLQKFGETRRGWLGVRIQNVDDTI 316

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  L L   +G+L+     + PA  AG++ GDVI   DG  IK   D    +AS    + 
Sbjct: 317 AETLNLGSVRGALVAGADDKGPAKAAGIEAGDVILKFDGVPIKESHDLPKIVASAPVGKD 376

Query: 357 VKISLCKEGSKHSVAVVLGS-------------SPTAKNDMHLEVGDKEL-LGMVLQDIN 402
           V++ L ++G + +  + LG               P   +         E  LGM    +N
Sbjct: 377 VEVVLLRQGKEITKTIKLGRLEDNEKQKAALTVRPGDDDKPPAANASMERALGMAFSGLN 436

Query: 403 DGNKKLV--------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           DG ++           ++  +   +     K IQ G  I+ +N   V    DV + + K 
Sbjct: 437 DGARRKYSIKQSVAAGVIVTDVEPDSGAAEKHIQPGDVIMEINQEPVKEPADVAKKVAKL 496

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           K+  + S LL +              RFV+L 
Sbjct: 497 KDDGKKSALLLVANG-------QGEMRFVALP 521


>gi|148254516|ref|YP_001239101.1| putative serine protease do-like [Bradyrhizobium sp. BTAi1]
 gi|146406689|gb|ABQ35195.1| Putative serine protease do-like precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 527

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 148/514 (28%), Positives = 240/514 (46%), Gaps = 39/514 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSS-------------TYLVLEAKLPPSSVDLPPVIARVSP 49
           ++  L    +  + +     S                +  E       V    ++ RV P
Sbjct: 25  RKFALMASVVAGLGVAAYGLSPQGAPLDLFSTSAHAQVANEVSKVARPVGFADIVERVKP 84

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVER-- 107
           S++SV V   +KV+     +   F       P++ +FR+   +      P          
Sbjct: 85  SVISVKVNIAEKVAKNDSDDDTPFQ---PGSPMERFFRRFGGENGIPGMPGRGGRGGGRA 141

Query: 108 -LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGFFI+ DGY +T+NH+V+      V   D     AK++GTD   DLA++KV+  
Sbjct: 142 VTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYSAKVIGTDQRTDLALIKVEGG 201

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPI 225
             F   +       R+G+ V  +GNPF L GTV+AGIVSA+ RDI + P   F QIDAP+
Sbjct: 202 SNFPFAK-LADGKPRIGDWVLAVGNPFGLGGTVTAGIVSAVGRDIGNGPYDDFIQIDAPV 260

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N+GNSGGP F+  G+V+GVN  I +     +G+   IP S +K  I  L   G V  GW 
Sbjct: 261 NKGNSGGPAFDVDGNVVGVNTAIYSPSGGSVGIAFSIPASTVKSVIAQLKDNGSVSRGWI 320

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q +TQ++A  LG++  +G+L+     + PA KAG++ GDVI  ++G  +K  ++  
Sbjct: 321 GVQIQPVTQDIADSLGMKKAEGALVAEPQADGPAAKAGIRSGDVITSVNGEPVKDARELA 380

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA---------KNDMHLEVGDKELLGM 396
             I   +P   VK+++ ++G + ++++ LG  P            N       D   LGM
Sbjct: 381 RTIGGLAPGASVKLNVLQKGQEKTISLTLGKLPNTIEAKADTGGDNSSPTRGADVPKLGM 440

Query: 397 VLQDIND-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
            +   +         +V    + +     +G ++G  I+ V    V+   DV   I  A+
Sbjct: 441 TVAPASSVAGAGKEGVVVTEVDPKSAAADRGFKEGDVILEVAGKSVTSAGDVREAINAAR 500

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              ++SVL+++K        +   SRFV++ + K
Sbjct: 501 NDNKNSVLMRVK--------SGGQSRFVAVPLAK 526


>gi|256113150|ref|ZP_05454027.1| protease Do [Brucella melitensis bv. 3 str. Ether]
 gi|265994563|ref|ZP_06107120.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765676|gb|EEZ11465.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 513

 Score =  226 bits (575), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 165/479 (34%), Positives = 257/479 (53%), Gaps = 34/479 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
            PP       ++ +V P++VSV V+   +       Q F   GF  LP+ HPLK +FR  
Sbjct: 46  TPPQQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFRDF 105

Query: 90  FHKFFSGEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
             +                        +  GSGF I++DGY++T+NH+V DG +++V+L 
Sbjct: 106 GMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLD 165

Query: 141 DDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D TEL AKL+G D   DLAVLK+    RKF+ V F D N +RVG+ V  +GNPF L GTV
Sbjct: 166 DGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTV 225

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +     +G+
Sbjct: 226 TSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGI 285

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +   + P
Sbjct: 286 AFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP 345

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V + + P
Sbjct: 346 AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMP 405

Query: 379 TAKNDMHLEVGDKE--------LLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
             K     +  D +          G+ +    DG      +V  + + + +   +GI+ G
Sbjct: 406 NDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDGK----GVVVTDVDPDSDAADRGIRSG 461

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L I++
Sbjct: 462 DVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALPINQ 512


>gi|15888320|ref|NP_354001.1| serine protease DO-like protease [Agrobacterium tumefaciens str.
           C58]
 gi|15155988|gb|AAK86786.1| serine protease DO-like protease [Agrobacterium tumefaciens str.
           C58]
          Length = 523

 Score =  226 bits (575), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 173/514 (33%), Positives = 277/514 (53%), Gaps = 41/514 (7%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKL---PPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           +  +V  +  + L+  I +       A +    P       V+  VSP++VSV V+   +
Sbjct: 21  KATTVGGLAALMLSTGIAAPILHSFAAPVEVTAPQVPSFANVVDAVSPAVVSVRVQSNVQ 80

Query: 62  VSVEQ------MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------ERLM 109
            + +        F   G   LP+DHPLK +F++   +     +   +           + 
Sbjct: 81  PASDDSSNFSFNFGGRGLDQLPDDHPLKRFFKEFGGQNQDRSDRGPNRHRDGKGPLRPVA 140

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGFFI++DGY++T+NH+V+DG++++V+++D TEL AKLVG D   DLA+LKV  +RKF
Sbjct: 141 QGSGFFISEDGYVVTNNHVVDDGSAYTVVMNDGTELEAKLVGRDPRTDLALLKVDVNRKF 200

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQG 228
             V+F D   IRVG+ V  +GNPF L GTV++GI+SA  RDI   P   + QIDA +N+G
Sbjct: 201 TYVKFADDTKIRVGDWVVAVGNPFGLGGTVTSGIISARGRDIGSGPYDDYLQIDAAVNRG 260

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G V+G+N  I +    ++G+   IP S+ K  I  L   G+V+ GW G+ 
Sbjct: 261 NSGGPAFNLNGEVVGINTAIFSPSGGNVGIAFAIPSSVAKDVIADLQKDGKVERGWLGVQ 320

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +++++A  LGL   KG+L+ +    SP DKAG+K GD+I  ++G  +K  +D   +I
Sbjct: 321 IQPVSKDIAESLGLAEAKGALVVSPQSGSPGDKAGIKQGDIITAVNGDPVKDARDLSRRI 380

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL-------------LG 395
              +P  +V+ISL + G   SV V LG   + +        + +              LG
Sbjct: 381 GGMAPNSKVEISLWRGGKSQSVTVTLGDLTSDEASKATPSQNDDKGGSQSSSEKVLSSLG 440

Query: 396 MVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
           + +   +DGN     +   + + + +  A+G++ G  I SVN  +V+   D+E+++ +AK
Sbjct: 441 LTVSPSDDGN----GLAITDVDPDSDAAARGLKTGEKITSVNNQQVASAADIEKILEQAK 496

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +  R   L QI+         D+ SRF++L ID+
Sbjct: 497 KDGRSKALFQIQ--------TDDGSRFIALDIDQ 522


>gi|325292355|ref|YP_004278219.1| serine protease DO-like protease [Agrobacterium sp. H13-3]
 gi|325060208|gb|ADY63899.1| serine protease DO-like protease [Agrobacterium sp. H13-3]
          Length = 517

 Score =  226 bits (574), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 175/513 (34%), Positives = 277/513 (53%), Gaps = 40/513 (7%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKL---PPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           +  +V  +  + L+  I +       A +    P       V+  VSP++VSV V+   +
Sbjct: 16  KATTVGGLAALMLSTGIAAPIVHSFAAPVEVTAPQVPSFANVVEAVSPAVVSVRVQSNVQ 75

Query: 62  VSVEQ------MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------ERLM 109
            + +        F   G   LP+DHPLK +F++         +   +           + 
Sbjct: 76  PASDDSSNFSFNFGGRGLDQLPDDHPLKRFFKEFGGPNQDRPDRGPNRHRDGKGPLRPVA 135

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGFFI++DGY++T+NH+V+DG++++V+++D TEL AKLVG D   DLA+LKV  +RKF
Sbjct: 136 QGSGFFISEDGYVVTNNHVVDDGSAYTVVMNDGTELEAKLVGRDPRTDLALLKVDVNRKF 195

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQG 228
             V+F D + IRVG+ V  +GNPF L GTV++GIVSA  RDI   P   + QIDA +N+G
Sbjct: 196 TYVQFADDSKIRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGSGPYDDYLQIDAAVNRG 255

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G V+G+N  I +    ++G+   IP S+ K  I  L   G+V+ GW G+ 
Sbjct: 256 NSGGPAFNLNGEVVGINTAIFSPSGGNVGIAFAIPSSVAKDVIADLQKDGKVERGWLGVQ 315

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +++++A  LGL   KG+L+ +    SP DKAG+K GD+I  ++G  +K  +D   +I
Sbjct: 316 IQPVSKDIAESLGLAEAKGALVVSPQSGSPGDKAGIKQGDIITAVNGDPVKDARDLSRRI 375

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL------------LGM 396
            S +P  +V+ISL + G   SV V LG   +          + +             LG+
Sbjct: 376 GSMTPNSKVEISLWRGGKSQSVTVTLGDLASDDASKATPGQENDSGSKPSSAKVLSSLGL 435

Query: 397 VLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
            +   +DGN     +   + + + +  A+G++ G  I SVN  +V+   D+E+++ +AK+
Sbjct: 436 TVAPADDGN----GLAITDVDPDSDAAARGLKTGEKITSVNNQQVASAADIEKVLEQAKK 491

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             R   L QI+         D+ SRF++L ID+
Sbjct: 492 DGRSKALFQIQ--------TDSGSRFIALDIDQ 516


>gi|17987613|ref|NP_540247.1| protease DO [Brucella melitensis bv. 1 str. 16M]
 gi|225852136|ref|YP_002732369.1| protease Do [Brucella melitensis ATCC 23457]
 gi|256044313|ref|ZP_05447217.1| protease Do [Brucella melitensis bv. 1 str. Rev.1]
 gi|256264352|ref|ZP_05466884.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563667|ref|ZP_05834153.1| serine protease [Brucella melitensis bv. 1 str. 16M]
 gi|265990725|ref|ZP_06103282.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|38257712|sp|Q8YG32|DEGP_BRUME RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|17983322|gb|AAL52511.1| protease do [Brucella melitensis bv. 1 str. 16M]
 gi|225640501|gb|ACO00415.1| protease Do [Brucella melitensis ATCC 23457]
 gi|260153683|gb|EEW88775.1| serine protease [Brucella melitensis bv. 1 str. 16M]
 gi|263001509|gb|EEZ14084.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094645|gb|EEZ18424.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408636|gb|ADZ65701.1| protease Do [Brucella melitensis M28]
 gi|326538358|gb|ADZ86573.1| protease Do [Brucella melitensis M5-90]
          Length = 513

 Score =  226 bits (574), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 165/479 (34%), Positives = 257/479 (53%), Gaps = 34/479 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
            PP       ++ +V P++VSV V+   +       Q F   GF  LP+ HPLK +FR  
Sbjct: 46  TPPQQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFRDF 105

Query: 90  FHKFFSGEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
             +                        +  GSGF I++DGY++T+NH+V DG +++V+L 
Sbjct: 106 GMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLD 165

Query: 141 DDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D TEL AKL+G D   DLAVLK+    RKF+ V F D N +RVG+ V  +GNPF L GTV
Sbjct: 166 DGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTV 225

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +     +G+
Sbjct: 226 TSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGI 285

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +   + P
Sbjct: 286 AFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP 345

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V + + P
Sbjct: 346 AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMP 405

Query: 379 TAKNDMHLEVGDKE--------LLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
             K     +  D +          G+ +    DG      +V  + + + +   +GI+ G
Sbjct: 406 NDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDGK----GVVVTDVDPDSDAADRGIRSG 461

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L I++
Sbjct: 462 DVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALPINQ 512


>gi|292490845|ref|YP_003526284.1| protease Do [Nitrosococcus halophilus Nc4]
 gi|291579440|gb|ADE13897.1| protease Do [Nitrosococcus halophilus Nc4]
          Length = 471

 Score =  226 bits (574), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 135/478 (28%), Positives = 227/478 (47%), Gaps = 28/478 (5%)

Query: 20  VIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
           V      L+  +       D   ++   SP++V++    K      ++   +G    PE 
Sbjct: 10  VFLVVLLLLASSPQAAGLPDFTELVKNSSPAVVNISTTQKVTQRGPRL--PHGLHQFPEG 67

Query: 80  HPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
            P +++FR+ F     GE      + E    GSGF I+ DGY++T+ H++ D     V  
Sbjct: 68  SPFEDFFRRFF-----GEGEGEPRSFETHSLGSGFIISSDGYVITNYHVIRDADEIIVRF 122

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           SD +EL A++VG D   DLA+LKV        ++  D++ ++VGE V  IG+PF    + 
Sbjct: 123 SDRSELEAEVVGGDERSDLALLKVNGKGL-PTLKQGDSSQLKVGEWVLAIGSPFGFEHSA 181

Query: 200 SAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGIVSAL R +P      F Q D  IN GNSGGP FN  G V+G+N+ I +     MG+
Sbjct: 182 TAGIVSALGRSLPRESYVPFIQTDVAINPGNSGGPLFNLAGEVVGINSQIYSRTGGFMGL 241

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP+ +  + +  L  KG+V  GW G++ Q++T+ELA   GL   +G+L+  V+ +SP
Sbjct: 242 SFAIPIDVAMEVVEQLKEKGQVSRGWLGVVIQDVTRELAESFGLEKPQGALVARVLADSP 301

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A K G++ GD+I   +G ++    D    +       +V + + +  ++ ++ V +G  P
Sbjct: 302 AAKGGIQAGDIITRFNGNLVPQSSDLPPLVGRTEIGHKVDVQILRASAQKTLKVKIGELP 361

Query: 379 TAKN----DMHLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKG 430
             +             ++ L + + D+ D  +  +     +              G+++G
Sbjct: 362 EEEELRKAVGRPGQTFEKRLAIEVTDLGDEERAQLDLTSGVQITRVEEG-PAAEAGLRRG 420

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             I+ +N  EV  I   + L+GK    K   +LLQ              + FV++KI 
Sbjct: 421 DIILGINNTEVKDISQFKELVGKLPAGKSVPLLLQ----------RGQTTSFVAIKIP 468


>gi|23501498|ref|NP_697625.1| serine protease [Brucella suis 1330]
 gi|62289573|ref|YP_221366.1| serine protease [Brucella abortus bv. 1 str. 9-941]
 gi|82699503|ref|YP_414077.1| serine protease family protein [Brucella melitensis biovar Abortus
           2308]
 gi|148559514|ref|YP_001258604.1| serine protease [Brucella ovis ATCC 25840]
 gi|161618586|ref|YP_001592473.1| protease Do [Brucella canis ATCC 23365]
 gi|163842886|ref|YP_001627290.1| protease Do [Brucella suis ATCC 23445]
 gi|189023832|ref|YP_001934600.1| Serine protease, V8 family [Brucella abortus S19]
 gi|225627118|ref|ZP_03785156.1| protease Do [Brucella ceti str. Cudo]
 gi|237815070|ref|ZP_04594068.1| protease Do [Brucella abortus str. 2308 A]
 gi|254688894|ref|ZP_05152148.1| Serine protease, V8 family protein [Brucella abortus bv. 6 str.
           870]
 gi|254693375|ref|ZP_05155203.1| Serine protease, V8 family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697026|ref|ZP_05158854.1| Serine protease, V8 family protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701405|ref|ZP_05163233.1| Serine protease, V8 family protein [Brucella suis bv. 5 str. 513]
 gi|254703950|ref|ZP_05165778.1| Serine protease, V8 family protein [Brucella suis bv. 3 str. 686]
 gi|254707672|ref|ZP_05169500.1| Serine protease, V8 family protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709745|ref|ZP_05171556.1| Serine protease, V8 family protein [Brucella pinnipedialis B2/94]
 gi|254713748|ref|ZP_05175559.1| Serine protease, V8 family protein [Brucella ceti M644/93/1]
 gi|254717194|ref|ZP_05179005.1| Serine protease, V8 family protein [Brucella ceti M13/05/1]
 gi|254729925|ref|ZP_05188503.1| Serine protease, V8 family protein [Brucella abortus bv. 4 str.
           292]
 gi|256031235|ref|ZP_05444849.1| Serine protease, V8 family protein [Brucella pinnipedialis
           M292/94/1]
 gi|256159338|ref|ZP_05457128.1| Serine protease, V8 family protein [Brucella ceti M490/95/1]
 gi|256254643|ref|ZP_05460179.1| Serine protease, V8 family protein [Brucella ceti B1/94]
 gi|256257142|ref|ZP_05462678.1| Serine protease, V8 family protein [Brucella abortus bv. 9 str.
           C68]
 gi|256369050|ref|YP_003106558.1| serine protease [Brucella microti CCM 4915]
 gi|260168371|ref|ZP_05755182.1| serine protease [Brucella sp. F5/99]
 gi|260545666|ref|ZP_05821407.1| serine protease [Brucella abortus NCTC 8038]
 gi|260566801|ref|ZP_05837271.1| HtrA protein [Brucella suis bv. 4 str. 40]
 gi|260754379|ref|ZP_05866727.1| serine endoprotease [Brucella abortus bv. 6 str. 870]
 gi|260757598|ref|ZP_05869946.1| serine endoprotease [Brucella abortus bv. 4 str. 292]
 gi|260761424|ref|ZP_05873767.1| serine endoprotease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883404|ref|ZP_05895018.1| HtrA [Brucella abortus bv. 9 str. C68]
 gi|261213625|ref|ZP_05927906.1| serine endoprotease [Brucella abortus bv. 3 str. Tulya]
 gi|261219010|ref|ZP_05933291.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221818|ref|ZP_05936099.1| HtrA [Brucella ceti B1/94]
 gi|261315168|ref|ZP_05954365.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317276|ref|ZP_05956473.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321490|ref|ZP_05960687.1| serine protease [Brucella ceti M644/93/1]
 gi|261751944|ref|ZP_05995653.1| serine endoprotease [Brucella suis bv. 5 str. 513]
 gi|261754602|ref|ZP_05998311.1| serine endoprotease [Brucella suis bv. 3 str. 686]
 gi|261757831|ref|ZP_06001540.1| serine protease [Brucella sp. F5/99]
 gi|265988314|ref|ZP_06100871.1| HtrA [Brucella pinnipedialis M292/94/1]
 gi|265997782|ref|ZP_06110339.1| HtrA [Brucella ceti M490/95/1]
 gi|297247988|ref|ZP_06931706.1| serine protease [Brucella abortus bv. 5 str. B3196]
 gi|60392175|sp|P0A3Z5|DEGP_BRUSU RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|88911283|sp|Q2YMX6|DEGP_BRUA2 RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|90109771|sp|P0C114|DEGP_BRUAB RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|497157|gb|AAA70164.1| htrA [Brucella abortus]
 gi|23347404|gb|AAN29540.1| serine protease [Brucella suis 1330]
 gi|62195705|gb|AAX74005.1| serine protease [Brucella abortus bv. 1 str. 9-941]
 gi|82615604|emb|CAJ10591.1| Serine proteases, V8 family:Serine protease, trypsin
           family:PDZ/DHR/GLGF domain:HtrA/DegQ protease [Brucella
           melitensis biovar Abortus 2308]
 gi|122831091|gb|ABM66832.1| HtrA [Brucella melitensis]
 gi|148370771|gb|ABQ60750.1| serine protease [Brucella ovis ATCC 25840]
 gi|161335397|gb|ABX61702.1| protease Do [Brucella canis ATCC 23365]
 gi|163673609|gb|ABY37720.1| protease Do [Brucella suis ATCC 23445]
 gi|189019404|gb|ACD72126.1| Serine protease, V8 family [Brucella abortus S19]
 gi|225617953|gb|EEH14997.1| protease Do [Brucella ceti str. Cudo]
 gi|237789907|gb|EEP64117.1| protease Do [Brucella abortus str. 2308 A]
 gi|255999210|gb|ACU47609.1| serine protease [Brucella microti CCM 4915]
 gi|260097073|gb|EEW80948.1| serine protease [Brucella abortus NCTC 8038]
 gi|260156319|gb|EEW91399.1| HtrA protein [Brucella suis bv. 4 str. 40]
 gi|260667916|gb|EEX54856.1| serine endoprotease [Brucella abortus bv. 4 str. 292]
 gi|260671856|gb|EEX58677.1| serine endoprotease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674487|gb|EEX61308.1| serine endoprotease [Brucella abortus bv. 6 str. 870]
 gi|260872932|gb|EEX80001.1| HtrA [Brucella abortus bv. 9 str. C68]
 gi|260915232|gb|EEX82093.1| serine endoprotease [Brucella abortus bv. 3 str. Tulya]
 gi|260920402|gb|EEX87055.1| HtrA [Brucella ceti B1/94]
 gi|260924099|gb|EEX90667.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294180|gb|EEX97676.1| serine protease [Brucella ceti M644/93/1]
 gi|261296499|gb|EEX99995.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261304194|gb|EEY07691.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261737815|gb|EEY25811.1| serine protease [Brucella sp. F5/99]
 gi|261741697|gb|EEY29623.1| serine endoprotease [Brucella suis bv. 5 str. 513]
 gi|261744355|gb|EEY32281.1| serine endoprotease [Brucella suis bv. 3 str. 686]
 gi|262552250|gb|EEZ08240.1| HtrA [Brucella ceti M490/95/1]
 gi|264660511|gb|EEZ30772.1| HtrA [Brucella pinnipedialis M292/94/1]
 gi|297175157|gb|EFH34504.1| serine protease [Brucella abortus bv. 5 str. B3196]
          Length = 513

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 165/479 (34%), Positives = 257/479 (53%), Gaps = 34/479 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
            PP       ++ +V P++VSV V+   +       Q F   GF  LP+ HPLK +FR  
Sbjct: 46  TPPPQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFRDF 105

Query: 90  FHKFFSGEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
             +                        +  GSGF I++DGY++T+NH+V DG +++V+L 
Sbjct: 106 GMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLD 165

Query: 141 DDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D TEL AKL+G D   DLAVLK+    RKF+ V F D N +RVG+ V  +GNPF L GTV
Sbjct: 166 DGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTV 225

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +     +G+
Sbjct: 226 TSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGI 285

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +   + P
Sbjct: 286 AFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP 345

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V + + P
Sbjct: 346 AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMP 405

Query: 379 TAKNDMHLEVGDKE--------LLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
             K     +  D +          G+ +    DG      +V  + + + +   +GI+ G
Sbjct: 406 NDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDGK----GVVVTDVDPDSDAADRGIRSG 461

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L I++
Sbjct: 462 DVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALPINQ 512


>gi|83942980|ref|ZP_00955440.1| periplasmic serine protease, DO/DeqQ family protein [Sulfitobacter
           sp. EE-36]
 gi|83845988|gb|EAP83865.1| periplasmic serine protease, DO/DeqQ family protein [Sulfitobacter
           sp. EE-36]
          Length = 494

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 138/490 (28%), Positives = 237/490 (48%), Gaps = 37/490 (7%)

Query: 17  LTCVIFSSTYLVLEAKLP-PSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGN 75
           L   + +  +++++A +       L P+  ++SPS+V++      +            G 
Sbjct: 21  LMMGMLALAFVLMQAVVALAKPESLAPLAEKISPSVVNITTSTTVEGRTG------PRGI 74

Query: 76  LPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASF 135
           +PE  P +++F++   +   GE P      +    GSGF I++DG+++T+NH++E     
Sbjct: 75  VPEGSPFEDFFKEFRDRNNGGEAPAP---RKSSALGSGFVISEDGFVVTNNHVIEGADEI 131

Query: 136 SVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRL 195
           ++      EL A+++GTD   D+A+LKV++      V F D+N  RVG+ V  +GNP   
Sbjct: 132 TIEFFTGLELKAEVIGTDPNTDIALLKVEAPSALPFVSFGDSNAARVGDWVLAMGNPLGQ 191

Query: 196 RGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
             +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     
Sbjct: 192 GFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPNGGS 251

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  +  +++ + +  L   G    GW G+  Q++TQ++A  +GL    G+LIT  V 
Sbjct: 252 IGIGFSMASNVVTRVVNQLKEFGETRRGWLGVRIQDVTQDVADAMGLAKASGALITD-VP 310

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           + PA  AG+K GDVI    G  ++  +  V Q+ + +    V++++ +EG   ++ V LG
Sbjct: 311 DGPAKDAGLKTGDVILSFAGVEVEDTRGLVRQVGNSTVGASVRVTVLREGKSQTLKVKLG 370

Query: 376 SSPT-----------AKNDMHLEVGDKELLGMVLQDINDGNKKLVR-------IVALNPN 417
                                     K +LG+ +  + D  +  +        +     +
Sbjct: 371 RREDAEGAGASASAPEDEAEPEAPASKSVLGLTITPLTDDLRTELGADDSVEGLAVTEVD 430

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
              E   KG++ G  I       +  I D+E  I +AK+  R S+LL ++   D      
Sbjct: 431 EMSEAFEKGLRVGDIITEAEQQPILSITDLEDRITEAKDGGRKSLLLLVRRAGD------ 484

Query: 478 NMSRFVSLKI 487
              RFV+L +
Sbjct: 485 --PRFVALGL 492


>gi|297569465|ref|YP_003690809.1| protease Do [Desulfurivibrio alkaliphilus AHT2]
 gi|296925380|gb|ADH86190.1| protease Do [Desulfurivibrio alkaliphilus AHT2]
          Length = 489

 Score =  225 bits (572), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 138/493 (27%), Positives = 223/493 (45%), Gaps = 32/493 (6%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA 70
           +   + +   + +   L               +  ++ PS+V++      +         
Sbjct: 12  AAVRLFVVFSLTALLVLAAATGRAAPPPSFADLAEKLGPSVVNIYTTQTVQA------PG 65

Query: 71  YGFGNLPEDHPLKNYFRKDFH------KFFSGEEPI--LSDTVERLMFGSGFFITDDGYI 122
                  E   L   FR+ F       +   G  P       ++R   GSG  I+ DGYI
Sbjct: 66  SPHQFFFEGEELPELFRRFFDLPSPHSRPPGGTPPRGTPPREMQRTSLGSGVVISPDGYI 125

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+VE+  S ++ L++  E  A++VG D   DLA+LK++       V   D+  +RV
Sbjct: 126 VTNNHVVENADSINIRLTNFEEYDAEVVGRDPKTDLALLKIEPRNPLPAVTMGDSEALRV 185

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHV 241
           G+ V  IGNPF    TV+AGIVS   R +   P   F Q DA IN GNSGGP FN  G +
Sbjct: 186 GDWVIAIGNPFGFEQTVTAGIVSGKGRSLGSGPYENFIQTDASINPGNSGGPLFNLQGEM 245

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I + G  ++G+G  IP+++ K  I  +   G V  GW G++ Q++T ELA    
Sbjct: 246 VGINTAIYSRGGGNIGIGFAIPVNMAKNIIGQIQEHGTVTRGWLGVLIQHVTPELARQFQ 305

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L    G+L+  V  ESPA +AGM+ GDVI   DG+ I         +A      +V + +
Sbjct: 306 LDRPIGALVGEVSPESPAAEAGMRPGDVIVEYDGKEITQMSMVPTLVAQTPVGSEVPVKV 365

Query: 362 CKEGSKHSVAVVLGSS-PTAKNDMHLEVGDKELLGMVLQDIND------GNKKLVRIVAL 414
            + G +  + V +G      +         +E LG+ +Q++ +      G K+ V ++  
Sbjct: 366 IRRGQETELLVTIGKLDEDDQPAAPRTREAEEKLGLGVQELTEEVARSLGLKEQVGVLIS 425

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           +       +  G+++G  IV VN      + +   L+  A EK    VLL +        
Sbjct: 426 HVEPGSPAQRAGLRRGEVIVEVNQQPAGNLTEYAELMAAALEKGE--VLLLVNRG----- 478

Query: 475 GNDNMSRFVSLKI 487
                 RFV++ +
Sbjct: 479 ---GQHRFVAISV 488


>gi|146339742|ref|YP_001204790.1| putative serine protease do-like [Bradyrhizobium sp. ORS278]
 gi|146192548|emb|CAL76553.1| Putative serine protease do-like precursor [Bradyrhizobium sp.
           ORS278]
          Length = 528

 Score =  225 bits (572), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 150/515 (29%), Positives = 237/515 (46%), Gaps = 40/515 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSS-------------TYLVLEAKLPPSSVDLPPVIARVSP 49
           ++  L    +  + +     S                +  E       V    ++ RV P
Sbjct: 25  RKFALMASVVAGLGVAAYGLSPQGAPLDLFSTSAHAQVANEVSKVARPVGFADIVERVKP 84

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVER-- 107
           S++SV V   +KV+     +   F       P++ +FR+   +      P          
Sbjct: 85  SVISVKVNIAEKVAKNDNDDDTPFQ---PGSPMERFFRRFGGENGIPGMPGRGGRGGGRA 141

Query: 108 -LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGFFI+ DGY +T+NH+V+      V   D     AK++GTD   DLA++KV+  
Sbjct: 142 VTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYSAKVIGTDQRTDLALIKVEGG 201

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPI 225
             F   +       R+G+ V  +GNPF L GTV+AGIVSA+ RDI + P   F QIDAP+
Sbjct: 202 SNFPFAK-LADGKPRIGDWVLAVGNPFGLGGTVTAGIVSAVGRDIGNGPYDDFIQIDAPV 260

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N+GNSGGP F+  G+V+GVN  I +     +G+   IP S +K  I  L   G V  GW 
Sbjct: 261 NKGNSGGPAFDVDGNVVGVNTAIYSPSGGSVGIAFSIPASTVKSVIAQLKDNGSVSRGWI 320

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q +TQ++A  LG++  +G+L+       PA KAG+  GDVI  ++G+ +K  ++  
Sbjct: 321 GVQIQPVTQDIADSLGMKKAEGALVAEPQANGPAAKAGIVSGDVITAVNGQPVKDARELA 380

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA----------KNDMHLEVGDKELLG 395
             I   +P   VK+++  +G + +V + LG  P             N       D   LG
Sbjct: 381 RTIGGIAPGAAVKLNVLSKGQEKTVNLTLGKLPNTVEAKADNDNGDNSSPTRGADVPKLG 440

Query: 396 MVLQDIND-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           M +   +         +V    + +     +G ++G  I+ V    V+   DV   I  A
Sbjct: 441 MTVAPASSVAGAGKDGVVVTEVDPKSAAADRGFKEGDVILEVAGKSVTSAGDVREAINAA 500

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           K   ++SVL+++K        +   SRFV++ + K
Sbjct: 501 KADNKNSVLMRVK--------SGGQSRFVAVPLAK 527


>gi|144899065|emb|CAM75929.1| Peptidase S1C, Do [Magnetospirillum gryphiswaldense MSR-1]
          Length = 493

 Score =  225 bits (572), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 134/469 (28%), Positives = 220/469 (46%), Gaps = 34/469 (7%)

Query: 37  SVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
                 +  ++ P++V++      K               P   P +++F++   +    
Sbjct: 35  PGSFADLAEKLLPAVVNISTTQTIK----NPERIPEMPQFPPGSPFEDFFKEFMERQARP 90

Query: 97  EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
           +             GSGF I   GY++T+NH++ D    +V L DDT   A L+G D+  
Sbjct: 91  DAAPK----RATSLGSGFVIDAAGYVVTNNHVIADADEITVTLHDDTTHKATLIGRDSKT 146

Query: 157 DLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
           DLAVLK+    +    V F +++  R+G+ V  IGNPF L GTV+AGIVSA  RDI   P
Sbjct: 147 DLAVLKIDPGKKTLTAVPFGNSDLSRIGDWVLAIGNPFGLGGTVTAGIVSARARDINAGP 206

Query: 216 GT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q DA IN+GNSGGP FN+ G V+G+N  I +     +G+G  IP ++ K  I  L
Sbjct: 207 YDDFIQTDASINRGNSGGPLFNSAGEVVGINTAIFSPSGGSIGIGFAIPSTLAKPVIDDL 266

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
              GR   GW G+  Q+L  ELA  +GL  +KG+L+ +V    PA KA +K GDVI   D
Sbjct: 267 KQFGRTRRGWLGVRIQSLDPELAESMGLTESKGALVASVNAGGPAAKANLKPGDVILKFD 326

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL 394
           GR I   +     +A  +  ++  + + ++G +  V V +G  P    ++  +  +K   
Sbjct: 327 GRDITEMRKLPRIVAETAIGKKAPVEIWRDGKRVIVDVAVGELPEEPEEVASKSPEKPQT 386

Query: 395 ----------GMVLQDINDGNKKLVRI------VALNPNREREVEAKGIQKGMTIVSVNT 438
                     G+ +  +N   ++   +      + +   ++     KG++ G  I+    
Sbjct: 387 QAQGQVIAGTGLTVSALNPALRERFGLEEDTAGLVVTEVKDGPAAEKGMKPGDVIIEAGN 446

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             V    D+ + +  AK   +  +LL+++        N    R+V+L +
Sbjct: 447 KPVRNPADLTKAVEAAKASSQKFLLLRVE--------NPQALRYVALPL 487


>gi|254718760|ref|ZP_05180571.1| Serine protease, V8 family protein [Brucella sp. 83/13]
 gi|265983738|ref|ZP_06096473.1| serine protease [Brucella sp. 83/13]
 gi|306838736|ref|ZP_07471571.1| protease Do [Brucella sp. NF 2653]
 gi|264662330|gb|EEZ32591.1| serine protease [Brucella sp. 83/13]
 gi|306406223|gb|EFM62467.1| protease Do [Brucella sp. NF 2653]
          Length = 513

 Score =  225 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 165/479 (34%), Positives = 258/479 (53%), Gaps = 34/479 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
            PP       ++ +V P++VSV V+   +      +Q F   GF  LP+ HPLK +FR  
Sbjct: 46  TPPPQAGFADLVEKVRPAVVSVRVKKDVQEASNRGQQFFGPPGFDQLPDGHPLKRFFRDF 105

Query: 90  FHKFFSGEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
             +                        +  GSGF I++DGY++T+NH+V DG +++V+L 
Sbjct: 106 GMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLD 165

Query: 141 DDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D TEL AKL+G D   DLAVLK+    RKF+ V F D N +RVG+ V  +GNPF L GTV
Sbjct: 166 DGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTV 225

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +     +G+
Sbjct: 226 TSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGI 285

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +   + P
Sbjct: 286 AFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP 345

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V + + P
Sbjct: 346 AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMP 405

Query: 379 TAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
             K     +  D         +  G+ +    DG      +V  + + + +   +GI+ G
Sbjct: 406 NDKGKSGSQSNDNGGGQGETLDSYGLTVVSSEDGK----GVVVTDVDPDSDAADRGIRSG 461

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L I++
Sbjct: 462 DVIVSVNNQTVKTASDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALPINQ 512


>gi|27378241|ref|NP_769770.1| DO-like serine protease [Bradyrhizobium japonicum USDA 110]
 gi|27351388|dbj|BAC48395.1| serine protease DO-like precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 525

 Score =  225 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 150/519 (28%), Positives = 234/519 (45%), Gaps = 43/519 (8%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPS--------------------SVDLPP 42
           +R + S + I  +A     F +        + P+                     V    
Sbjct: 17  RRSVFSARKIALMASVVAGFGAAVYGFSPSVSPADLFSSPAHAQVNNEVRKVERPVGFAD 76

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV V  K+K +     +       P   P++ +FR+              
Sbjct: 77  IVERVKPSVISVKVNIKEKTASNDDGDDSSSPFQP-GSPMERFFRRFGG-PDGIPGMKGG 134

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
                   GSGFFI+ DG+ +T+NH+V+      V   D     AK++GTD   DLA++K
Sbjct: 135 RGRVVQGQGSGFFISADGFAVTNNHVVDGADKVEVTTDDGKTYTAKVIGTDQRTDLALIK 194

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQI 221
           V+    F   +       R+G+ V  +GNPF L GTV+AGIVSA  RDI + P   F QI
Sbjct: 195 VEGGSNFPFAKLA-DGKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDFIQI 253

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DAP+N+GNSGGP FN  G V+GVN  I +     +G+   IP + +K  +  L  KG V 
Sbjct: 254 DAPVNKGNSGGPAFNTDGEVMGVNTAIYSPSGGSVGIAFSIPANTVKTVVAQLKDKGSVS 313

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            GW G+  Q +T ++A  LG++  +G+L+       PA KAG++ GDVI  ++G  +K  
Sbjct: 314 RGWIGVQIQPVTSDIADSLGMKKAEGALVAEPQANGPAAKAGIESGDVITSVNGESVKDA 373

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK---------- 391
           ++    I   +P   VK+++  +G    V + LG  P           D           
Sbjct: 374 RELARTIGGMAPGAIVKLNVLHKGQDKVVNLTLGQLPNTVEAKADTDNDSGKGATKGTDV 433

Query: 392 ELLGMVLQDIND-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
             LGM +   N         +V    + +     +G ++G  I+ V    VS   DV   
Sbjct: 434 PKLGMTVAPANSVAGAGKEGVVVTEVDPKSAAAERGFKEGDVILEVGGKSVSTAGDVREA 493

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           I  A+   ++SVL+++K        +   SRFV++ + K
Sbjct: 494 INTARTDNKNSVLMRVK--------SGGQSRFVAIPLAK 524


>gi|254502930|ref|ZP_05115081.1| protease Do subfamily [Labrenzia alexandrii DFL-11]
 gi|222439001|gb|EEE45680.1| protease Do subfamily [Labrenzia alexandrii DFL-11]
          Length = 500

 Score =  225 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 153/504 (30%), Positives = 248/504 (49%), Gaps = 27/504 (5%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPP------SSVDLPPVIARVSPSIVSVMV 56
           +R  L   ++   A   +   +      A+  P      +  D   V+  VSP++VSV V
Sbjct: 4   RRAKLLAGAVVLGAAGLMTVQTIVPAQLAQATPVRIDNAAPADFSDVVGAVSPAVVSVQV 63

Query: 57  EPKKKVSVEQMFNA----YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-RLMFG 111
           +   +  +            F +LP  HP + +FR    +      P      +  +  G
Sbjct: 64  KQAAEPRMMNFNGGNNFRDFFEDLPNGHPFERFFRDFGERGGEEGRPQRPTPRQYGMSQG 123

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGFFI+ DG+++T+ H+++ G  F+VI  +  E  A L+G D   DLA+LK+   + F  
Sbjct: 124 SGFFISADGFVVTNQHVIDKGTEFTVIDHEGEEYDAVLIGADKRTDLALLKIDGGKDFTY 183

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNS 230
           V+F       VGE    IGNPF L G+V+AGIVSA  RDI   P   F QIDAP+N+GNS
Sbjct: 184 VDFA-DEAPEVGEWTVAIGNPFGLGGSVTAGIVSARGRDIGAGPYDDFIQIDAPVNRGNS 242

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP FN  G VIGVNA I +    ++G+   IP S  +  I  L   G V  GW G+  Q
Sbjct: 243 GGPAFNMNGEVIGVNAAIFSPSGGNVGIAFAIPASTAQDVIMELKDDGTVVRGWLGVQIQ 302

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
           N+T ++A  LGL    G++++   + SPA KAG++ GD I  ++G  +   +D    IA+
Sbjct: 303 NVTDDIAESLGLDEAHGAIVSEAQEGSPAAKAGLRSGDTILEVEGAKVDGPRDLSKIIAA 362

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPT------AKNDMHLEVGDKELLGMVLQDINDG 404
             P   V+I++ ++G +  + V LG              +  +    + +G+VL    D 
Sbjct: 363 YDPDTSVEITVWRDGKEQDIDVTLGRLQDQQQAAAEPEAVEQQKTSLDDMGLVLTSKADA 422

Query: 405 NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
                 ++  + + +     K + +G  I+ V    V+  +DV + + KA+E  R +VL 
Sbjct: 423 GLDGNGVLIADIDPDSPASEKRLSRGDVILEVAGMPVNSPEDVIKAVKKAEEDGRKAVLF 482

Query: 465 QIKYDPDMQSGNDNMSRFVSLKID 488
           +++        +++ +RFV+L ++
Sbjct: 483 RVE--------SNDNTRFVALPMN 498


>gi|256060743|ref|ZP_05450907.1| Serine protease, V8 family protein [Brucella neotomae 5K33]
 gi|261324733|ref|ZP_05963930.1| HtrA [Brucella neotomae 5K33]
 gi|261300713|gb|EEY04210.1| HtrA [Brucella neotomae 5K33]
          Length = 513

 Score =  225 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 164/479 (34%), Positives = 257/479 (53%), Gaps = 34/479 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
            PP       ++ +V P++VSV V+   +       Q F   GF  LP+ HPLK +FR  
Sbjct: 46  TPPPQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFRDF 105

Query: 90  FHKFFSGEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
             +                        +  GSGF I++DGY++T+NH+V DG +++V+L 
Sbjct: 106 GMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLD 165

Query: 141 DDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D TEL AKL+G D   DLAVLK+    RKF+ V F D N +RVG+ V  +GNPF L GTV
Sbjct: 166 DGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTV 225

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +     +G+
Sbjct: 226 TSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGI 285

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +   + P
Sbjct: 286 AFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP 345

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V + + P
Sbjct: 346 AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMP 405

Query: 379 TAKNDMHLEVGDKE--------LLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
             K     +  D +          G+ +    DG      ++  + + + +   +GI+ G
Sbjct: 406 NDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDGK----GVIVTDVDPDSDAADRGIRSG 461

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L I++
Sbjct: 462 DVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALPINQ 512


>gi|91976488|ref|YP_569147.1| peptidase S1C, Do [Rhodopseudomonas palustris BisB5]
 gi|91682944|gb|ABE39246.1| Peptidase S1C, Do [Rhodopseudomonas palustris BisB5]
          Length = 526

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 143/517 (27%), Positives = 235/517 (45%), Gaps = 44/517 (8%)

Query: 3   KRQILSVKSICTVA-LTCVIFSSTYLVLEAKLP-------------------PSSVDLPP 42
           +R +LS +    +A +   + +  + + +   P                      V    
Sbjct: 18  RRSLLSARKFALMASVVAGLGAGAFGLSQTSTPVDLFSTPAHAQVGNKVNQAQQPVGFAD 77

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ +V PS+  + V+        +  +           P++ +FR+   +   G      
Sbjct: 78  IVEKVKPSV--ISVKVNIAEKTAKNEDRAEDSPFQPGSPMERFFRRFGGEMPPGMRGHRG 135

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
                   GSGFFI+ DGY +T+NH+V+      V   D     AK++GTD   DLA++K
Sbjct: 136 G-GTMTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTDLALIK 194

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQI 221
            +    F   +  +    R+G+ V  +GNPF L GTV+AGIVSA  RDI + P   F QI
Sbjct: 195 AEGRTDFPFAKLSE-GKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDFIQI 253

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DAP+N+GNSGGP F+  G V+GVN  I +     +G+   IP S +K  +  L  KG V 
Sbjct: 254 DAPVNKGNSGGPAFDTNGEVMGVNTAIYSPSGGSVGIAFSIPASTVKTVVQQLKDKGSVS 313

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            GW G+  Q +T E+A  LGL+   G+L+       PA KAG++ GDVI  ++G  +K  
Sbjct: 314 RGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGPAAKAGIESGDVITAVNGTPVKDA 373

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK---------- 391
           ++    I   +P   VK+++  +G+   + + LG  P        + GD           
Sbjct: 374 RELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLPNQVEAKVNDGGDNGNSSSRGTEV 433

Query: 392 ELLGMVLQDIND-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
             LG+ +   +         +V  + + +     +G ++G  I+ V    V+   DV   
Sbjct: 434 PRLGLTVAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVAGKNVASPGDVREA 493

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           I  AK   ++SVL++++        +   SRFV++ I
Sbjct: 494 INTAKADNKNSVLIRVR--------SGGSSRFVAVPI 522


>gi|163733305|ref|ZP_02140748.1| serine protease DO-like precursor, putative [Roseobacter litoralis
           Och 149]
 gi|161393093|gb|EDQ17419.1| serine protease DO-like precursor, putative [Roseobacter litoralis
           Och 149]
          Length = 487

 Score =  224 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 138/490 (28%), Positives = 237/490 (48%), Gaps = 37/490 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
             +  ++  +  LV    +      L P+  ++SPS+V++        S          G
Sbjct: 20  FLVIAILAMAFALVAPVTVLAQPASLAPLAEKISPSVVNI------TTSTTVSRRTGPQG 73

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            +PE  P +++FR                       GSGF I++DGY++T+NH++E    
Sbjct: 74  IVPEGSPFEDFFRD-------RNNGPEGAPRRSSALGSGFVISEDGYVVTNNHVIEGADE 126

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             +   D  EL A+++GTD   D+A+LKV+++     V F D+++ RVG+ V  +GNP  
Sbjct: 127 ILIEFFDGGELVAEVMGTDPNTDIALLKVETNEPLPFVSFGDSDSSRVGDWVIAMGNPLG 186

Query: 195 LRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
              +VSAGIVSA +R++  R   + Q DA IN+GNSGGP FN  G VIGVN  I++    
Sbjct: 187 QGFSVSAGIVSARNRELSGRYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPTGG 246

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+G  +  +++ + +  L   G    GW G+  Q++T+++A  +GL  T G+     V
Sbjct: 247 SIGLGFSMASNVVTRVVDQLQEFGETRRGWLGVQIQDVTEDMAEAMGLASTDGA-AVNGV 305

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            E PA  AG+++GDVI   DGR ++  +  V Q+ +    E V++ + +     ++ V L
Sbjct: 306 LEGPALDAGIEIGDVIISFDGRDVEDTRGLVRQVGNTPVGEAVRVVVRRGDETKTLLVTL 365

Query: 375 GSSPTAKND--------MHLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNRE 419
           G    A+                  E++G+ L  + D  ++ +        +  +  +  
Sbjct: 366 GRREEAEGATPAVAQAPQEDAPTSAEMMGLTLMVLTDELREQLGAKPETEGLAVMEVDEA 425

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNM 479
            E   KG++ G  I      +V+ I D+E  + +AK+  R S+LL ++   D        
Sbjct: 426 SEAFEKGLRSGDVITEAGQKKVTSIADLETRVEEAKDAGRKSLLLLVRRAGD-------- 477

Query: 480 SRFVSLKIDK 489
            RFV+L + +
Sbjct: 478 PRFVALSLAE 487


>gi|306842119|ref|ZP_07474788.1| protease Do [Brucella sp. BO2]
 gi|306287706|gb|EFM59137.1| protease Do [Brucella sp. BO2]
          Length = 513

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 165/479 (34%), Positives = 258/479 (53%), Gaps = 34/479 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
            PP       ++ +V P++VSV V+   +      +Q F   GF  LP+ HPLK +FR  
Sbjct: 46  TPPQQAGFADLVEKVRPAVVSVRVKKDVQEASNRDQQFFGPPGFDQLPDGHPLKRFFRDF 105

Query: 90  FHKFFSGEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
             +                        +  GSGF I++DGY++T+NH+V DG +++V+L 
Sbjct: 106 GMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLD 165

Query: 141 DDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D TEL AKL+G D   DLAVLK+    RKF+ V F D N +RVG+ V  +GNPF L GTV
Sbjct: 166 DGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTV 225

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +     +G+
Sbjct: 226 TSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGI 285

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +   + P
Sbjct: 286 AFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP 345

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V + + P
Sbjct: 346 AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMP 405

Query: 379 TAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
             K     +  D         +  G+ +    DG      +V  + + + +   +GI+ G
Sbjct: 406 NDKGKSGSQSNDNGGGQGETLDSYGLTVVPSEDGK----GVVVTDVDPDSDAADRGIRSG 461

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L I++
Sbjct: 462 DVIVSVNNQMVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALPINQ 512


>gi|30250256|ref|NP_842326.1| mucD; serine protease MucD precursor [Nitrosomonas europaea ATCC
           19718]
 gi|30181051|emb|CAD86241.1| mucD; serine protease MucD precursor [Nitrosomonas europaea ATCC
           19718]
          Length = 496

 Score =  223 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 143/488 (29%), Positives = 238/488 (48%), Gaps = 32/488 (6%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           K I  + L    F  +  +    LP    D   ++ +   ++V++     +++     F 
Sbjct: 31  KGIFAICLLVAAFMLSASLHAKDLP----DFTDLVEKHGQAVVNISTVQTQQIDANHFF- 85

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
             G  N+PED P   +FR+    F            E    GSGF I+ DGYILT+ H+V
Sbjct: 86  -PGIPNIPEDSPFYEFFRRHMQPFSG------PRKYESRSLGSGFIISKDGYILTNAHVV 138

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           E     +V L+D  E  AK++GTD   D+A+LK+ +D     V     + ++VGE V  I
Sbjct: 139 ESANEITVRLTDKREFGAKVIGTDRKTDIALLKIDADDL-PVVTQGSPDQLKVGEWVIAI 197

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G PF    TV+AGIVSA  R +       F Q D  IN GNSGGP FN  G V+G+N+ I
Sbjct: 198 GAPFGFENTVTAGIVSAKGRSLAQENYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQI 257

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     MG+   IP+ +  +    L + G+V  G  G+M Q +T ELA    L  ++G+
Sbjct: 258 YSRTGGFMGLSFAIPIDVAMEITSQLKAYGKVSRGKIGVMIQEMTDELAESFNLDKSRGA 317

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+ +V K+ PADKAG+K+ DVI   DG+ I +  D    + +  P  +V + + + GS  
Sbjct: 318 LVVSVEKDGPADKAGIKIRDVILRFDGKGIDTSSDLPRIVGNTKPDARVSVEVWRNGSVK 377

Query: 369 SVAVVLGSSPTAKNDMHLEVGDKE-----LLGMVLQDINDGNKKLVRI---VALNPNRER 420
            + V +G  P   +   ++   K       LG+ L++++   K  + I   + +    + 
Sbjct: 378 KLTVTVGEMPGDDSSTTVQKQSKSGDATSRLGLALRELSASQKNELGIDSGLLVEEVYDG 437

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
              + GI+ G  I+  N  ++  I+   +L+  AK+ +  ++L++            +++
Sbjct: 438 IASSAGIRPGDVILGFNNQDIKSIQQFNKLLDDAKKGRNIALLIK----------RGDIT 487

Query: 481 RFVSLKID 488
            F+++KI+
Sbjct: 488 TFITIKIN 495


>gi|306845217|ref|ZP_07477793.1| protease Do [Brucella sp. BO1]
 gi|306274376|gb|EFM56183.1| protease Do [Brucella sp. BO1]
          Length = 513

 Score =  223 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 165/479 (34%), Positives = 258/479 (53%), Gaps = 34/479 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
            PP       ++ +V P++VSV V+   +      +Q F   GF  LP+ HPLK +FR  
Sbjct: 46  TPPQQAGFADLVEKVRPAVVSVRVKKDVQEASNRDQQFFGPPGFDQLPDGHPLKRFFRDF 105

Query: 90  FHKFFSGEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
             +                        +  GSGF I++DGY++T+NH+V DG +++V+L 
Sbjct: 106 GMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLD 165

Query: 141 DDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D TEL AKL+G D   DLAVLK+    RKF+ V F D N +RVG+ V  +GNPF L GTV
Sbjct: 166 DGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTV 225

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +     +G+
Sbjct: 226 TSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGI 285

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++ +   + P
Sbjct: 286 AFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP 345

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V + + P
Sbjct: 346 AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMP 405

Query: 379 TAKNDMHLEVGDK--------ELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
             K     +  D         +  G+ +    DG      +V  + + + +   +GI+ G
Sbjct: 406 NDKGKTGSQSNDNGGGQGETLDSYGLTVVPSEDGK----GVVVTDVDPDSDAADRGIRSG 461

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IVSVN   V    D+ + I  A++  R +VLLQ++        +++ SRFV+L I++
Sbjct: 462 DVIVSVNNQMVKTAGDINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALPINQ 512


>gi|114706872|ref|ZP_01439772.1| serine protease DO-like protease [Fulvimarina pelagi HTCC2506]
 gi|114537820|gb|EAU40944.1| serine protease DO-like protease [Fulvimarina pelagi HTCC2506]
          Length = 507

 Score =  223 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 169/500 (33%), Positives = 268/500 (53%), Gaps = 28/500 (5%)

Query: 7   LSVKSICTVALTCVIFSSTYL----VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           +    +   AL+  + S+        ++ + P  S     V+++VSP++VSV V    + 
Sbjct: 18  ILAAGVAGGALSAGVLSNAPAVYAEPVQVEAPQQSFGFADVVSKVSPAVVSVRVSQSAEP 77

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFR-KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
           + +    A  F NLPEDHPL+ +F   D ++   G  P        +  GSGFFI++DGY
Sbjct: 78  AADFGGMASPFENLPEDHPLRRFFGTPDGNQMPRGLNPRSPRDRPSIGQGSGFFISEDGY 137

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR-KFIPVEFEDANNI 180
           ++T+NH+V++GA ++V++ D +E  AKL+GTD   DLA+LKV +   KF  VEF D + +
Sbjct: 138 VVTNNHVVDNGAKYTVVMDDGSEYEAKLIGTDERTDLALLKVDAKNTKFTYVEFGDDDAV 197

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
           RVG+ V  +GNPF L G+V+AGI+SA  RDI   P   F QIDA +N+GNSGGP F   G
Sbjct: 198 RVGDWVVAVGNPFGLGGSVTAGIISARGRDIGAGPYDDFLQIDAAVNRGNSGGPAFGLDG 257

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIGVN  I +    ++G+   IP S+ +  + SL   G V+ GW G+    ++ ++A  
Sbjct: 258 KVIGVNTAIFSPSGGNVGIAFAIPASVAQDVVRSLRENGSVERGWLGVQIGEVSDDIAEA 317

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           LGL   +G+++T    E+PA +AG++ GDVI  ++G  ++S ++    IA  SP   V+I
Sbjct: 318 LGLSNAQGAIVTLPDNETPASRAGIETGDVITGVNGEAVESPRELARMIADYSPGTDVEI 377

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDM----------HLEVGDKELLGMVLQDINDGNKKLV 409
           ++ ++G   ++ V LG+  +                ++       GM +    DG     
Sbjct: 378 TVFRDGDSETIDVTLGNLNSLDEAASLDEPRGQGSPVDPSTLSGYGMTVTPSEDGE---- 433

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +V  + + +     KG + G TIV+VN   V+   DV   I  A +  R + L Q++  
Sbjct: 434 GVVVTDVDPDSSAAEKGFEAGDTIVAVNGSNVASQSDVRAAIDAASKNGRRAALFQLR-- 491

Query: 470 PDMQSGNDNMSRFVSLKIDK 489
                  D  +RFV+L I+K
Sbjct: 492 -----NADGQNRFVALPIEK 506


>gi|329113251|ref|ZP_08242034.1| Putative serine protease do-like protein [Acetobacter pomorum
           DM001]
 gi|326697392|gb|EGE49050.1| Putative serine protease do-like protein [Acetobacter pomorum
           DM001]
          Length = 510

 Score =  223 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 141/490 (28%), Positives = 225/490 (45%), Gaps = 33/490 (6%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSV--------DLPPVIARVSPSIVSVMV 56
           +   V S+  + L    F+      +A      V            + A++ P++V+V  
Sbjct: 6   RFARVFSLSGLLLAGASFAYPAQADQASTTAPPVMVAQRVPESFADLAAKLLPAVVNVST 65

Query: 57  EPKKKVSVEQMF---NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSG 113
               +   +            N P+  P + +F    ++    + P           GSG
Sbjct: 66  TQTVRADSDDDDEDDQLPQMPNFPQGSPFEKFFHDFMNRQTEPDAPP----RRMQALGSG 121

Query: 114 FFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
           F I   GYI+T+NH++      +V L D+T L AK VG D   DLA+LKV+S +    V+
Sbjct: 122 FIIDPTGYIVTNNHVIRKADRITVTLQDNTVLTAKAVGHDDRTDLALLKVESKKPLPFVQ 181

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGG 232
           F ++++ RVG+ V  IGNPF L GTV+AGI+S+  R+I   P   F Q DAPIN+GNSGG
Sbjct: 182 FGNSDSHRVGDWVLAIGNPFGLSGTVTAGIISSRGRNIDQGPYDDFIQTDAPINKGNSGG 241

Query: 233 PCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNL 292
           P F+  G VIGVN  I +     +G+G  IP +  +  +  L   G+V  GW G+  QN+
Sbjct: 242 PLFDMNGQVIGVNTAIYSPSGGSVGIGFAIPSNEARNVVEQLRKTGKVSRGWLGVRIQNV 301

Query: 293 TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRS 352
           TQ++A  LGL   +G+L+  V K  PA KAG++ GDVI  L+ + I+         A   
Sbjct: 302 TQDIADGLGLTPARGALVAGVEKNGPAAKAGLQTGDVIQALNAQPIEGKA-LPRLSAQLP 360

Query: 353 PKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---------LGMVLQDIND 403
                 + + + G    + V + + P    D   +                G  +  I+ 
Sbjct: 361 VGSVAHLGVWRHGKILDLPVTIAALPEPAADTPQKPAAPSKTKETVSFADFGFSVGVIDT 420

Query: 404 GNKKLVR-------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
             ++          ++  +   +     +G++ G  I  V   EV+   D+++ I  AK+
Sbjct: 421 AARQKYGLSANQKGVLVTSVQDDGLAADRGLKPGDVITEVQQAEVNTPADLKKRIEAAKK 480

Query: 457 KKRDSVLLQI 466
            K+ SVLL +
Sbjct: 481 DKKRSVLLLV 490


>gi|253698882|ref|YP_003020071.1| protease Do [Geobacter sp. M21]
 gi|251773732|gb|ACT16313.1| protease Do [Geobacter sp. M21]
          Length = 457

 Score =  222 bits (565), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 151/486 (31%), Positives = 236/486 (48%), Gaps = 38/486 (7%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
            +I    L   +F S+     A     + D   +  ++ P++V++       V   Q+  
Sbjct: 3   AAIVARFLVLSVFLSSIFSTVAGASVLTPDFAKLAKKLKPAVVNISTSKTIAVKKRQI-- 60

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                  P   P + YF K F               ++   G+GF I+DDGYI+T+NH+V
Sbjct: 61  ------APGRDPFQEYFEKFFE-------GPHQRPQKQRNLGTGFIISDDGYIITNNHVV 107

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           +D     V LSD  E    + G D   DLA++K+ +          D++ + VG+ V  I
Sbjct: 108 KDADEIKVKLSDGREFAGDVKGRDEKLDLALVKIDAKGHLPVAPLGDSDKMEVGDWVMAI 167

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FN  G VIG+N  I
Sbjct: 168 GNPFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNTEGEVIGINTAI 227

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           V       G+G  IP+++ K+ +P L S G+V  GW G+  Q +T +LA   GL   KG+
Sbjct: 228 VAG---GQGIGFAIPVNMAKEILPQLKSAGKVTRGWLGVSVQLVTPDLAKSFGLDSEKGA 284

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  VVKESPA+KAG+K GD+I   DG  IK   +   ++A+    ++VK+ + +EG + 
Sbjct: 285 LVADVVKESPAEKAGLKGGDIILEYDGHPIKEMGELPRRVAATPVGKKVKLVVQREGRQE 344

Query: 369 SVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV------RIVALNPNREREV 422
           ++ V +        D  +     + LG+ + ++     + +       +V  +   +   
Sbjct: 345 TLQVTVEQLKDDDQDSAVA---SDRLGVKVTELTPERAQQLRVQGDKGVVVTDVEPDSLA 401

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
           +  GIQ+G  I  +N   VS + D  +LI  AK+     +LL+            + S F
Sbjct: 402 DRAGIQEGDLIREINGVRVSGVSDYSKLIAAAKKGGYLKMLLR----------RGDASLF 451

Query: 483 VSLKID 488
           V+L+++
Sbjct: 452 VALRLE 457


>gi|110679212|ref|YP_682219.1| serine protease DO-like precursor, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455328|gb|ABG31533.1| serine protease DO-like precursor, putative [Roseobacter
           denitrificans OCh 114]
          Length = 487

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 142/490 (28%), Positives = 240/490 (48%), Gaps = 37/490 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           + +  V+  +  LV           L P+  ++SPS+V++        S          G
Sbjct: 20  LLMVAVLAMAFALVAPLTGHAQPASLAPLAEKISPSVVNI------TTSTTVSRRTGPQG 73

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            +PE  P +++FR                       GSGF I++DGY++T+NH++E    
Sbjct: 74  IVPEGSPFEDFFRD-------RNIGPEGAPRRSSALGSGFVISEDGYVVTNNHVIEGADE 126

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             +   D  EL A++VGTD   D+A+LKV++D     V F D+++ RVG+ V  +GNP  
Sbjct: 127 ILIEFFDGGELVAEVVGTDPNTDIALLKVEADAPLPFVSFGDSDSARVGDWVIAMGNPLG 186

Query: 195 LRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF 254
              +VSAGIVSA +R++  R   + Q DA IN+GNSGGP FN  G VIGVN  I++    
Sbjct: 187 QGFSVSAGIVSARNRELSGRYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPTGG 246

Query: 255 HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVV 314
            +G+G  +  +++ + +  L   G    GW G+  Q++T+++A  +GL  T G+     V
Sbjct: 247 SIGLGFSMAANVVTRVVDQLQEFGETRRGWLGVQIQDVTEDMAEAMGLASTDGA-AVNGV 305

Query: 315 KESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVL 374
            E PA +AG+++GDVI   DGR ++  +  V Q+ +    E V++ + +     ++ V L
Sbjct: 306 LEGPAMEAGIEIGDVIISFDGRDVEDTRGLVRQVGNTPVGEAVRVVVRRGDETKTLLVTL 365

Query: 375 GSSPTAKNDMHL--------EVGDKELLGMVLQDINDGNKKLVR-------IVALNPNRE 419
           G    A+  +               E++G+ L  +ND  ++ +        +  +  +  
Sbjct: 366 GRREEAEGAVPAVAQAPEDDAPTSAEMMGLTLMVLNDELREQLGATPETEGLAVMEVDEA 425

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNM 479
            E   KG++ G  I      +V+ I D+E  + +A+E  R S+LL ++   D        
Sbjct: 426 SEAFEKGLRAGDVITEAGQKKVTSIADLETRVEEAREAGRKSLLLLVRRAGD-------- 477

Query: 480 SRFVSLKIDK 489
            RFV+L + +
Sbjct: 478 PRFVALSLAE 487


>gi|192290531|ref|YP_001991136.1| protease Do [Rhodopseudomonas palustris TIE-1]
 gi|192284280|gb|ACF00661.1| protease Do [Rhodopseudomonas palustris TIE-1]
          Length = 523

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 147/485 (30%), Positives = 237/485 (48%), Gaps = 25/485 (5%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           L      +  +    +     V    ++ +V PS++SV V    K++  +    + F   
Sbjct: 51  LIATPAHAQQVGANVQPAQQPVGFADIVDKVKPSVISVKVNIADKMAKNEDREDFSF--- 107

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           P   P++ +FR+   +   G        +     GSGFFI+ DGY +T+NH+VE      
Sbjct: 108 PPGSPMERFFRRFGGEMPPGLRGHRGGGM-ITGQGSGFFISADGYAVTNNHVVEGADKVE 166

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V   D     AK++G D   DLA++KV+    F   +  +    R+G+ V  +GNPF L 
Sbjct: 167 VTTDDGKTYKAKVIGNDPRTDLALIKVEGGSNFPYAKLSE-GKPRIGDWVLAVGNPFGLG 225

Query: 197 GTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV+AGIVSA+ RDI + P   F QIDAP+N+GNSGGP FN  G V+GVN  I +     
Sbjct: 226 GTVTAGIVSAMGRDIGNGPYDDFIQIDAPVNKGNSGGPAFNTAGEVVGVNTAIYSPSGGS 285

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+   IP + +K  +  L  +G V  GW G+  Q +T E+A  LGL+  +G+L+     
Sbjct: 286 IGIAFSIPANTVKAVVEQLKDRGSVSRGWIGVQVQPVTPEIADSLGLKKAEGALVAEPQS 345

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             PA KAG++ GDVI  +DG  +K  ++    I + +P   VK+++  +G +  + + LG
Sbjct: 346 NGPAAKAGIESGDVIVAVDGTSVKDARELARTIGAFAPGHAVKLTVFHKGKERELTLTLG 405

Query: 376 SSPTAKNDMHL----------EVGDKELLGMVLQDIND-GNKKLVRIVALNPNREREVEA 424
             P      +           +  D   LG+ L   +         +V  + + +     
Sbjct: 406 ELPNKIEASNNTDRGDRGGANQGLDLPKLGLTLAPASSVAGAGKDGVVVTDVDPKGAAAD 465

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVS 484
           +G ++G  I+ V    VS   DV  ++  AK + ++SVL++++        +   SRFV+
Sbjct: 466 RGFKEGDVILEVAGKNVSSPADVRDVLATAKTENKNSVLVRVR--------SGGASRFVA 517

Query: 485 LKIDK 489
           L I K
Sbjct: 518 LPIAK 522


>gi|39934998|ref|NP_947274.1| htrA-like serine protease [Rhodopseudomonas palustris CGA009]
 gi|39648849|emb|CAE27370.1| htrA-like serine protease [Rhodopseudomonas palustris CGA009]
          Length = 523

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 147/485 (30%), Positives = 237/485 (48%), Gaps = 25/485 (5%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           L      +  +    +     V    ++ +V PS++SV V    K++  +    + F   
Sbjct: 51  LIATPAHAQEVSANVQPAQQPVGFADIVDKVKPSVISVKVNIADKMAKNEDREDFSF--- 107

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           P   P++ +FR+   +   G        +     GSGFFI+ DGY +T+NH+VE      
Sbjct: 108 PPGSPMERFFRRFGGEMPPGLRGHRGGGM-ITGQGSGFFISADGYAVTNNHVVEGADKVE 166

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V   D     AK++G D   DLA++KV+    F   +  +    R+G+ V  +GNPF L 
Sbjct: 167 VTTDDGKTYKAKVIGNDPRTDLALIKVEGGSSFPYAKLSE-GKPRIGDWVLAVGNPFGLG 225

Query: 197 GTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV+AGIVSA+ RDI + P   F QIDAP+N+GNSGGP FN  G V+GVN  I +     
Sbjct: 226 GTVTAGIVSAMGRDIGNGPYDDFIQIDAPVNKGNSGGPAFNTAGEVVGVNTAIYSPSGGS 285

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+   IP + +K  +  L  +G V  GW G+  Q +T E+A  LGL+  +G+L+     
Sbjct: 286 IGIAFSIPANTVKAVVEQLKDRGSVSRGWIGVQVQPVTPEIADSLGLKKAEGALVAEPQS 345

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             PA KAG++ GDVI  +DG  +K  ++    I + +P   VK+++  +G +  + + LG
Sbjct: 346 NGPAAKAGIESGDVIVAVDGTSVKDARELARTIGAFAPGHAVKLTVFHKGKERELTLTLG 405

Query: 376 SSPTAKNDMHL----------EVGDKELLGMVLQDIND-GNKKLVRIVALNPNREREVEA 424
             P      +           +  D   LG+ L   +         +V  + + +     
Sbjct: 406 ELPNKIEASNNTDRGDRGGANQGLDLPKLGLTLAPASSVAGAGKDGVVVTDVDPKGAAAD 465

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVS 484
           +G ++G  I+ V    VS   DV  ++  AK + ++SVL++++        +   SRFV+
Sbjct: 466 RGFKEGDVILEVAGKNVSSPADVRDVLATAKTENKNSVLVRVR--------SGGASRFVA 517

Query: 485 LKIDK 489
           L I K
Sbjct: 518 LPIAK 522


>gi|89055661|ref|YP_511112.1| peptidase S1C, Do [Jannaschia sp. CCS1]
 gi|88865210|gb|ABD56087.1| Peptidase S1C Do [Jannaschia sp. CCS1]
          Length = 515

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 135/478 (28%), Positives = 223/478 (46%), Gaps = 31/478 (6%)

Query: 26  YLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNY 85
             +       +      ++ +V  ++V++                     +PE  PL+++
Sbjct: 55  SSLPARAQSGALPGFADLVDQVGDAVVNITTSSVVAGR-----GGGPAPVVPEGSPLEDF 109

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           F +          P           GSGF I++DGY++T+NH++E      +   +  EL
Sbjct: 110 FNEFLGPDGGDNGPSP---RRSQALGSGFVISEDGYLVTNNHVIEGADEIMIEFRNGVEL 166

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            A+L+GTD   D+A+L+VQSD     V F  A++ RVG+ V  +GNP     +VS G+VS
Sbjct: 167 VAELIGTDPNTDIALLRVQSDEPLPYVPFGVASDHRVGDWVMVMGNPLGQGFSVSVGVVS 226

Query: 206 ALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLS 265
           A  R +      F Q DA INQGNSGGP FN  G VIGVN  I++     +G+G  +   
Sbjct: 227 AFGRSLSGTYDDFIQTDAAINQGNSGGPLFNLEGEVIGVNTAILSPTGGSIGIGFAMSSD 286

Query: 266 IIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMK 325
           ++   +  L   G    GW G+  Q++T E+A  LGL   +G+++T  V E PA + G++
Sbjct: 287 VVINVVDQLREFGETRRGWLGVRIQDVTTEMADALGLDEARGAMVTD-VPEGPALEGGIE 345

Query: 326 VGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH 385
           VGDVI   DG  ++  +  V  +   +  E V++ + ++G+  ++ + LG   TA++   
Sbjct: 346 VGDVILTFDGADVEDTRGLVRVVGDSTVGETVRVVVFRDGATETLRITLGRRETAESAAA 405

Query: 386 LEVGDKE-------LLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGM 431
            E  +         +LGM L  + D  +  +        +V    +        G+Q G 
Sbjct: 406 PETPEGAEAAPSSIVLGMTLTPLTDELRGELNARGVTNGLVITEIDPVSAAAEMGLQVGD 465

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            I  V    V+ I D +  I  A E  ++++LL I+ D           RF++L I +
Sbjct: 466 IITEVTQMPVTTIADFQLRIDAADEAGQETILLLIRRD--------GNPRFMALGIKE 515


>gi|322417815|ref|YP_004197038.1| protease Do [Geobacter sp. M18]
 gi|320124202|gb|ADW11762.1| protease Do [Geobacter sp. M18]
          Length = 458

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 146/486 (30%), Positives = 235/486 (48%), Gaps = 37/486 (7%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
            +I    L   +F S+     A     + D   +  R+ P++V++       +   Q+  
Sbjct: 3   AAIVARFLVFSLFLSSIFSTVAGAATLTPDFAKLAKRLKPAVVNISTSKTIGMKKRQL-- 60

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                  P   P + YF K F               ++   GSGF I+DDGY++T+NH+V
Sbjct: 61  ------APGGDPFQEYFEKFFESP-------RQHPYKQRSMGSGFIISDDGYLITNNHVV 107

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           ++     V LSD  E   ++ G D   DLA++K+ +          D++ + VG+ V  I
Sbjct: 108 KEADEIKVKLSDGREFKGEVKGRDEKLDLALIKIDAKGHLPVAPLGDSDKMEVGDWVMAI 167

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FN  G VIG+N  I
Sbjct: 168 GNPFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNTDGEVIGINTAI 227

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           V       G+G  IP+++ K+ +P L   G+V  GW G+  Q +TQ+LA   G+   +G+
Sbjct: 228 VAG---GQGIGFAIPVNMAKEILPQLKESGKVIRGWLGVSVQLVTQDLANSFGMDSERGA 284

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  V KESPA+KAG+K GD+I   DG  IK   +   ++A+    ++VK+ + ++G + 
Sbjct: 285 LVAEVAKESPAEKAGIKGGDIILEYDGHPIKDMGELPRRVAATPVGKKVKMVVLRDGKQV 344

Query: 369 SVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV------RIVALNPNREREV 422
            + V +      +++     GD   LG+ + D+     + +       ++ ++   E   
Sbjct: 345 PLQVTIEKLKEGEDEDAAVTGD--RLGLKVIDLTPERAQQLRLQGEKGVLVVDVQPESIA 402

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
           E  GI  G  I  +N   ++ +KD  ++I   K+     +LL+              S F
Sbjct: 403 ERAGIVDGDLIREINGVRITSVKDYSKVIAGVKKGGYLKMLLK----------RGEASLF 452

Query: 483 VSLKID 488
           V+L++D
Sbjct: 453 VALRLD 458


>gi|294851979|ref|ZP_06792652.1| serine protease do-like protein [Brucella sp. NVSL 07-0026]
 gi|294820568|gb|EFG37567.1| serine protease do-like protein [Brucella sp. NVSL 07-0026]
          Length = 513

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 164/479 (34%), Positives = 256/479 (53%), Gaps = 34/479 (7%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMFNAYGFGNLPEDHPLKNYFRKD 89
            PP       ++ +V P++VSV V+   +       Q F   GF  LP+ HPLK +FR  
Sbjct: 46  TPPPQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFRDF 105

Query: 90  FHKFFSGEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
             +                        +  GSGF I++DGY++T+NH+V DG +++V+L 
Sbjct: 106 GMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVVLD 165

Query: 141 DDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D TEL AKL+G D   DLAVLK+    RKF+ V F D N +RVG+ V  +GNPF L GTV
Sbjct: 166 DGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLGGTV 225

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GIVSA  RDI   P   F QIDA +N+GNSGGP F+  G VIG+N  I +     +G+
Sbjct: 226 TSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGGSVGI 285

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP S  K+ +  LI KG V+ GW G+  Q +T+++A  LGL   KG+++     + P
Sbjct: 286 AFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVALPQDDGP 345

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI  ++G  ++  +D   ++A+ +P E+  +++ ++     + V + + P
Sbjct: 346 AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMP 405

Query: 379 TAKNDMHLEVGDKE--------LLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKG 430
             K     +  D +          G+ +    DG      +V  + + + +   +GI+ G
Sbjct: 406 NDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDGK----GVVVTDVDPDSDAADRGIRSG 461

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             IVSVN   V    ++ + I  A++  R +VLLQ++        +++ SRFV+L I++
Sbjct: 462 DVIVSVNNQTVKTAGNINKAITAAEKSGRKAVLLQLQ--------SNDQSRFVALPINQ 512


>gi|82702872|ref|YP_412438.1| peptidase S1C, Do [Nitrosospira multiformis ATCC 25196]
 gi|82410937|gb|ABB75046.1| Peptidase S1C, Do [Nitrosospira multiformis ATCC 25196]
          Length = 473

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 139/488 (28%), Positives = 228/488 (46%), Gaps = 30/488 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           +    L  V+   +  V          D   ++ R  PS+V++        + E+ F   
Sbjct: 1   MIAKFLLVVLLGLSTSVFAQAPARELPDFTGLVEREGPSVVNISTVQSGNSTTERAF--P 58

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
           G  N+PED P   +FR+            +    E    GSGF I+ DGYILT+ H+V+ 
Sbjct: 59  GIPNIPEDDPFFEFFRRHMQPHGG-----MPRDFESRSVGSGFIISSDGYILTNTHLVDG 113

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
               +V L+D  E  AKL+G D   D+A+LK+        V   D NN++VGE V  IG+
Sbjct: 114 ADEINVKLTDKREFRAKLIGADRKTDIALLKID-ATGLPKVTQGDPNNMKVGEWVVAIGS 172

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +       F Q D  IN GNSGGP FN  G V+GVN+ I +
Sbjct: 173 PFGFENSVTAGIVSAKGRSLAQENFVPFIQTDVAINPGNSGGPLFNMNGEVVGVNSQIYS 232

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ + +     LI+ G+V  G  G++ Q +T+ELA   GL    G+L+
Sbjct: 233 RTGGFMGLSFAIPIDVARDISNQLIASGKVSRGRIGVLIQEITKELAESFGLPKPAGALV 292

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
            +V K  PADKAG++  DVI   DG+ + S  D    + S  P  +V++ + + GS    
Sbjct: 293 ASVQKGGPADKAGIQARDVILKFDGKTVNSSGDLPRIVGSTKPGTKVQMQVWRNGSTKEF 352

Query: 371 AVVLGSSPTAKNDMH------LEVGDKELLGMVLQDINDGNKKLV----RIVALNPNRER 420
            + +   P  +                  +G+ L ++    KK +     ++  +     
Sbjct: 353 TITVDELPEDEKPAARSGKRGKTPDTANRIGLSLIELTPDQKKELETESGLLVEDMVPG- 411

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
                G++ G  I+S+N  +V  +    +L+ K ++ +  ++L++            + +
Sbjct: 412 IASRAGVRPGDVILSINNQDVKTVDQFNQLLNKVEKGRNIALLVK----------RGDTA 461

Query: 481 RFVSLKID 488
            F+++K++
Sbjct: 462 TFITMKMN 469


>gi|254454827|ref|ZP_05068264.1| MucD serine protease MucD [Octadecabacter antarcticus 238]
 gi|198269233|gb|EDY93503.1| MucD serine protease MucD [Octadecabacter antarcticus 238]
          Length = 497

 Score =  221 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 137/501 (27%), Positives = 224/501 (44%), Gaps = 46/501 (9%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           +     AL   +  S   V+ A           +   +SP++V++               
Sbjct: 21  RQTWIAALMVGLALSLVTVVGADAQDRPASFADLAEAISPAVVNITTSTMIAGRTGPQ-- 78

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
               G +P+  P +++F +                      GSGF I+ DGYI+T+NH++
Sbjct: 79  ----GIVPDGSPFEDFFDEF----------GQDGPRRSSALGSGFVISADGYIVTNNHVI 124

Query: 130 EDGASFSVILSDDTE-----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI--RV 182
           E      +      +     LPA LVGTD   D+A+LKV+ D     V F D+N    RV
Sbjct: 125 EGADEIEIEFFPGADQPAKLLPAVLVGTDPNTDIALLKVEYDTPLSFVSFGDSNGPGARV 184

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVI 242
           G+ V  +GNP     +VSAGI+SA +R +      + Q DA IN+GNSGGP FN  G VI
Sbjct: 185 GDWVMAMGNPLGQGFSVSAGIISARNRSLQGTYDDYIQTDAAINRGNSGGPLFNMNGDVI 244

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           GVN  I++     +G+G  +   ++   I  L   G    GW G+  Q++T ++   +  
Sbjct: 245 GVNTAILSPNGGSIGIGFAMSSDVVSNVIDQLEEFGETRRGWLGVRIQDVTVDMIDAIDG 304

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
                  +   V   PA+ AGM+ GD+I + DG  I+  ++ V  + +    ++V + + 
Sbjct: 305 LQDARGAMVTDVPAGPAEDAGMESGDIILLFDGIAIEDTRELVQIVGNSPVGKEVPVEIL 364

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVGD---------KELLGMVLQDINDGNKKLVRI-- 411
           + G    + VVLG   TA+ +   E GD           +LGM L +I    ++ + +  
Sbjct: 365 RNGDMVDLTVVLGRRETAETEAFPEDGDTPDEDTPITSNMLGMTLSEITPEMEESLGVEA 424

Query: 412 ----VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
               V +    + E E KG+  G  I      +++ I D E  + +A+E  R S+LL ++
Sbjct: 425 ASGLVIVEVEADSEAETKGLLAGDLITEAGQQKIASIADFEARVEEAQEAGRKSLLLLVR 484

Query: 468 YDPDMQSGNDNMSRFVSLKID 488
            D           RFV++ ++
Sbjct: 485 RD--------GAPRFVAIALE 497


>gi|170739393|ref|YP_001768048.1| protease Do [Methylobacterium sp. 4-46]
 gi|168193667|gb|ACA15614.1| protease Do [Methylobacterium sp. 4-46]
          Length = 501

 Score =  221 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 143/485 (29%), Positives = 224/485 (46%), Gaps = 34/485 (7%)

Query: 23  SSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPL 82
             T  +  A L      L  +  +V+ ++V++      +     +        LP   P 
Sbjct: 32  VGTAALPSAALARGPESLADLTEQVTDAVVNISASTTVETRGRTL------PQLPPGTPF 85

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
           ++ F   F++   G++P      +    GSGF I   G ++T+NH++ D     VIL D 
Sbjct: 86  EDLFEDFFNRRGGGDQPRQP--RKSNSLGSGFIIDASGIVVTNNHVIGDANDIQVILHDG 143

Query: 143 TELPAKLVGTDALFDLAVL--KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVS 200
            +L A++VG D+  D+AVL  K ++DR    V   D+  +R G+ V  IGNPF L G+VS
Sbjct: 144 RKLKAEIVGKDSKTDIAVLRVKPEADRPLKAVPLGDSEKMRPGDWVIAIGNPFGLGGSVS 203

Query: 201 AGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVG 259
           AGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  I++     +G+G
Sbjct: 204 AGIVSARGRNIDSGPYDNYIQTDAAINKGNSGGPLFNMSGEVIGINTAILSPTGGSVGIG 263

Query: 260 LIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG-LRGTKGSLITAVVKESP 318
             +P +     I  L   G    GW G+  QN+    A  LG   G +G+LI  + ++ P
Sbjct: 264 FAVPTATAAPVIEQLRQYGETRRGWLGVRIQNVDDTTAEALGLKGGARGALIAGIDEKGP 323

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A  AG +VGDVI   +G  +KS  D    +A+    + V +   ++G++ +  V LG   
Sbjct: 324 AKTAGFEVGDVIVKFNGVEVKSSSDLPRIVATTPVGKTVDVLTIRKGAEQTRPVTLGRLE 383

Query: 379 TAKNDMHLEVGDKEL--------LGMVLQDINDGNKKLV-------RIVALNPNREREVE 423
                    +   +         LG+ L  +++  ++          +V    +      
Sbjct: 384 DNDKPQPAALNRPQPEADVTRQALGLNLTGLSEEARRRFNIKDGLKGVVVTRVDPNSNAA 443

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
            K IQ G  IV V    V+   DV R + + K++ R S LL +       S      RFV
Sbjct: 444 DKRIQAGDLIVEVGQEPVNSPSDVTRRLDQIKKEGRKSALLLV-------SNAQGEVRFV 496

Query: 484 SLKID 488
           +L ++
Sbjct: 497 ALSLE 501


>gi|77457592|ref|YP_347097.1| peptidase S1C, Do [Pseudomonas fluorescens Pf0-1]
 gi|77381595|gb|ABA73108.1| putative exported heat-shock adaptation serine protease
           [Pseudomonas fluorescens Pf0-1]
          Length = 482

 Score =  221 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 131/500 (26%), Positives = 228/500 (45%), Gaps = 29/500 (5%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M    + S  SI    L            EA  P +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPSLKSYLSIFATVLVLGQAVPAVHAAEAASPANLPDFTQLVEQASPAVVNISTTQK- 59

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITD 118
                 + +      +P+   L    R+ F +    ++  P      E    GSGF I+ 
Sbjct: 60  ------LPDRKVNQQMPDLEGLPPMLREFFERGMPPQQRSPRGDRQREAQSLGSGFIISP 113

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DGYILT+NH++ D     V L+D +E+ AKL+GTD   D+A+LK++       ++   + 
Sbjct: 114 DGYILTNNHVIADADEILVRLADRSEMKAKLIGTDPRSDVALLKIEGKDL-PVLKLGKSQ 172

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNA 237
           +++ G+ V  IG+PF    TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN 
Sbjct: 173 DLKAGQWVVAIGSPFGFDHTVTQGIVSAVGRSLPNENYVPFIQTDVPINPGNSGGPLFNL 232

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+G+N+ I T     MGV   IP+ +       L S G+V  GW G++ Q + ++LA
Sbjct: 233 NGEVVGINSQIYTRSGGFMGVSFAIPIDVAMDVSNQLKSGGKVSRGWLGVVIQEVNKDLA 292

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
              GL    G+L+  +  + PA K G++VGDVI  ++G+ I    D    + +     + 
Sbjct: 293 ESFGLDKPAGALVAQIQDDGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGALKAGAKA 352

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD-----KELLGMVLQDINDGNKKLV--- 409
            + + ++G + +V + +G+ P    ++              LG+ + +++   KK     
Sbjct: 353 NLEVIRDGKRKNVELTVGAIPDEDKELDALPKSGAETNSNRLGVSVAELSAEQKKTYDLK 412

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
             V +   ++      G+Q G  I  +N   +   K+   +     + +  S+ +     
Sbjct: 413 GGVVIKEVQDGPAALIGLQPGDIITHLNNQAIGSSKEFAEIAKALPKNRSVSMRVL---- 468

Query: 470 PDMQSGNDNMSRFVSLKIDK 489
                     + F++ K+ +
Sbjct: 469 ------RQGRASFITFKLAE 482


>gi|258543537|ref|YP_003188970.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-01]
 gi|256634615|dbj|BAI00591.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-01]
 gi|256637671|dbj|BAI03640.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-03]
 gi|256640725|dbj|BAI06687.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-07]
 gi|256643780|dbj|BAI09735.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-22]
 gi|256646835|dbj|BAI12783.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-26]
 gi|256649888|dbj|BAI15829.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-32]
 gi|256652878|dbj|BAI18812.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655932|dbj|BAI21859.1| endopeptidase DegP/Do [Acetobacter pasteurianus IFO 3283-12]
          Length = 510

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 140/490 (28%), Positives = 225/490 (45%), Gaps = 33/490 (6%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSV--------DLPPVIARVSPSIVSVMV 56
           +   V S+  + L    F       +A      V            + A++ P++V+V  
Sbjct: 6   RFARVFSLSGLLLAGASFVHPARADQAATATPPVVVAQRVPESFADLAAKLLPAVVNVST 65

Query: 57  EPKKKVSVEQMF---NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSG 113
               +   +            N P+  P + +F    ++    + P           GSG
Sbjct: 66  TQTVRADSDDDDEDDQLPQMPNFPQGSPFEKFFHDFMNRQTEPDAPP----RRMQALGSG 121

Query: 114 FFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
           F I   GYI+T+NH++      +V L D+T L AK VG D   DLA+LKV+S +    V+
Sbjct: 122 FIIDPTGYIVTNNHVIRKADRITVTLQDNTVLTAKAVGHDDRTDLALLKVESKKPLPFVQ 181

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGG 232
           F ++++ RVG+ V  IGNPF L GTV+AGI+S+  R+I   P   F Q DAPIN+GNSGG
Sbjct: 182 FGNSDSHRVGDWVLAIGNPFGLSGTVTAGIISSRGRNIDQGPYDDFIQTDAPINKGNSGG 241

Query: 233 PCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNL 292
           P F+  G VIGVN  I +     +G+G  IP +  +  +  L   G+V  GW G+  QN+
Sbjct: 242 PLFDMNGQVIGVNTAIYSPSGGSVGIGFAIPSNEARNVVEQLRKTGKVSRGWLGVRIQNV 301

Query: 293 TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRS 352
           TQ++A  LGL   +G+L+  V K  PA KAG++ GDVI  L+ + I+         A   
Sbjct: 302 TQDIADGLGLTPARGALVAGVEKNGPAAKAGLQTGDVIQSLNAQPIEGKA-LPRLSAQLP 360

Query: 353 PKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---------LGMVLQDIND 403
                 + + + G    + V + + P   ++   +                G  +  I+ 
Sbjct: 361 VGSVAHLGVWRHGKTLDLPVTIAALPEPADETPQKTTVPSKTKETVSFADFGFSVGIIDT 420

Query: 404 GNKKLVR-------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
             ++          ++  +   +     +G++ G  I  V   EV+   D+++ I  AK+
Sbjct: 421 AARQKYGLSANQKGVLVTSVQEDGLAADRGLKPGDVITEVQQAEVNTPADLKKRIEAAKK 480

Query: 457 KKRDSVLLQI 466
            K+ SVLL +
Sbjct: 481 DKKRSVLLLV 490


>gi|114331760|ref|YP_747982.1| protease Do [Nitrosomonas eutropha C91]
 gi|114308774|gb|ABI60017.1| protease Do [Nitrosomonas eutropha C91]
          Length = 490

 Score =  220 bits (559), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 137/483 (28%), Positives = 236/483 (48%), Gaps = 27/483 (5%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           +A    +  S +++  +       D   ++ +   ++V++     ++V V Q        
Sbjct: 27  IAFIIFLCWSAFMLPVSLQAKDLPDFTDLVEKHGQAVVNISTVQTQQVGVGQFL--PEIP 84

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           N+PED P   +FR+    F            E    GSGF I+ DGYILT+ H+VE    
Sbjct: 85  NIPEDSPFYEFFRRHIQPFSG------PRKYESRSLGSGFIISKDGYILTNAHVVEAANE 138

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
            +V L+D  E  AK++G D   D+A+LK+ ++     V       ++VGE V  IG PF 
Sbjct: 139 ITVRLTDKREFSAKVIGADQKTDIALLKIDANDL-PVVTQGSPEQLKVGEWVVAIGAPFG 197

Query: 195 LRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
              TV+AGIVSA  R +       F Q D  IN GNSGGP FN  G V+G+N+ I +   
Sbjct: 198 FENTVTAGIVSAKGRSLAQENYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQIYSRTG 257

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             MG+   IP+ +       L + G++  G  G+M Q +T ELA    L  ++G+L+ +V
Sbjct: 258 GFMGLSFAIPIDVAMDIADQLKTYGKISRGKIGVMIQEMTDELAESFSLDKSRGALVVSV 317

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
            K  PADKAG+K+ DVI   DG+ I++  D    + +  P  +V + + + GS   + + 
Sbjct: 318 EKGGPADKAGIKIRDVILKFDGKDIEASSDLPRIVGNTKPGSKVPVEIWRSGSVKKMTIS 377

Query: 374 LGSSPTAKNDMHLEVGDK----ELLGMVLQDINDGNKKLVRI---VALNPNREREVEAKG 426
           +G  P   N ++ +          LG+VL++++   K  + I   + ++   +    + G
Sbjct: 378 VGEMPADGNIVNQKQSKSGDATSRLGLVLRELSANQKNQLGIENGLLVDEVYDGIASSSG 437

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I+ G  I+  N  ++  I+   +L+  A + +  ++L++            +++ F+++K
Sbjct: 438 IRPGDIILGFNNQDIKSIRQFNKLLNDAPKGRNIALLIR----------RGDVATFITIK 487

Query: 487 IDK 489
           ID+
Sbjct: 488 IDE 490


>gi|2094850|emb|CAA72164.1| ORF E0 [Rhodobacter capsulatus]
          Length = 460

 Score =  220 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 133/472 (28%), Positives = 220/472 (46%), Gaps = 36/472 (7%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           SS+    ++ +V P++V +           +M         P   P + +F++       
Sbjct: 6   SSIRFADLVVQVKPAVVMITTSTTVSEPAGRM------PGFPPGSPFEEFFKEFGMPNMP 59

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED------GASFSVILSDDTELPAKL 149
              P           GSGF I+ DGYI+T+NH+++           S+  ++  +L AK+
Sbjct: 60  QGGPQRQHH--ADALGSGFVISADGYIVTNNHVIKGEDGNTVADEISIEFANGKKLDAKI 117

Query: 150 VGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR 209
           VGTD   D+A+LKV+S      V F D++ +R G+ V  +GNP     + S GIVSA +R
Sbjct: 118 VGTDPKTDIALLKVESKEPLPFVSFGDSDTMREGDWVMAMGNPLGQGFSTSVGIVSARNR 177

Query: 210 DIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKK 269
           ++        Q DA IN+GNSGGP F+  G VIGVN  I++     +G+G  +  +++ K
Sbjct: 178 ELSGTYDDCIQTDAAINRGNSGGPLFSMDGKVIGVNTAILSPNGGSIGIGFSMASNVVSK 237

Query: 270 AIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDV 329
               L   G    GW G+  Q+LT ++A  + L   +G++++  V E PA  AGMK GDV
Sbjct: 238 VAGQLQEFGATRRGWLGVKIQDLTPDMAEAMSLATPEGAMVSE-VPEGPAKVAGMKSGDV 296

Query: 330 ICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG 389
           I    G  +K  +    ++A     + V + + + G   ++ V LG    A++      G
Sbjct: 297 IISFAGAPVKDTKSLTRRVADAPVGQAVDVVVMRAGKPVTLQVTLGQRELAESSEAAAGG 356

Query: 390 DKE------LLGMVLQDINDGNKKL-------VRIVALNPNREREVEAKGIQKGMTIVSV 436
                    +LGMVL  I D  +           ++  + +       KG++ G  IV  
Sbjct: 357 TAPALAGGAVLGMVLSPITDAMRAERNLPEDLTGLMVTDIDATGAAFDKGLRAGDVIVEA 416

Query: 437 NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
               V+ + D++  + +AKE  R SVLL I+ + +         RFV++ + 
Sbjct: 417 GQQPVTSLDDLKARVAEAKEGGRKSVLLLIRREGE--------PRFVAVPLQ 460


>gi|302342161|ref|YP_003806690.1| protease Do [Desulfarculus baarsii DSM 2075]
 gi|301638774|gb|ADK84096.1| protease Do [Desulfarculus baarsii DSM 2075]
          Length = 478

 Score =  220 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 139/497 (27%), Positives = 226/497 (45%), Gaps = 28/497 (5%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M KR +         AL  V+     L   A+  P       +  RVSP++V++ +    
Sbjct: 1   MQKRAVTLALCW---ALALVLIGPPRLAQAAEAGPQLPSFADLAERVSPAVVNIRIVKTV 57

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
                 +   +G          +  F + F     G         +    GSG  I  +G
Sbjct: 58  T--GRPLMGLFGRERGQGHPSPEELFERFFRG--PGGGGDQPREFKERSLGSGVIIDPEG 113

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y+LT+NH+++D     V L  + ELPAK++G DA  DLA++K+  ++    +   D++ +
Sbjct: 114 YVLTNNHVIDDADEIVVRLKGEKELPAKIIGRDAKTDLALIKIDGEKNLPVLPLGDSDKL 173

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
           RVG+ V  +GNPF L  TV+AGI+SA  RDI   P   F Q DA IN GNSGGP  +  G
Sbjct: 174 RVGDWVLAVGNPFGLEHTVTAGIISAKGRDIGAGPYDDFLQTDASINPGNSGGPLIDLGG 233

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+GVN  I        G+G  IP+++ KK +  L  KGRV  G+ G+  Q +T ELA  
Sbjct: 234 AVVGVNTAIAAQ---GQGIGFAIPVNLAKKIVGQLREKGRVVRGYLGVYFQPVTPELAQQ 290

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL+   G+L+  V+ + PA + G+K GDVI   +GR +    +    +A     ++V++
Sbjct: 291 FGLKKPGGALVAEVIADGPAAEGGVKPGDVIVRFNGREVNDWHELPAMVADTPVGQEVEM 350

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMH-LEVGDKELLGMVLQDINDGNKKLVRI------V 412
           ++ + G +  + + +G     +      +   ++ LG+ LQ++     + + +      V
Sbjct: 351 TVMRGGDEKDLEITVGELKDGEAQAQAPQRQSEDKLGLSLQELTPDLAQQLGVGASKGLV 410

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
                        G++KG  IV  +   V  +KD + L+   K      VL         
Sbjct: 411 VTGAREGGPAAEAGLRKGDVIVEADRKAVETLKDFQGLVDGLKPGDGLLVL--------- 461

Query: 473 QSGNDNMSRFVSLKIDK 489
               +  S +  +K  K
Sbjct: 462 -YQREGRSLYTVIKAPK 477


>gi|115523952|ref|YP_780863.1| protease Do [Rhodopseudomonas palustris BisA53]
 gi|115517899|gb|ABJ05883.1| protease Do [Rhodopseudomonas palustris BisA53]
          Length = 528

 Score =  220 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 150/520 (28%), Positives = 236/520 (45%), Gaps = 43/520 (8%)

Query: 3   KRQILSVKSICTVAL--------------------TCVIFSSTYLVLEAKLPPSSVDLPP 42
           +R +LS++ +  +A                          +   +  E +     +    
Sbjct: 18  RRSLLSMRKLALMASVVAGLGAGAYGLGLPGGNVDLFAGPAQAQVSTEVRKVAQPIGFAD 77

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           ++ RV PS++SV ++   +       N       P   P++ +FR+              
Sbjct: 78  IVERVKPSVISVKIKINDRSDRSDSANNEDSPFQP-GSPMERFFRRFGGPDGMPPGQRGH 136

Query: 103 DTVER--LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF I+ DGY +T+NH+V+      V   D     AK++GTDA  DLA+
Sbjct: 137 RGGRGVVTGQGSGFLISPDGYAVTNNHVVDGADKVEVTFDDGKNYTAKVIGTDARTDLAL 196

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FT 219
           +K++    F   +  +    R+G+ V  +GNPF L GTV+AGIVSA  RDI   P   F 
Sbjct: 197 IKIEGGSNFPFAKLSE-GKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGSGPYDDFI 255

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           QIDAP+N+GNSGGP FN  G VIGVN  I +     +G+   IP + +K  I  L  KG 
Sbjct: 256 QIDAPVNKGNSGGPAFNVEGEVIGVNTAIYSPSGGSVGIAFSIPSNTVKTVIEQLKDKGS 315

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  GW G+  Q +TQE+A  LGL+   G+L+     + PA KAG++ GDVI  ++G  +K
Sbjct: 316 VSRGWIGVQIQPVTQEIADSLGLKKADGALVAEPQADGPAAKAGIESGDVITAVNGEPVK 375

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM---------HLEVGD 390
             ++    I   +P   VK+++  +G    V + LG  P   N                D
Sbjct: 376 DARELARTIGGFAPGNSVKLNIIHKGQDKVVNLTLGQLPNQVNAKADLGRGDYGDSTRSD 435

Query: 391 KELLGMVLQDI-NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
              LGM +    +        +V  + + +     +G ++G  I+ V    V+   DV  
Sbjct: 436 LPRLGMTVAPAASVAGAGKEGVVVTDVDPKGAAADRGFKEGDVILEVGGKSVASPGDVRD 495

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            +  AK   ++SVLL+++        +   SRFV++ + K
Sbjct: 496 ALAAAKTDNKNSVLLRVR--------SGGSSRFVAIPLAK 527


>gi|126735319|ref|ZP_01751065.1| possible serine protease [Roseobacter sp. CCS2]
 gi|126715874|gb|EBA12739.1| possible serine protease [Roseobacter sp. CCS2]
          Length = 508

 Score =  220 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 135/502 (26%), Positives = 224/502 (44%), Gaps = 40/502 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           +R I++  +   VA   V+   T    +++          +  +VSPS+V++        
Sbjct: 32  RRLIMAFVTTLAVAFAMVLAQVTLANAQSR----PATFADLAEQVSPSVVNITTSTTVAG 87

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
                      G +PE  P +++F          +      T      GSGF I+ DG+I
Sbjct: 88  RTGPQ------GLVPEGSPFEDFFNDL-------DRGPGEGTRRSSALGSGFVISQDGFI 134

Query: 123 LTSNHIVEDGASFSVILSDD--TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           +T+NH++E      +         +PA+L+GTD   D+AVLKV  +        + +   
Sbjct: 135 VTNNHVIEGADEILIEFFPGGEPGVPAELIGTDPNTDIAVLKVDLEGLPFVEFGDSSAEG 194

Query: 181 -RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALG 239
            RVG+ V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G
Sbjct: 195 ARVGDWVMAMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDG 254

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIGVN  I++     +G+G  +  +++   +  L   G    GW G+  Q++T ++   
Sbjct: 255 EVIGVNTAILSPNGGSIGIGFAMSSAVVTNVVDQLKEFGETRRGWLGVRIQDVTPDMVDA 314

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           +         +   V   PA+ AGM  GDVI   DG  I+  ++ V  + +    ++V +
Sbjct: 315 IEGLDLARGALVTDVPAGPAENAGMLAGDVILDFDGVAIEDTRELVRIVGNSPVGKEVPV 374

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHL------EVGDKELLGMVLQDINDGNKKLV---- 409
           ++ ++G    + V+LG   T++           E    E+LG+ L +I            
Sbjct: 375 AVLRDGDMEDLTVILGRRETSEAVAFPASTEGEEPEQSEILGLALSEITPELIDQFSLSV 434

Query: 410 --RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              +V    N + E  +KG+ +G  I       V+ I D+E  I  A E  R S+LL ++
Sbjct: 435 ESGLVITGINPDSEAASKGLLEGDVITEAGQEAVATISDLEERIEAATEAGRKSLLLLVR 494

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
              D         RFV+L +++
Sbjct: 495 RGGD--------PRFVALVLEE 508


>gi|119899963|ref|YP_935176.1| serine protease MucD [Azoarcus sp. BH72]
 gi|119672376|emb|CAL96290.1| probable serine protease MucD [Azoarcus sp. BH72]
          Length = 477

 Score =  220 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 133/495 (26%), Positives = 221/495 (44%), Gaps = 32/495 (6%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSS---VDLPPVIARVSPSIVSVMVEP 58
            +    +   I  +A      +         LP  S        +I RV P++V++  E 
Sbjct: 5   LRATTTASALILALAGAFGTDALAQAPAPRGLPAGSIVLPSFDTIIQRVGPAVVNISTEG 64

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
             +            G L  D P   +FR+ F      +             GSGF ++ 
Sbjct: 65  PVRT-------GGPSGGLSPDDPFSEFFRR-FGPPLGPQFGNPPGQGPVRGQGSGFIVSA 116

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DG +LT+ H+V+  +  +V L+D  E  AK++G D   D+AVL++ +      V   D  
Sbjct: 117 DGIVLTNAHVVDGASEVTVKLTDKREFKAKVLGVDKPTDVAVLRIDAKNL-PTVPLGDPQ 175

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD-RPGTFTQIDAPINQGNSGGPCFNA 237
              VG+ V  IG PF    +V+AGI+SA  R +P+     F Q D  IN GNSGGP  N 
Sbjct: 176 KAHVGDWVLAIGAPFGFENSVTAGIISAKSRSLPNEGYVPFIQTDVAINPGNSGGPLLNL 235

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+G+N+ I +    + G+   IP+ +       +++ G+V  G  G+  Q++ Q LA
Sbjct: 236 AGEVVGINSQIYSRSGGYQGLSFAIPIDVAAGVRDQIVAHGKVTRGRIGVAVQDVNQALA 295

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
              GL+   G+LI++V   +P DKAG+KVGDVI  L+G  I +  D   ++A+  P   V
Sbjct: 296 ESFGLKSAGGALISSVEPGAPGDKAGLKVGDVIIELNGEKIVNSADLPPRVAAVRPGNTV 355

Query: 358 KISLCKEGSKHSVAVVLGSSPTA-KNDMHLEVGDKELLGMVLQDINDGNKKLVRI----V 412
           ++ + ++G    + V +G  P   +        D+  LG+ ++ ++   ++   +    V
Sbjct: 356 RMKVWRKGESRDLEVKVGEFPDDSQVASSTGKADQGRLGLAVRALSGEERRQAGLPGGLV 415

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
                        GIQ+G  I+S+N   V  +  +  L+ KA       V L ++ D   
Sbjct: 416 VTEVA--GPAARAGIQRGDLILSINGQPVETVDQLRALVAKA----GKHVALLVQRD--- 466

Query: 473 QSGNDNMSRFVSLKI 487
                    FV +++
Sbjct: 467 -----EARIFVPVEL 476


>gi|254464370|ref|ZP_05077781.1| S1C (protease Do) subfamily peptidase MucD [Rhodobacterales
           bacterium Y4I]
 gi|206685278|gb|EDZ45760.1| S1C (protease Do) subfamily peptidase MucD [Rhodobacterales
           bacterium Y4I]
          Length = 495

 Score =  219 bits (557), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 139/503 (27%), Positives = 242/503 (48%), Gaps = 44/503 (8%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           ++++ I    L+  +     +   A+       L P+  RVSP+            +   
Sbjct: 17  MTMRLIWLAVLSMAVLLMQAVSAMAR----PESLAPLAERVSPA------VVNITTTTVV 66

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSN 126
                  G +PE  P +++FR+   +  +G  P           GSGF I++DGYI+T+N
Sbjct: 67  EGRTGPQGIVPEGSPFEDFFREFQDRNGNGSRP-----RRSSALGSGFVISEDGYIVTNN 121

Query: 127 HIVEDGASFSVILSDDTE-----LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           H++E      +            LPA+++GTD   D+A+LKV++      V+F D++  R
Sbjct: 122 HVIEGADEIEIEFYPGEGQPKGLLPAEVIGTDPNTDIALLKVKAPAPLKFVKFGDSDTAR 181

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHV 241
           VG+ V  +GNP     ++SAGIVSA +R++      + Q DA IN+GNSGGP FN  G V
Sbjct: 182 VGDWVVAMGNPLGQGFSLSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMDGDV 241

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +GVN  I++     +G+G  +  +++ K +  L   G    GW G+  Q++  +LA  +G
Sbjct: 242 VGVNTAILSPNGGSIGIGFSMASNVVVKVVEQLKEYGETRRGWLGVKIQDVDADLAEAIG 301

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L   +G+L+T  V + PA  AG+  GDVI   DG  ++  +  V Q+ +    + V++ +
Sbjct: 302 LEKARGALVTD-VPDGPAKDAGVLAGDVIVSFDGVDVRDTRGLVRQVGNAEVGKTVRVVV 360

Query: 362 CKEGSKHSVAVVLGSSPTAKN--------DMHLEVGDKELLGMVLQDINDGNKKLV---- 409
            +EG   ++ V LG    A+         +   +  +KELLG+ +  + +  +  +    
Sbjct: 361 YREGKTETLRVTLGRREDAERGPSAPETGNGAPDSSEKELLGLSVGALTEQMRSELNVGE 420

Query: 410 ---RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               +  L+ +   E   KG++ G  I      +V  + D+E  + +AKE  R S+LL +
Sbjct: 421 EVEGLAILSVDETSEAWEKGLRAGDVITEAGQQKVVSVSDLEARVEEAKEAGRKSLLLLV 480

Query: 467 KYDPDMQSGNDNMSRFVSLKIDK 489
           +   +         RFV+L + +
Sbjct: 481 RRGGE--------PRFVALNLPE 495


>gi|307545616|ref|YP_003898095.1| protease Do [Halomonas elongata DSM 2581]
 gi|307217640|emb|CBV42910.1| protease Do [Halomonas elongata DSM 2581]
          Length = 474

 Score =  219 bits (557), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 140/476 (29%), Positives = 231/476 (48%), Gaps = 20/476 (4%)

Query: 20  VIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
           ++ S   L  ++ +     D   ++   +P++V++      +      F  +G   LPE 
Sbjct: 12  MLLSLAILASQSAMAQKLPDFTSLVEEAAPAVVNISTSRTVETRNMP-FGQFGGQELPEI 70

Query: 80  HPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
              K++F + F             + ER   GSGF I++DGYI+T+ H+VE      V L
Sbjct: 71  --FKHFFGERFGDQMPMPPGAQGHSEERRSLGSGFIISEDGYIMTNAHVVEGADEILVSL 128

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           +D  EL A+LVG D   D+AVLKV +D     +   D+ +++VG+ V  IG+PF L  +V
Sbjct: 129 NDGRELKAELVGADTKTDVAVLKVDADNL-PTLTLGDSEDLKVGQWVAAIGSPFGLDHSV 187

Query: 200 SAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           ++GI+SA++R +P      F Q D  IN GNSGGP FN  G VIG+N+ I T    +MG+
Sbjct: 188 TSGIISAINRTLPRDVYVPFIQTDVAINPGNSGGPLFNLDGEVIGINSQIFTRSGGYMGL 247

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
              IP+ +       L + G V  GW G+M Q +++ELA   G+   +G+LI  +  + P
Sbjct: 248 SFAIPIDVAMDVADQLRNDGSVSRGWLGVMIQPVSRELADSFGMDKPQGALIADLDPDGP 307

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A + G+K GDV+  +DG+ + S       I   SP   V++ + + G   +V V +G  P
Sbjct: 308 AARDGLKAGDVVLEVDGQTVDSSSALPRLIGRVSPGNDVELKVLRNGEHRNVTVTVGDWP 367

Query: 379 TAKNDMHLEVGD--KELLGMVLQDINDGNKKLV---RIVALNPNREREVEAKGIQKGMTI 433
            ++       GD     LG+ ++ + +G         +  +  +        GI+ G  +
Sbjct: 368 DSQKGAGGSAGDTAPARLGLAVRPLEEGQHDQAIDNGVRVVEVDPTGVAAKAGIRAGDIL 427

Query: 434 VSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           VS+  H V   + +  LIG+  E +   V L               S +V+L++ +
Sbjct: 428 VSIGEHAVESPEQLSELIGELPEDRAVPVRL----------YRSGHSYYVALRLAQ 473


>gi|316934892|ref|YP_004109874.1| protease Do [Rhodopseudomonas palustris DX-1]
 gi|315602606|gb|ADU45141.1| protease Do [Rhodopseudomonas palustris DX-1]
          Length = 522

 Score =  219 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 147/484 (30%), Positives = 234/484 (48%), Gaps = 24/484 (4%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           L      +  +    +     V    ++ +V PS++SV V    K++     + + F   
Sbjct: 51  LIGTPAQAQQVGANVQPSQQPVGFADIVEKVKPSVISVKVNIADKMAKGDDRDDFSF--- 107

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           P   P++ +FR+   +                  GSGF I+ DGY +T+NH+VE      
Sbjct: 108 PPGSPMERFFRRFGGE-MPPGMRGHRGGGMMTGQGSGFLISADGYAVTNNHVVEGADRVE 166

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V   D     AK++G+D   DLA++KV+    F   +       R+G+ V  +GNPF L 
Sbjct: 167 VTTDDGKTHKAKVIGSDPRTDLALIKVEGASNFPYAKLS-DGKPRIGDWVLAVGNPFGLG 225

Query: 197 GTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV++GIVSA+ RDI + P   F QIDAP+N+GNSGGP FN  G V+GVN  I +     
Sbjct: 226 GTVTSGIVSAIGRDIGNGPYDDFIQIDAPVNKGNSGGPAFNTAGEVVGVNTAIYSPSGGS 285

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+   IP S +K  +  L  KG V  GW G+  Q +T E+A  LGL+  +G+L+     
Sbjct: 286 IGIAFSIPASTVKAVVEQLKDKGSVSRGWIGVQVQPVTPEIADSLGLKKAEGALVAEPQS 345

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             PA KAG++ GDVI  +DG  +K  ++    I   +P   VK+++  +G +  + + LG
Sbjct: 346 NGPAAKAGIESGDVIIAVDGTSVKDARELARTIGGFAPGHSVKLTVVHKGKERELTLTLG 405

Query: 376 SSPTAKNDMHLEVGDK---------ELLGMVLQDIND-GNKKLVRIVALNPNREREVEAK 425
             P        + GD+           LG+ L   +         +V  + + +     +
Sbjct: 406 ELPNKIEASATDRGDRGRSSQGLDLPKLGLTLAPASSVAGAGKDGVVVTDVDPKGAAADR 465

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           G ++G  I+ V    VS   DV  ++  AK + ++SVL++++        +   SRFV+L
Sbjct: 466 GFKEGDVILEVAGKNVSSPADVRDVLATAKTENKNSVLVRVR--------SGGASRFVAL 517

Query: 486 KIDK 489
            I K
Sbjct: 518 PIAK 521


>gi|78222234|ref|YP_383981.1| peptidase S1C, Do [Geobacter metallireducens GS-15]
 gi|78193489|gb|ABB31256.1| Peptidase S1C, Do [Geobacter metallireducens GS-15]
          Length = 476

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 131/486 (26%), Positives = 218/486 (44%), Gaps = 33/486 (6%)

Query: 9   VKSICTVALTCVIFSSTYLVLE-AKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM 67
           +  +    L  +IF          +          +  ++ P++V++      KV     
Sbjct: 12  ISLLTAFLLISLIFLGGCDGRSKTEFVGFPQSFADLAEKIRPAVVNISTTSTVKVPGNPF 71

Query: 68  FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNH 127
            +   F    E+ P  ++F+  F         +    +++   GSG     DGYI+T+NH
Sbjct: 72  RH---FFGPEEEGPFGDFFKHFFGD-------MPDRELKQQSLGSGIITDKDGYIVTNNH 121

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF-IPVEFEDANNIRVGEAV 186
           +V++     V +SD  E  AK++G D   DLA++K+ S  +    +   D++ +RVG+ V
Sbjct: 122 VVDNAEEIKVKISDGREFKAKVIGRDPKTDLALIKISSPFRNLPVLPLGDSDKMRVGDWV 181

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVN 245
             +GNPF L  TV+ GI+SA  R I   P   F Q DAPIN GNSGGP  N  G VIG+N
Sbjct: 182 LAVGNPFGLEHTVTQGIISATGRVIGSGPYDNFLQTDAPINPGNSGGPLVNLKGEVIGIN 241

Query: 246 AMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGT 305
                      G+G  IP S+ K  +  L  KG+V  GW G+  Q +T +LA   GL+  
Sbjct: 242 T---AIVPGGQGLGFAIPSSMAKMVLKQLQEKGKVVRGWLGVTIQTVTPDLAASFGLKEA 298

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           KG+L++ + +  PA K G++ GD+I   DG+ +K   +    +A     ++V +++ +EG
Sbjct: 299 KGALVSDIAEGGPAAKGGIRRGDIILSFDGKNVKDSMELPRIVAETPVGKEVDVTVLREG 358

Query: 366 SKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVR------IVALNPNRE 419
            +    V +    T +          +  GM   DI    ++ +       +V       
Sbjct: 359 KEVHCRVRVEEL-TEQRIAAQTEAPTDSFGMTFVDITPKVRQQLGIKEKTGVVVAGVEPG 417

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNM 479
              E  GI+ G  I  VN   V  + D+   + K+ + +   +LL             + 
Sbjct: 418 SIAEDAGIRAGDVIKEVNRKPVRNLADLSSALEKSAKGQPVLLLL----------NRGSQ 467

Query: 480 SRFVSL 485
           + +V+L
Sbjct: 468 TFYVTL 473


>gi|92116994|ref|YP_576723.1| peptidase S1C, Do [Nitrobacter hamburgensis X14]
 gi|91799888|gb|ABE62263.1| Peptidase S1C, Do [Nitrobacter hamburgensis X14]
          Length = 523

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 147/512 (28%), Positives = 238/512 (46%), Gaps = 39/512 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTY-------LVLEAKL------PPSSVDLPPVIARVSP 49
           ++  L       + L    FS              A++          +    ++ RV P
Sbjct: 25  RKFALMASVAAGLGLAAYGFSPPTDKADLFTTPAHAQVNNDVSKVAQPIGFADIVERVKP 84

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF-SGEEPILSDTVERL 108
           S++SV V  K KV      + +         P++ +FR+                     
Sbjct: 85  SVISVKVRMKDKVVAGDDDSPFQ-----PGSPMERFFRRFGGPDGLPPGMHGRRGHGIVT 139

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGFFI+ DGY +T+NH+V+D     V         AK++GTD   D+A++KV+    
Sbjct: 140 GQGSGFFISADGYAVTNNHVVDDADKVEVTTDGGKTYTAKVIGTDPRTDIALIKVEGGSN 199

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQ 227
           F   +  D    R+G+ V  +GNPF L GTV++GIVSA+ RDI + P   F QIDAP+N+
Sbjct: 200 FPFAKLSDD-KARIGDWVLAVGNPFGLGGTVTSGIVSAIGRDIGNGPYDDFIQIDAPVNK 258

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP FN  G VIGVN  I +     +G+   IP + +K  +  L  KG V  GW G+
Sbjct: 259 GNSGGPAFNMKGDVIGVNTAIYSPSGGSVGIAFSIPANTVKNVVAQLKDKGSVSRGWIGV 318

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T ++A  LGL+ T+G+L+     +SPA KAG++ GDVI  ++G  +K  ++    
Sbjct: 319 QIQPVTADIADSLGLKKTEGALVAEPQADSPAAKAGIQSGDVITQVNGATVKDARELART 378

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM---------HLEVGDKELLGMVL 398
           I   +P   +K+++  +G+   + + LG  P                    D   LGM +
Sbjct: 379 IGGLAPGTSIKLNVLHKGTDKVINLTLGILPNTAEAKADLYGDDHGPSHGDDVPRLGMTV 438

Query: 399 QDI-NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK 457
               +        +V ++ + +     +G ++G  I+ V   +VS   DV   I  A+  
Sbjct: 439 APAGSVAGAGTEGVVVVDVDPKSAAADRGFKEGDVILEVGGKDVSNSADVREAIKAARAD 498

Query: 458 KRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            ++S+L++++            +RFV++ I K
Sbjct: 499 HKNSILMRVR--------TGGTARFVAVPIAK 522


>gi|254486877|ref|ZP_05100082.1| protease Do [Roseobacter sp. GAI101]
 gi|214043746|gb|EEB84384.1| protease Do [Roseobacter sp. GAI101]
          Length = 494

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 138/507 (27%), Positives = 237/507 (46%), Gaps = 44/507 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M  R  L +  +  VA   +                   L P+  ++SPS+V++      
Sbjct: 14  MTPRIKLLMMGLLAVAFVML--------QAVMSYAKPESLAPLAEQISPSVVNITTSTMV 65

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           +            G +PE  P +++F +   +  +GE P      +    GSGF I++DG
Sbjct: 66  EGRTG------PRGIVPEGSPFEDFFEEFRDRNNNGEAPAP---RKSSALGSGFVISEDG 116

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y++T+NH+++     ++      EL A ++GTDA  D+A+LKV++      V F D+N  
Sbjct: 117 YVVTNNHVIDGADEITIEFFSGEELKATVIGTDANTDIALLKVEASNPLPFVSFGDSNAA 176

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
           RVG+ V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G 
Sbjct: 177 RVGDWVIAMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGA 236

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVN  I++     +G+G  +  +++ + +  L   G    GW G+  Q++TQ++A  +
Sbjct: 237 VIGVNTAILSPNGGSIGIGFSMASNVVTRVVDQLKEFGETRRGWLGVRIQDVTQDVADAM 296

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL    G+L+T  V E PA +AG+  GD+I    G  ++  +  V Q+ + +    V+++
Sbjct: 297 GLAKATGALVTD-VPEGPAKEAGLLTGDIIMSFAGVDVEDTRGLVRQVGNSAVGAAVRVT 355

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLE-----------VGDKELLGMVLQDINDGNKKLV 409
           + ++G   ++ V LG    A+     E                +LG+ L  + D  +  +
Sbjct: 356 ILRDGKTQTLKVTLGRREDAEAPAPTEEEPAEEGTTEGPATDSMLGLTLTPLTDDLRAEL 415

Query: 410 -------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
                   +     +   E   KG++ G  I       +    D+E  +  A++  R S+
Sbjct: 416 GADASTSGLAVTAVDELSEAFEKGLRVGDIITEAGQQSIMTFADLEDSVTLARDAGRKSL 475

Query: 463 LLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           LL ++   D         RFV+L +++
Sbjct: 476 LLLVRRAGD--------PRFVALGLEE 494


>gi|86750554|ref|YP_487050.1| peptidase S1C, Do [Rhodopseudomonas palustris HaA2]
 gi|86573582|gb|ABD08139.1| Peptidase S1C, Do [Rhodopseudomonas palustris HaA2]
          Length = 528

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 144/511 (28%), Positives = 234/511 (45%), Gaps = 36/511 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYL-------VLEAKL------PPSSVDLPPVIARVSP 49
           ++  L    +  +       S             +A++          V    ++ +V P
Sbjct: 24  RKFALMASVVAGLGAGAFGLSQVPASGDLFSTAAQAQVGNEVHKAQQPVGFADIVEKVKP 83

Query: 50  SIVSVMVEPKKKVS-VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERL 108
           S++SV V   +KV+  ++              P++ +FR+   +                
Sbjct: 84  SVISVKVNIAEKVAKTDERSERSEESPFAPGSPMERFFRRFGGE-MPPGMRGHRGGGMMT 142

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGFFIT DGY +T+NH+V+      V   D     AK++GTD   DLA++K +    
Sbjct: 143 GQGSGFFITADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTDLALIKAEGRTD 202

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQ 227
           F   +  +    R+G+ V  +GNPF L GTV+AGIVSA  RD+ + P   F QIDAP+N+
Sbjct: 203 FPFAKLSE-GKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDLGNGPYDDFIQIDAPVNK 261

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP F+  G V+GVN  I +     +G+   IP S +K  +  L  KG V  GW G+
Sbjct: 262 GNSGGPAFDVNGEVMGVNTAIYSPSGGSVGIAFSIPASTVKAVVQQLKDKGSVSRGWIGV 321

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T E+A  LGL+   G+L+       PA KAG++ GDVI  ++G  +K  ++    
Sbjct: 322 QIQPVTPEIADSLGLKKPDGALVAEPQPNGPAAKAGIESGDVITAVNGAPVKDARELART 381

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----------ELLGMV 397
           I   +P   VK+++  +G+   +++ LG  P          GD             LG+ 
Sbjct: 382 IGGFAPGNTVKLTVFHKGADRELSLTLGQLPNQVEAKANLDGDNGRQSSRGTEVPRLGLT 441

Query: 398 LQDIND-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           +   +         +V  + + +     +G ++G  I+ V    V+   DV   I  AK 
Sbjct: 442 VAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVAGKNVASPGDVRDAINTAKN 501

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             ++SVL++++        +   SRFV++ I
Sbjct: 502 DNKNSVLIRVR--------SGGSSRFVAVPI 524


>gi|126725615|ref|ZP_01741457.1| possible serine protease [Rhodobacterales bacterium HTCC2150]
 gi|126704819|gb|EBA03910.1| possible serine protease [Rhodobacterales bacterium HTCC2150]
          Length = 508

 Score =  218 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 145/493 (29%), Positives = 234/493 (47%), Gaps = 38/493 (7%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           +S   + L      +  +   A+          +   VS S+V++        + +    
Sbjct: 40  RSFVALVLGVAFLMAQAISANAR----PDSFADLAEDVSNSVVNITTSTTVAGAAD---- 91

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                 +PE  PL+++FR    +   G+ P           GSGF I+ DGYI+T+NH++
Sbjct: 92  --LRPIVPEGSPLEDFFRDFTERQRDGQRP-----RRSAALGSGFVISADGYIVTNNHVI 144

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           +      +      EL AKLVGTD   D+A+LKV+SD     VEF +++  RVG+ V  +
Sbjct: 145 DKADEIMIEFFSGLELEAKLVGTDPKTDIALLKVESDVPLEFVEFGNSDVARVGDWVMAV 204

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           GNP     +VSAGI+SA +R +      F Q DA IN+GNSGGP FN  G VIGVN  I+
Sbjct: 205 GNPLGQGFSVSAGIISARNRSLSGTYDDFIQTDAAINKGNSGGPLFNMDGDVIGVNTAIL 264

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +     +G+G  +  S++   +  L+  G    GW G+  Q++T ++A  LGL   +G+L
Sbjct: 265 SPSGGSIGIGFSMSSSVVTNVVDQLLEFGETRRGWLGVRIQDVTADVAEALGLAKAEGAL 324

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           IT  V + PA  AG+  GDVI   DG  I   ++ V  + +    + V + + +EG++ +
Sbjct: 325 ITD-VPDGPAKDAGVLAGDVILTFDGADIVDTRELVRIVGNTQVGKAVDVLVVREGAEVT 383

Query: 370 VAVVLGSS-------PTAKNDMHLEVGDKELLGMVLQDINDGNK-------KLVRIVALN 415
           +A+ LG         P +         D+E+LG+ L  + D  +       K   +V  +
Sbjct: 384 LAITLGRREEAESVVPASAPATETPPADQEVLGIKLAPLTDELRAELDLGEKATGLVVRD 443

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
            + + E   KG++ G  I      +V    D+ + +  A E  R S+LL ++        
Sbjct: 444 LDEQSEAYEKGLRAGDLIAEAGQKKVVSAADLTKQVEIAIEAGRKSLLLLVRRA------ 497

Query: 476 NDNMSRFVSLKID 488
                RFV+L + 
Sbjct: 498 --GQPRFVALSVQ 508


>gi|74318109|ref|YP_315849.1| peptidase S1C, Do [Thiobacillus denitrificans ATCC 25259]
 gi|74057604|gb|AAZ98044.1| peptidase S1C, Do [Thiobacillus denitrificans ATCC 25259]
          Length = 464

 Score =  218 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 132/482 (27%), Positives = 229/482 (47%), Gaps = 31/482 (6%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
             +A+T  +F     V EA      VD+  ++ +  P++V++      K   E       
Sbjct: 4   AALAMTSFVFVLAAPVAEA------VDVADLVEKQGPAVVNISTTKLVKRGAEGFP---- 53

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
              +PED  ++ +FR+ F           +        GSGF ++ DGYILT+ H+V+  
Sbjct: 54  -FAVPEDPEMQEFFRRFFPGVPGRAPGAPAQEFPAHGAGSGFIVSSDGYILTNAHVVKGA 112

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
               V L+D  +  AK+VG+D   D+AV+++ +      V   D   +RVGEAV  IG+P
Sbjct: 113 DEVVVKLTDKRKFIAKVVGSDPRTDVAVIRITARNL-PAVRLGDPEKLRVGEAVAAIGSP 171

Query: 193 FRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F    +V+AGIVSA  R +P      F Q D  +N GNSGGP FN  G V+G+N+ I + 
Sbjct: 172 FGFENSVTAGIVSAKGRSLPSESYVPFIQTDVAVNPGNSGGPLFNMRGEVVGINSQIYSQ 231

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
              + GV   IP+ I  + +  L + G+V  GW G+M Q ++ +LA   GL   +G+L++
Sbjct: 232 SGGYQGVAFAIPIDIAMEVVDQLKAGGKVSRGWLGVMIQEVSADLAESFGLDRPRGALVS 291

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V   SPA +AG++  DVI   +G+ +++  D    + S  P  ++ + + + G   ++ 
Sbjct: 292 QVQDGSPAARAGVQTADVILSFNGKPVENSGDLPRIVGSTKPGSKIPMQVWRRGKMQTLQ 351

Query: 372 VVLGSSPTAKNDMHLEVGDK--ELLGMVLQDINDGNKKLV----RIVALNPNREREVEAK 425
           VVL   P+ +         K     G+ L ++N   ++ +     ++        +    
Sbjct: 352 VVLAELPSEEQVAGAGKSGKSYSRGGLALSELNPEQRRELKIDHGLLVEEVT--GDAARA 409

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           GI+ G  +++VN   ++ +    + I    + K  ++L++              S ++ L
Sbjct: 410 GIRVGDIVLAVNNARIATVDAFRQAIAAIPKGKSAALLVR----------RGEGSLYIPL 459

Query: 486 KI 487
           KI
Sbjct: 460 KI 461


>gi|260462375|ref|ZP_05810583.1| protease Do [Mesorhizobium opportunistum WSM2075]
 gi|259031869|gb|EEW33137.1| protease Do [Mesorhizobium opportunistum WSM2075]
          Length = 516

 Score =  218 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 169/501 (33%), Positives = 263/501 (52%), Gaps = 36/501 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM-FNA 70
           I   ALT    S           P       V+ RVSP++VSV V+ K + + +    + 
Sbjct: 28  IGVGALTSGT-SPVLADAVRVEAPQVPSFADVVERVSPAVVSVKVKAKIQPTADDGSDDQ 86

Query: 71  YGFGNLPEDHPLKNYFRKD--FHKFFS---------GEEPILSDTVERLMFGSGFFITDD 119
            G  NLP +  L+ +F++   F              G     +     +  GSGFFI++D
Sbjct: 87  DGLDNLPNNPQLRRFFKEFRGFGDQGGQNDEGHRRFGHRDRNNGQPRPVAQGSGFFISED 146

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GY++T+NH+VE+G +F+V+ +D  EL AKLVGTD   DLAVLKV    KF  V+F D + 
Sbjct: 147 GYLVTNNHVVEEGTAFTVVTNDGKELDAKLVGTDPRTDLAVLKVDGGGKFTYVDFADDSK 206

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNAL 238
           +RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   F QIDA +N+GNSGGP FN  
Sbjct: 207 VRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDASVNRGNSGGPTFNLN 266

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N  I +     +G+   IP S  ++ +  L+  G V  GW G+  Q +T ++A 
Sbjct: 267 GQVVGINTAIFSPSGGSVGIAFDIPASTARQVVGDLMKNGAVQRGWLGVEIQPVTSDIAE 326

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+   G+L+++   + P  KAG+  GDVI  +DG+ + S ++    I + SP + V 
Sbjct: 327 SLGLKSNNGALVSSAQDDGPGKKAGITAGDVITQVDGKDVASPKELARLIGAYSPGKPVD 386

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----------LGMVLQDINDGNKKL 408
           +++ ++G   +V V LG  P +      +   +            LG+ +      ++  
Sbjct: 387 VTVWRDGKSQTVKVDLGKLPASDKQASNDQQQQPAAPAKPDTLADLGLTVT----KSENG 442

Query: 409 VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
             +V  + + + +   +GIQ G  I +VN+ EV+  +DV + + +A +  R +VL+QI  
Sbjct: 443 KGLVVTDVDPDSDAADRGIQPGDVITAVNSTEVNGTEDVTKAMTEAVKSGRKAVLMQITR 502

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
           D        + +RFV+L + K
Sbjct: 503 D--------DNNRFVALPVAK 515


>gi|296446922|ref|ZP_06888858.1| protease Do [Methylosinus trichosporium OB3b]
 gi|296255597|gb|EFH02688.1| protease Do [Methylosinus trichosporium OB3b]
          Length = 503

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 134/503 (26%), Positives = 227/503 (45%), Gaps = 29/503 (5%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
             +  +++  + + C           AK P S  DL   +     ++V++          
Sbjct: 11  SAIGARALARLLVPCFAGLLAIAPAAAKGPDSLADLSATVQD---AVVNISATQTIDPKS 67

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDDGYIL 123
                           P  + F + F +   G+  P L    +    GSGF I   G I+
Sbjct: 68  AHKGGPDSGPGGAPGTPFDDLFEEFFRRRQQGQGAPELPRPRKSSSLGSGFVIDPSGIII 127

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+NH+V D    +VI +D  +L A+++G D   D+AVLKV+ ++    V+F D++  RVG
Sbjct: 128 TNNHVVADANEVTVIFTDGQKLKAEILGKDQKVDVAVLKVKPEKPLKAVKFADSDKARVG 187

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVI 242
           + V  +GNPF L G+V+AGI+SA +R+I   P   + Q DA IN+GNSGGP FN  G VI
Sbjct: 188 DWVLAVGNPFGLGGSVTAGIISARNRNIDSGPYDNYIQTDASINKGNSGGPLFNLDGEVI 247

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N  I++     +G+G   P + ++  I  L   G    GW G+  Q +   +A  L L
Sbjct: 248 GINTAILSPSGGSVGIGFATPSNTVEPVIEQLQKFGETRRGWLGVRIQKVDDAIAENLQL 307

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
              +G+L+  V  + P+  AG+K GDVI   DG+ IK  +D    +A+    ++V++ + 
Sbjct: 308 GHPRGALVAGVDDKGPSKSAGLKAGDVIVKFDGKPIKESRDLPKLVAATPVGKEVEVVIV 367

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---------LGMVLQDINDGNKKLV---- 409
           + G + + A+ LG     +        D            LG+ L  ++D  +       
Sbjct: 368 RGGKEQAKAIKLGRLEDGEKVASNGSPDGGWAEKSVTQKTLGLELSSLSDELRNRFQIKD 427

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                ++    +   +   K +Q G  ++ +N   ++   D  + +   K+  + S LL 
Sbjct: 428 AVKSGVIITGVDPRSDAADKRLQAGEILLEINQEPIADPADAVKKVKALKDGGKKSALLI 487

Query: 466 IKYDPDMQSGNDNMSRFVSLKID 488
           +             + FV+L ID
Sbjct: 488 VANG-------QGDTHFVALNID 503


>gi|163758997|ref|ZP_02166083.1| putative protease precursor signal peptide protein [Hoeflea
           phototrophica DFL-43]
 gi|162283401|gb|EDQ33686.1| putative protease precursor signal peptide protein [Hoeflea
           phototrophica DFL-43]
          Length = 480

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 138/485 (28%), Positives = 223/485 (45%), Gaps = 34/485 (7%)

Query: 23  SSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPL 82
           +       ++       +  +   +  ++V++                      P+  P 
Sbjct: 11  TPAITPAYSQNNAGPASVADLAEGLLDAVVNISTSQSVGGGGGSQPRMRA----PDGSPF 66

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDD-GYILTSNHIVEDGASFSVILSD 141
           +++F + F+      E            GSGF I  D G I+T+NH++E      V  +D
Sbjct: 67  QDFFDEFFNDR----ENQGPRNRRVSSLGSGFVIDADEGIIITNNHVIEGADDIEVNFAD 122

Query: 142 DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
            ++L A+LVG D   DLAVLKV+ D+    V F D++ +R+G+ V  IGNPF L GTV+ 
Sbjct: 123 GSKLKAELVGADPKTDLAVLKVEPDKPLTEVPFGDSDRMRIGDWVMAIGNPFGLGGTVTV 182

Query: 202 GIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           GI+SA  RDI   P   F Q DA IN+GNSGGP FN  G VIG+N  I++     +G+G 
Sbjct: 183 GIISARGRDINSGPYDNFIQTDAAINRGNSGGPLFNMNGEVIGINTAIISPSGGSIGIGF 242

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            +P  +    I  L   G    GW G+  Q +T ++   LG+    G+L+  +++  P D
Sbjct: 243 AVPTELAVNVIDQLREFGETRRGWLGVRIQPVTDDIGESLGMDEAMGALVAGIIRGGPVD 302

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
              ++VGDVI   DG+ +++ +D    +A     + V + + + G + +V V LG    +
Sbjct: 303 DGSIEVGDVIVRFDGKTVETMRDLPRVVAESPVGKAVDVVVIRGGEEVTVKVTLGRLEDS 362

Query: 381 KNDMHLE----------VGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVE 423
           +     E              E+LGM L +++D  ++          +V    + +    
Sbjct: 363 EQVASAETEGGDSTADMPATLEILGMTLAELDDEGREEFAIADTVEGVVITEVDPDSAAA 422

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
            K I+ G  IV +    V+  +DV   I   KE  R + LL       M SG     RFV
Sbjct: 423 EKRIEPGDVIVEIAQETVTTPEDVRTRIEALKEDGRRNALL-------MLSGKTGELRFV 475

Query: 484 SLKID 488
           ++++D
Sbjct: 476 TVRMD 480


>gi|90423349|ref|YP_531719.1| peptidase S1C, Do [Rhodopseudomonas palustris BisB18]
 gi|90105363|gb|ABD87400.1| Peptidase S1C, Do [Rhodopseudomonas palustris BisB18]
          Length = 528

 Score =  217 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 145/522 (27%), Positives = 233/522 (44%), Gaps = 45/522 (8%)

Query: 2   FKRQILSVKSICTVA-----LTCVIFSSTYLV---------------LEAKLPPSSVDLP 41
            +R + S +    +A     L   ++  +                   E +     V   
Sbjct: 17  LRRSLFSARKFALMASVVAGLGAGLYGLSPAPDHFNVLSTAAHAQVNNEVRKVAQPVGFA 76

Query: 42  PVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL 101
            ++ RV PS+  + V+      V +  ++          P++ +FR+             
Sbjct: 77  DIVERVKPSV--ISVKVNINEKVAKNDDSAEDSPFQPGSPMERFFRRFGGPDGMPPGLRG 134

Query: 102 SDTVER--LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
                      GSGFFI+DDGY +T+NH+V+      V   D     AK++GTD   DLA
Sbjct: 135 GRGGRGAVTGQGSGFFISDDGYAVTNNHVVDGADKVEVTTDDGRTFKAKVIGTDPRTDLA 194

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-F 218
           ++KV+    F   +  +    R+G+ V  +GNPF L GTV+AGIVSA  RDI + P   F
Sbjct: 195 LIKVEGGNNFPFAKLAE-GKPRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDF 253

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            QIDAP+N+GNSGGP F+  G V+GVN  I +     +G+   IP S +K  +  L  KG
Sbjct: 254 IQIDAPVNKGNSGGPAFDTSGEVMGVNTAIYSPSGGSVGIAFSIPASTVKTVVAQLKDKG 313

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
            V  GW G+  Q +TQE+A  LGL+   G+L+     + PA KAG++ GDVI  ++   +
Sbjct: 314 SVSRGWIGVQIQPVTQEIADSLGLKKADGALVAEPQADGPAAKAGIQSGDVITAVNDTPV 373

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH----------LEV 388
           K  ++    I   +P   VK+++  +G    V + LG  P                    
Sbjct: 374 KDARELARTIGGFAPGNSVKLNVIHKGQDKVVNLTLGQLPNTIEAKADVDRGDHGDAKRG 433

Query: 389 GDKELLGMVLQDI-NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
            D   LG+ L             +V    + +     +G ++G  I+ V    V+   +V
Sbjct: 434 SDIPRLGLTLAPAGTVAGAGKDGVVVTEVDPKSAAAERGFKEGDVILEVAGKSVASPTEV 493

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              +  AK + ++SVL++++        +   SRFV++ + K
Sbjct: 494 REALASAKTENKNSVLIRVR--------SGGSSRFVAVPLAK 527


>gi|260460969|ref|ZP_05809218.1| protease Do [Mesorhizobium opportunistum WSM2075]
 gi|259033003|gb|EEW34265.1| protease Do [Mesorhizobium opportunistum WSM2075]
          Length = 513

 Score =  217 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 151/516 (29%), Positives = 242/516 (46%), Gaps = 44/516 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTY---------LVLEAKLPPSSV---DLPPVIARVSP 49
            +R  ++      + ++ V+ S               +  +P  S       PV+A   P
Sbjct: 7   LRRHRVAALLGAALIISPVVVSFAQNTNGIAKIVATTQTPVPGISAPNGSFAPVVAATKP 66

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVER 107
           ++V+V    K +       + +      ++ P  +YFR+ F          P        
Sbjct: 67  AVVTVTTVMKAQPEAMNEASPFQ-----DNSPFDDYFRQFFGDQGMPMPRTPPQQQAPRT 121

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSGF +  DG I+T+NH+V+  +S  V L D TELPAK+VG+DA  DLAVLK+++ +
Sbjct: 122 EALGSGFIVGADGTIVTNNHVVDGASSIKVTLDDGTELPAKVVGSDAKNDLAVLKIKASK 181

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPIN 226
               V++ D++ +  G+ V  IGNPF +  TVSAGIVSA  RD+   P   F QIDAPIN
Sbjct: 182 PLPTVKWGDSDRLMTGDQVLAIGNPFGIGTTVSAGIVSARGRDLHSGPFDDFIQIDAPIN 241

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  +  G+VIG+N  I +     +GVG  IP    +K +  L   G + +G+ G
Sbjct: 242 HGNSGGPLVDVNGNVIGINTAIYSPNGGSVGVGFAIPSDQAQKVVAKLEKGGSIQYGYLG 301

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q +T ++A  +GL    G+L++ V   SPA  AG++ GDVI    G+ +K  +D   
Sbjct: 302 VDIQPVTPDVASAMGLDHPGGALVSQVNDGSPAALAGVETGDVITGFAGQDVKDPKDLSR 361

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL---------EVGDKELLGMV 397
            +A  +P  +  + + ++G    ++V +G +                  +      LG+ 
Sbjct: 362 AVADVAPGTRETLDVWRKGKAMKISVDVGRNSDDAKTASTGGSGAPGAEQGSGAPALGLG 421

Query: 398 LQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
           L DI    ++ +         V    N ++   A GIQ G  IV+VN   V   K V + 
Sbjct: 422 LMDITPDIRQQMNLADNERGAVVARVNPDKAAAAAGIQPGDIIVAVNQVPVKSAKQVTQA 481

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           + +A +  R SVLL ++              +V++ 
Sbjct: 482 VAQAGKSGRKSVLLLVERGGSQ--------IYVAVP 509


>gi|114771708|ref|ZP_01449112.1| possible serine protease [alpha proteobacterium HTCC2255]
 gi|114547780|gb|EAU50670.1| possible serine protease [alpha proteobacterium HTCC2255]
          Length = 492

 Score =  217 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 141/502 (28%), Positives = 232/502 (46%), Gaps = 33/502 (6%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           KR  +       +    V      L + A    +      +   +SPS+V++        
Sbjct: 8   KRLTIRQIHTVIINTLFVFSILMLLTVSAHARGAPESFADLAEELSPSVVNITTSTTIAG 67

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
             +Q         +PE  P ++ FR  F+    G+             GSGF ++ DGYI
Sbjct: 68  VTDQA-----RPQIPEGSPFEDLFRDFFNNGEGGQARP----RRSSALGSGFVVSSDGYI 118

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+++      +   D  EL AKLVG D   D+AVLKV++      V F D++  RV
Sbjct: 119 VTNNHVIDKADEIVIEFFDGKELVAKLVGRDPKTDIAVLKVEASEPLPFVGFGDSDIARV 178

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHV 241
           G+ V  IGNP     +VSAGI+SA +R +   P   F Q DA IN+GNSGGP FN  G V
Sbjct: 179 GDWVMAIGNPLGQGFSVSAGIISARNRTLRSGPYDDFIQTDAAINRGNSGGPLFNMSGEV 238

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           IGVN  I++     +G+G  +   ++ + +  L   G    GW G+  Q++  ++A  LG
Sbjct: 239 IGVNTAIISPNGGSIGLGFSMSSRVVGRVVKQLKEYGETRRGWLGVQIQDIDSDMAEALG 298

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L    G+L++  V E P   AG++ GDVI   DG  ++  +  V  + +    + V++ +
Sbjct: 299 LDKVSGALVSG-VPEGPGADAGIQSGDVIISFDGVEVEDTRGLVTAVGNADVGKVVRVII 357

Query: 362 CKEGSKHSVAVVLGSSPTAKND-------MHLEVGDKELLGMVLQDINDGNKKLV----- 409
            ++G   ++ V LG    A+ +          ++ + E  GM L  IN  ++  +     
Sbjct: 358 FRDGKTKTIKVTLGRREAAEKEKLVPVTKAPEKIKETEKFGMKLLTINSESRIKLNLPED 417

Query: 410 --RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              +  L+ +   +   KGI+ G  IV     +++ + D+ ++   A E  R S+LL + 
Sbjct: 418 LEGVAVLDVSDTSDAFEKGIRAGDVIVEAGRTKIADVNDISKIFEDAIEAGRKSILLLVL 477

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
                     + SRFV L + +
Sbjct: 478 RG--------DNSRFVGLSLSE 491


>gi|197116644|ref|YP_002137071.1| periplasmic trypsin-like serine protease [Geobacter bemidjiensis
           Bem]
 gi|197086004|gb|ACH37275.1| periplasmic trypsin-like serine protease [Geobacter bemidjiensis
           Bem]
          Length = 458

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 149/486 (30%), Positives = 231/486 (47%), Gaps = 37/486 (7%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
            +I    L   +F S+     A     + D   +  ++ P++V++       V   Q+  
Sbjct: 3   AAIVARFLVLSVFLSSIFSTVAGASVLTPDFAKLAKKLKPAVVNISTSKTLAVKKRQI-- 60

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                  P   P + YF K F               ++   G+GF I+DDGYI+T+NH+V
Sbjct: 61  ------APGQDPFQEYFDKFFE-------GPHQRPQKQRNLGTGFIISDDGYIITNNHVV 107

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           +D     V LSD  E    + G D   DLA++K+ +          D++ + VG+ V  I
Sbjct: 108 KDADEIKVKLSDGREFAGDVKGRDEKLDLALVKIDAKDHLPVAPLGDSDKMEVGDWVMAI 167

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FN  G VIG+N  I
Sbjct: 168 GNPFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNTEGEVIGINTAI 227

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           V       G+G  IP+++ K+ +P L S G+V  GW G+  Q +T +LA   GL   KG+
Sbjct: 228 VAG---GQGIGFAIPVNMAKEILPQLKSAGKVTRGWLGVSVQLVTPDLAKSFGLDTEKGA 284

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+  VVK SPA+KAG+K GD+I   DG  IK   +   ++A+    ++VK+ + +EG + 
Sbjct: 285 LVADVVKGSPAEKAGLKGGDIILEYDGHPIKEMGELPRRVAATPVGKKVKVVVLREGRQE 344

Query: 369 SVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV------RIVALNPNREREV 422
            + V +        +      D   LG+ + ++     + +       +V  +   +   
Sbjct: 345 PLQVTVEQLKEGGEEDSAVTSD--RLGVKVTELTPERAQQLRLQGDKGVVVTDVEPDSLA 402

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
           +  GI +G  I  +N   VS + D  +LI  AK+     +LL+              S F
Sbjct: 403 DRAGILEGDLIREINGVRVSGVSDYSKLIAAAKKGGYLKMLLR----------RGEASLF 452

Query: 483 VSLKID 488
           V+L+++
Sbjct: 453 VALRLE 458


>gi|114320499|ref|YP_742182.1| protease Do [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226893|gb|ABI56692.1| protease Do [Alkalilimnicola ehrlichii MLHE-1]
          Length = 481

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 128/473 (27%), Positives = 222/473 (46%), Gaps = 27/473 (5%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
             A       D   ++   SP++V++      +           F  +PEDHPL+++  +
Sbjct: 23  ASAGAKSHLPDFTELVEENSPAVVNISTRQTPESRGGSGRLPDHFD-IPEDHPLRDFMER 81

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAK 148
            F +   GE P           GSGF I++DGY+LT++H+++     +V LSD  E  A+
Sbjct: 82  FFGER--GERPPEHGQRRPRSLGSGFIISEDGYVLTNHHVIDGADEVNVRLSDRREFVAE 139

Query: 149 LVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALD 208
           ++G+D   D+AVLK+ ++     V    ++ +RVGE V  IG+PF    + +AGIVSA  
Sbjct: 140 VIGSDERSDVAVLKIDAEGL-PTVRIGQSDTLRVGEWVLAIGSPFGFEHSATAGIVSAKG 198

Query: 209 RDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSII 267
           R +P      + Q D  IN GNSGGP FN  G V+G+N+ I +     MGV   IP+ + 
Sbjct: 199 RSLPSGNYVPYLQTDVAINPGNSGGPLFNLDGEVVGINSQIYSRTGGFMGVSFSIPIELA 258

Query: 268 KKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVG 327
                 L   GRV  GW G++ Q++T++LA    +   +G+L+  V+ +SPA +A ++ G
Sbjct: 259 MDVATQLRETGRVARGWLGVIIQDVTRDLAESFDMDRPRGALVAQVLSDSPALEADLQPG 318

Query: 328 DVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE 387
           D+I   DG  +++       + +     +V++ + +EG +  V V +G  P  +      
Sbjct: 319 DIIVEFDGEAVETSGSLPPMVGATPVGAEVQVKVLREGREVMVDVTIGELPEEQARAQRP 378

Query: 388 VGDK---------ELLGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVS 435
              +         E LG+ ++ +     + +R+   V +           GI+ G  I S
Sbjct: 379 PRGEPERAPDTAAERLGLRVEPVPAERLEELRVDSGVLVRRVESGPAREAGIRPGDVITS 438

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           ++   V  ++    L+      +   VL+            +  +RF +L+I 
Sbjct: 439 IDQQSVEGVEQFAELVEGLASGRSVPVLVL----------REGGARFFALRIP 481


>gi|15964774|ref|NP_385127.1| protease precursor protein [Sinorhizobium meliloti 1021]
 gi|7531139|sp|Q52894|DEGP_RHIME RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|15073952|emb|CAC45593.1| Probable serine protease [Sinorhizobium meliloti 1021]
          Length = 504

 Score =  216 bits (549), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 180/517 (34%), Positives = 276/517 (53%), Gaps = 42/517 (8%)

Query: 1   MFKRQILSVKSICTVALTCVI---FSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE 57
           M K    +V  +  V LT  +    + ++        P+      V+  VSP++VSV V+
Sbjct: 1   MLK--TTTVAGLAAVLLTTGLPAEVAQSFAEAVRVQAPAVPSFANVVDAVSPAVVSVRVQ 58

Query: 58  PKKKVSVEQM-----FNAYGFGNLPEDHPLKNYFRKDFHK-------FFSGEEPILSDTV 105
            +++VS ++      F   GF +LPEDHPL+ +FR+   +       +     P     +
Sbjct: 59  ARERVSDDESNFTFDFGGRGFEDLPEDHPLRRFFREFAPRENDRADRWRDRRGPRGEGRL 118

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
                GSGFFIT+DGY++T+NH+V DG++F+VI++D TEL AKLVG D+  DLAVLKV  
Sbjct: 119 RPRAQGSGFFITEDGYLVTNNHVVSDGSAFTVIMNDGTELDAKLVGKDSRTDLAVLKVDD 178

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAP 224
            RKF  V F D   +RVG+ V  +GNPF L GTV+AGI+SA  RDI   P   + Q+DA 
Sbjct: 179 KRKFTYVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIISARGRDIGSGPYDDYLQVDAA 238

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           +N+GNSGGP FN  G V+G+N  I +    ++G+   IP S+ K  + SLI  G V  GW
Sbjct: 239 VNRGNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVVDSLIKDGTVSRGW 298

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  Q +T+++A  LGL    G+L+      SP +KAG+K GDV+  L+G  +K  +D 
Sbjct: 299 LGVQIQPVTKDIAESLGLSEANGALVVEPQAGSPGEKAGIKNGDVVTALNGEPVKDPRDL 358

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----------- 393
             ++A+  P    +++L + G   +V + +G+ P+   +     G+ +            
Sbjct: 359 ARRVAALRPGSTAEVTLWRSGKSETVNLEIGTLPSDAKEPAPATGEAQPDEGQAGEEALA 418

Query: 394 -LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
            LG+ +    DG      +   + + + +   +G+++G  IVSVN  EV    DV ++I 
Sbjct: 419 DLGLTVTPSEDGK----GVTIASVDPDSDAGDRGLKEGEKIVSVNNQEVKSADDVLKVIN 474

Query: 453 KAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            AK+  R   L QI+            SRFV+L I +
Sbjct: 475 NAKKDGRSKALFQIE--------AQEGSRFVALPITQ 503


>gi|170743953|ref|YP_001772608.1| protease Do [Methylobacterium sp. 4-46]
 gi|168198227|gb|ACA20174.1| protease Do [Methylobacterium sp. 4-46]
          Length = 504

 Score =  216 bits (549), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 165/503 (32%), Positives = 251/503 (49%), Gaps = 31/503 (6%)

Query: 3   KRQILSVKSICTVA---LTCVIFSSTYLVLEAKLPPSSV--------DLPPVIARVSPSI 51
           ++ + SV ++  VA   L       +  VL   LP + +           P++ RV P +
Sbjct: 12  RKALASVAAVTLVATGALGSAFLPPSTPVLAQALPQTPITAPEHPPGSFAPIVNRVKPGV 71

Query: 52  VSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFG 111
           VSV V+ K   + ++     G    P+   L+ +FR+       G          R   G
Sbjct: 72  VSVKVKLKDDAADDEEGGPGGQNVPPQ---LREFFRRFGEN---GMPNRPHRNGGRAAQG 125

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGFFI+ DGY++T+NH+VE+  S  V L D   L AK+VGTD   DLA+LKV       P
Sbjct: 126 SGFFISADGYVVTNNHVVENAKSVEVTLDDGRTLDAKVVGTDPKTDLALLKVTEGNGSFP 185

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNS 230
                    +VG+ V  IGNPF L GTV+AGIVSA  RDI   P   F QIDAPIN+GNS
Sbjct: 186 YVRLAHGAPQVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDAPINKGNS 245

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP FN  G V+GVN  I +    ++G+   IP   ++  +  L + G+V  G+ G+  Q
Sbjct: 246 GGPTFNVSGEVVGVNTAIASPSGGNVGLAFAIPSETVQAVVDQLRTDGKVARGYLGLQIQ 305

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            +T+++A  LGL   KG+L+T+    +PA KAG+K GDV+  ++G  +   ++   +IAS
Sbjct: 306 PVTKDIAEGLGLDKAKGALVTSAQDGTPAAKAGLKSGDVVQAVNGDPVGDARELSRRIAS 365

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE-----VGDKELLGMVLQDINDGN 405
             P  +V++S  + G   +  V L + P        E        +  LG+ L   +   
Sbjct: 366 MKPGTKVQLSYLRGGKTDTATVELATLPNDTRVAAREERGRGSDAQPRLGLSLAPADAVG 425

Query: 406 KKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +  +N + +    AKGI+ G  I+ V    VS + DV+  I  A+   R +VL++
Sbjct: 426 AGQEGVAVVNVDPDGPAAAKGIEPGDVILDVGGQPVSSVSDVQGRIRAAERDGRKAVLMR 485

Query: 466 IKYDPDMQSGNDNMSRFVSLKID 488
           +K        +D  +RFV++ + 
Sbjct: 486 VK--------SDKGTRFVAIALQ 500


>gi|332702073|ref|ZP_08422161.1| protease Do [Desulfovibrio africanus str. Walvis Bay]
 gi|332552222|gb|EGJ49266.1| protease Do [Desulfovibrio africanus str. Walvis Bay]
          Length = 480

 Score =  216 bits (549), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 139/503 (27%), Positives = 234/503 (46%), Gaps = 38/503 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
              ++     I  +    +   +   V  A LP        +  + +PS+V++  +    
Sbjct: 1   MSPRVHRFFPIAPILTLTLALFTAAGVQAASLPE----FTDLAEKAAPSVVNISSKVAMP 56

Query: 62  VSVEQMFNAYGFGNLPED-HPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
                M         P   +PL+ +FR  F +        +     +   GSGF I+ DG
Sbjct: 57  EGGPAMRQGPQGPQGPRGRNPLEEFFRDFFGE-------GMPMPRPQASLGSGFIISQDG 109

Query: 121 YILTSNHIVEDGASFSVILSDDTE-LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           +I+T+NH+V+D AS  V+L D  +  PAK++GTD   DLA++K++   + +P+EF ++  
Sbjct: 110 FIVTNNHVVQDAASIEVLLDDGKDTYPAKVIGTDPETDLALIKIEPKTRLVPLEFGNSEQ 169

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            +VGE V  +GNPF L  +V+AGI+SA  R I   P   F Q DA IN GNSGGP  N  
Sbjct: 170 AKVGEWVLAVGNPFGLDHSVTAGIISAKGRVIGAGPYDNFIQTDASINPGNSGGPLINMA 229

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  IV       G+G  +P  I +  I  L   G V  G  G+  Q++    A 
Sbjct: 230 GKVIGINTAIVA---TGQGIGFAVPSDIARGVIQQLREHGEVRRGLLGVAIQDMDANTAK 286

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+  +G+L+ +V   SPA +AG++ GDVI  ++G+ ++  +    +I +  P E+VK
Sbjct: 287 ALGLKEAQGALVASVSPGSPAAEAGIRQGDVITRVNGQPVEDSRTLTMRIGAMPPGERVK 346

Query: 359 ISLCKEGSKHSVAVVLGSSPTAK------NDMHLEVGDKELLGMVLQDINDGNK------ 406
           +++ + G +    V L                  +    ELLGM ++ + D         
Sbjct: 347 LTVWRGGKQKEYTVKLAKRSAEALGQMQPGQPGPQQPGGELLGMSMRKLTDQEASALGVE 406

Query: 407 KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               ++          E  G+  G  I+ +N   V+   + +R+I +  ++K  ++LL  
Sbjct: 407 PGRGVLVQAVAPGSPAEENGVAPGDVILEINQQPVNNPAEAQRIINEDAKRKGVALLLLS 466

Query: 467 KYDPDMQSGNDNMSRFVSLKIDK 489
           +            + FV++ + +
Sbjct: 467 RR---------GQNLFVTIPMGQ 480


>gi|49475272|ref|YP_033313.1| Serine protease [Bartonella henselae str. Houston-1]
 gi|51704299|sp|P54925|DEGP_BARHE RecName: Full=Probable periplasmic serine protease DO-like;
           AltName: Full=Antigen htrA; Flags: Precursor
 gi|49238078|emb|CAF27285.1| Serine protease [Bartonella henselae str. Houston-1]
          Length = 503

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 186/515 (36%), Positives = 277/515 (53%), Gaps = 39/515 (7%)

Query: 1   MFKRQI---LSVKSICTVALTCVIFS---STYLVLEAKLPPSSVD------LPPVIARVS 48
           M K+     L+  S      T + FS   S+    +A                 ++++V 
Sbjct: 1   MVKKTFFTTLAAVSFSAALETALFFSGCGSSLWTTKAHANSVFSSLMQQQGFADIVSQVK 60

Query: 49  PSIVSVMVEPKKKVSV---EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV 105
           P++VSV V+  KK         F+  GF  LP+ HPLK +F+  +++     + +     
Sbjct: 61  PAVVSVQVKSNKKKKEWFFSDFFSTPGFDQLPDQHPLKKFFQDFYNRDKPSNKSLQRSHR 120

Query: 106 -ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
              + FGSGFFI+ DGYI+T+NH++ DG S++V+L D TEL AKL+GTD   DLAVLKV 
Sbjct: 121 LRPIAFGSGFFISSDGYIVTNNHVISDGTSYAVVLDDGTELNAKLIGTDPRTDLAVLKVN 180

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR-PGTFTQIDA 223
             RKF  V+F D + +RVG+ V  IGNPF L GTV+AGIVSA  RDI       F QIDA
Sbjct: 181 EKRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGTGVYDDFIQIDA 240

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N+GNSGGP F+  G V+GVN  I +    ++G+   IP +  K+ +  LI KG V  G
Sbjct: 241 AVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAATAKQVVQQLIEKGLVQRG 300

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           W G+  Q +T+E++  +GL+  KG+LIT  +K  PA KAG+K GDVI  ++G  I   +D
Sbjct: 301 WLGVQIQPVTKEISDSIGLKEAKGALITDPLK-GPAAKAGIKAGDVIISVNGEKINDVRD 359

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE---------LL 394
              +IA+ SP E V + + K G + ++ V L S P  +N         E           
Sbjct: 360 LAKRIANMSPGETVTLGVWKSGKEENIKVKLDSMPEDENMKDGSKYSNEHGNSDETLEDY 419

Query: 395 GMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           G+++   +D     V +V  + + + +   KGI+ G  IV+VN   V  + D+   I  A
Sbjct: 420 GLIVAPSDD----GVGLVVTDVDPDSDAADKGIRPGDVIVTVNNKSVKKVSDITDTIKNA 475

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++  R ++LLQ++         ++ +RFV+L I K
Sbjct: 476 QKLGRKAILLQVR--------TNDQNRFVALPIFK 502


>gi|307309661|ref|ZP_07589313.1| protease Do [Sinorhizobium meliloti BL225C]
 gi|307319458|ref|ZP_07598885.1| protease Do [Sinorhizobium meliloti AK83]
 gi|306894830|gb|EFN25589.1| protease Do [Sinorhizobium meliloti AK83]
 gi|306899873|gb|EFN30496.1| protease Do [Sinorhizobium meliloti BL225C]
          Length = 517

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 178/513 (34%), Positives = 275/513 (53%), Gaps = 40/513 (7%)

Query: 5   QILSVKSICTVALTCVI---FSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           +  +V  +  V LT  +    + ++        P+      V+  VSP++VSV V+ +++
Sbjct: 16  KTTTVAGLAAVLLTTGLPAEVAQSFAEAVRVQAPAVPSFANVVDAVSPAVVSVRVQARER 75

Query: 62  VSVEQM-----FNAYGFGNLPEDHPLKNYFRKDFHK-------FFSGEEPILSDTVERLM 109
           VS ++      F   GF +LPEDHPL+ +FR+   +       +     P     +    
Sbjct: 76  VSDDESNFTFDFGGRGFEDLPEDHPLRRFFREFAPRENDRADRWRDRRGPRGEGRLRPRA 135

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGFFIT+DGY++T+NH+V DG++F+VI++D TEL AKLVG D+  DLAVLKV   RKF
Sbjct: 136 QGSGFFITEDGYLVTNNHVVSDGSAFTVIMNDGTELDAKLVGKDSRTDLAVLKVDDKRKF 195

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQG 228
             V F D   +RVG+ V  +GNPF L GTV+AGI+SA  RDI   P   + Q+DA +N+G
Sbjct: 196 TYVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIISARGRDIGSGPYDDYLQVDAAVNRG 255

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G V+G+N  I +    ++G+   IP S+ K  + SLI  G V  GW G+ 
Sbjct: 256 NSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVVDSLIKDGTVSRGWLGVQ 315

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +T+++A  LGL    G+L+      SP +KAG+K GDV+  L+G  +K  +D   ++
Sbjct: 316 IQPVTKDIAESLGLSEANGALVVEPQAGSPGEKAGIKNGDVVTALNGEPVKDPRDLARRV 375

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL------------LGM 396
           A+  P    +++L + G   +V + +G+ P+   +     G+ +             LG+
Sbjct: 376 AALRPGSTAEVTLWRSGKSETVNLEIGTLPSDAKEPAPATGEAQPDEGQAGEEALADLGL 435

Query: 397 VLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
            +    DG      +   + + + +   +G+++G  IVSVN  EV    DV ++I  AK+
Sbjct: 436 TVTPSEDGK----GVTIASVDPDSDAGDRGLKEGEKIVSVNNQEVKSADDVLKVINNAKK 491

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             R   L QI+            SRFV+L I +
Sbjct: 492 DGRSKALFQIE--------AQEGSRFVALPITQ 516


>gi|188582023|ref|YP_001925468.1| protease Do [Methylobacterium populi BJ001]
 gi|179345521|gb|ACB80933.1| protease Do [Methylobacterium populi BJ001]
          Length = 511

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 150/498 (30%), Positives = 241/498 (48%), Gaps = 37/498 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           V    V  ++  +   A+ P     L  +  +V+ ++V++      + S     N     
Sbjct: 27  VLGVTVTVTALPMPAFARGPE---SLADLAEKVTDAVVNISASTTVEASNRGGRN---LP 80

Query: 75  NLPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
            LP+  P ++ F + F +   G     E+     T +    GSGF I   G ++T+NH++
Sbjct: 81  QLPQGTPFEDLFEEFFKRRGQGAPKGDEDSPRGPTRKSNSLGSGFIIDASGIVVTNNHVI 140

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVL--KVQSDRKFIPVEFEDANNIRVGEAVF 187
            D     VIL D T+L A+++G D+  DLA+L  K  +DR    V F D++ +R G+ V 
Sbjct: 141 GDANDIQVILHDGTKLKAEIIGKDSKIDLALLRVKPTADRPLKAVPFGDSDKMRPGDWVM 200

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N 
Sbjct: 201 AIGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINT 260

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG-LRGT 305
            I++     +G+G  +P     + +  L   G V  GW G+  QN+ +  A  LG   G 
Sbjct: 261 AILSPSGGSVGIGFAVPSGTASQVVDQLRQFGEVRRGWLGVRIQNVDEATAEALGLKGGA 320

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           KG+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G
Sbjct: 321 KGALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKTVDVQIVRKG 380

Query: 366 SKHSVAVVLGSSPTAKN-------DMHLEVGDKELLGMVLQDINDGNKKLVR-------- 410
            + + +V+LG     +            E  ++++LG+ L  +ND  ++           
Sbjct: 381 EEQTKSVLLGRLEDGEKTQVANVKQPEAESVNRQILGLNLSGLNDEARRRFGIKESVKSG 440

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
           +V    +       K IQ G  IV V    V+   DV + +   K++ R SVLL +    
Sbjct: 441 VVVTKVDPNSTAADKRIQPGEVIVEVGQEAVANPADVTKRVEALKKQGRKSVLLLV---- 496

Query: 471 DMQSGNDNMSRFVSLKID 488
              +      RFV++ +D
Sbjct: 497 ---ASASGDVRFVAIGLD 511


>gi|312115806|ref|YP_004013402.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
 gi|311220935|gb|ADP72303.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
          Length = 532

 Score =  215 bits (546), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 148/481 (30%), Positives = 240/481 (49%), Gaps = 33/481 (6%)

Query: 23  SSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPL 82
           +    + +  LP S      +  +V P++VSV V+ +         +     +LP+DHPL
Sbjct: 49  AFAQEMKQGPLPGSPPTFADLADKVRPAVVSVNVKSRGAAGETAQKD---LPDLPQDHPL 105

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
           + +F +         +    +       GSGF I+ DGY++T++H+ +      +   ++
Sbjct: 106 REFFDQF--------KHNQPERRPSRAQGSGFLISPDGYVVTNHHVADKVDEIEITFENE 157

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
            +  AK+VG+DA  D+A+LK+ S +KF      +    RVG+ V  +GNPF L GTV+AG
Sbjct: 158 EKYKAKVVGSDARTDIALLKIDSKKKFDNWLEFEDAAPRVGDWVLAVGNPFGLGGTVTAG 217

Query: 203 IVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           IVSA  RDI   P  F QIDA +N+GNSGGP  +  G V+GVN  I +     +G+   I
Sbjct: 218 IVSANGRDIGSGPYDFLQIDAAVNRGNSGGPAVDLKGKVVGVNTAIYSPSGGSVGIAFAI 277

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P S  K+ +  L  KG+V  GW G+  QNL + +A   GL+  KG+L+  ++ + PA K+
Sbjct: 278 PTSTAKEVVDKLRDKGKVSSGWLGVQIQNLDENIAESQGLKTAKGALVAKIIADGPAAKS 337

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP---- 378
            +K  DVI  ++GR + + ++    IA+  P    K+ + + G +  V V LG  P    
Sbjct: 338 ELKARDVIQQVNGRTVGNSRELARTIAALPPGADAKLRVFRNGEEREVTVKLGEFPANDK 397

Query: 379 --------TAKNDMHLEVGDKELLGMVLQDIN--DGNKKLVRIVALNPNREREVEAKGIQ 428
                      +D      + E LG+ L       G K    +  +N +   +   +G++
Sbjct: 398 LASLQGGGNDDSDSSASGKELEDLGLTLIPAPEFPGAKTKEGVAIVNVDPNSKAADQGLR 457

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           +G  IV VN   V+   +V   I  A++K + +VLLQ++        + +  RF+ L ID
Sbjct: 458 RGDVIVEVNGKTVTSPDEVVEGIRDARQKNKKNVLLQVR--------SRDQQRFIGLPID 509

Query: 489 K 489
           K
Sbjct: 510 K 510


>gi|13476388|ref|NP_107958.1| serine protease [Mesorhizobium loti MAFF303099]
 gi|14027149|dbj|BAB54103.1| serine protease [Mesorhizobium loti MAFF303099]
          Length = 516

 Score =  215 bits (546), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 171/501 (34%), Positives = 265/501 (52%), Gaps = 36/501 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM-FNA 70
           I   ALT          +  + P        V+ RVSP++VSV V+ K + + +    + 
Sbjct: 28  IGVGALTSGTSPVLADAVRVEAPQVQ-GFADVVERVSPAVVSVKVKAKIQPTADDGSDDQ 86

Query: 71  YGFGNLPEDHPLKNYFRKD--FHKFFS---------GEEPILSDTVERLMFGSGFFITDD 119
            GF NLP +  L+ +F++   F              G     +D    +  GSGFFI++D
Sbjct: 87  DGFDNLPNNPQLRRFFKEFRGFGDQGGQNDEGHRRFGHRDRSNDQPRPVAQGSGFFISED 146

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GY++T+NH+VE+G +F+V+ +D  EL AKLVGTD   DLAVLKV+   KF  V+F D + 
Sbjct: 147 GYLVTNNHVVEEGTAFTVVTNDGKELDAKLVGTDPRTDLAVLKVEGGGKFTYVDFADDSK 206

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNAL 238
           +RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   F QIDA +N+GNSGGP FN  
Sbjct: 207 VRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDASVNRGNSGGPTFNLN 266

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N  I +     +G+   IP S  K+ +  L+  G V  GW G+  Q +T ++A 
Sbjct: 267 GQVVGINTAIFSPSGGSVGIAFDIPASTAKQVVEDLMKSGAVQRGWLGVEIQPVTSDIAE 326

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+   G+L+++   + P  KAG+  GDVI  ++G+ + S ++    I + SP + V 
Sbjct: 327 SLGLKSNNGALVSSAQDDGPGKKAGITAGDVITQVEGKDVASPKELARLIGAYSPGKSVD 386

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----------LGMVLQDINDGNKKL 408
           +++ ++G   ++ V LG  P +      +   +            LG+ +      ++  
Sbjct: 387 VTVWRDGKSQTIKVDLGKLPASDKQASNDQQQQPAAPAKPDTLADLGLTVT----KSENG 442

Query: 409 VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
             +V  + + E     +GIQ G  I +VN++EV+   DV + +  A +  R +VL+QI  
Sbjct: 443 KGLVVTDVDPESAAADRGIQPGDIITAVNSNEVNGTDDVTKAMTDAVKSGRKAVLMQITR 502

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
           D        N +RFV+L + K
Sbjct: 503 D--------NNNRFVALPVAK 515


>gi|299131888|ref|ZP_07025083.1| protease Do [Afipia sp. 1NLS2]
 gi|298592025|gb|EFI52225.1| protease Do [Afipia sp. 1NLS2]
          Length = 502

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 144/515 (27%), Positives = 236/515 (45%), Gaps = 40/515 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MF    + +  +  +A+            +         +  V  +V  ++V++      
Sbjct: 1   MFH-APVRLSRLLPLAVAGGFLMMAASAPQPAFARGPDSIADVAEKVIDAVVNISTSQTV 59

Query: 61  --------KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGS 112
                   + + ++         LP D P   +F   F               +    GS
Sbjct: 60  NGRDEKGEEATPQKEGRNKANPKLPPDSPFNEFFDDFFKNR-----RADRGQHKVNSLGS 114

Query: 113 GFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF-IP 171
           GF I   G ++T+NH++ D    +VIL+D T++ A+LVG D   DLAVLK Q   K    
Sbjct: 115 GFIIDASGIVVTNNHVIADADEINVILNDGTKIKAELVGRDKKSDLAVLKFQPPEKKLTA 174

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNS 230
           V+F +++ +R+GE V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNS
Sbjct: 175 VKFGNSDKLRLGEWVIAIGNPFSLGGTVTAGIVSARNRDINSGPYDNYIQTDAAINRGNS 234

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP FN  G VIGVN  I++     +G+G  +P + +   +  L     V  GW G+  Q
Sbjct: 235 GGPLFNLDGEVIGVNTAIISPSGGSIGIGFAVPSNTVVGIVNQLRQYKEVRRGWLGVRIQ 294

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            +T E+A  LG++  +G+L+  V  + PA  AG++ GDVI   DG+ I+  +D    +A 
Sbjct: 295 QVTDEIADSLGVKPPRGALVAGVDDKGPAKPAGIEAGDVITSFDGKTIREMKDLPRAVAD 354

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPT----------AKNDMHLEVGDKELLGMVLQD 400
               + V + L ++G + +  V LG                     +   ++ LG+ L  
Sbjct: 355 TPVGKTVDVVLIRKGKEETHKVTLGRLDDGDKPVEASLKTPAPEPDKTVTQKALGLDLAA 414

Query: 401 INDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           I+   +   +I       V +  +R  +   + +  G  IV V    V+   DV++ I +
Sbjct: 415 ISKDLRTRYKIKDKVKGVVIVGVDRNSDAAERRLSAGDVIVEVAQEAVNSPADVKKRIDQ 474

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            K+  + S+LL +       S  +   RFV++ ++
Sbjct: 475 LKKDGKKSILLLV-------SNTEGELRFVAIAVN 502


>gi|288957922|ref|YP_003448263.1| hypothetical protein AZL_010810 [Azospirillum sp. B510]
 gi|288910230|dbj|BAI71719.1| hypothetical protein AZL_010810 [Azospirillum sp. B510]
          Length = 522

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 139/502 (27%), Positives = 237/502 (47%), Gaps = 29/502 (5%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE 65
           +L+  ++   A +    S       A    +      + A+VSP++V++    + K    
Sbjct: 28  VLAGPALAGWAASQAQQSGATPPAVAMAQDAPASFADLAAKVSPAVVNIAATQEAKA-EP 86

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS-----DTVERLMFGSGFFITDDG 120
           +          P   P + +FR+   +                  +    GSGF I   G
Sbjct: 87  RAQRGPAVPGFPPGSPFEEFFRQFQDQMGRNGGDQGDQGDQEPHGKTGALGSGFIIDPAG 146

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y++T+NH+++  +  +V L D T +PAK++G DA  DLA+LKV+SD+    V++ D++  
Sbjct: 147 YVVTNNHVIDGASEITVTLQDGTAMPAKVIGRDAKTDLALLKVKSDKPLPAVDWADSDKT 206

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALG 239
           RVG+ V  +GNPF L GTV+ GIVSA  RDI   P   + Q+DA IN+GNSGGP F+  G
Sbjct: 207 RVGDWVMAVGNPFGLGGTVTKGIVSARGRDIHSGPYDDYFQLDAAINRGNSGGPTFDLSG 266

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIG+N  I +     +G+G  IP ++ K+ +  L   G+V+ GW G+  Q +T ++A  
Sbjct: 267 RVIGINTAIYSPNGGSVGIGFAIPSNLAKEVVAQLKDSGKVERGWLGVKIQEVTPDIADS 326

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           +GL G KG+L+  V  +SPA +AG+  GDV+    G+ + + +D    +A     + V +
Sbjct: 327 VGLPGAKGALVAEVTADSPAQRAGLHQGDVVLSYAGKPVTTLRDLTRNVAETKAGDTVDL 386

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD----------KELLGMVLQDINDGNKKLV 409
            + ++G + +VAV +      +     +               + G+ L  ++   +K +
Sbjct: 387 KILRDGREKTVAVRIDRLTDQQQMASADGDTGKGSAGREEVAPVKGLKLAPLDPAARKRL 446

Query: 410 RI--VALNPNREREVEAKG--IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
            I                   I+ G  I  +   EV    DV R + +A++  + ++L+ 
Sbjct: 447 GIGEEVQGVVVTGLAANVDVPIRPGDVIERIGDTEVKSPADVRRQVTEAEKAGQKALLML 506

Query: 466 IKYDPDMQSGNDNMSRFVSLKI 487
           I               FV+LK+
Sbjct: 507 INR--------QGNESFVALKL 520


>gi|222081971|ref|YP_002541336.1| serine protease DO-like protein [Agrobacterium radiobacter K84]
 gi|221726650|gb|ACM29739.1| serine protease DO-like protein [Agrobacterium radiobacter K84]
          Length = 500

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 149/486 (30%), Positives = 242/486 (49%), Gaps = 30/486 (6%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
            A      +S         P       P++    P++V+V    K   +     N+    
Sbjct: 27  FAFNASTVASAAEPSGIIAPGG--SFAPIVDADKPAVVTVTTTMKATDTSADTSNS---- 80

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
             P D   + +F      F   + P    +   +  GSGF I+ DG I+T+NH++E+  +
Sbjct: 81  --PMDEQFRQFFENQGIPFPQQQAPQRHQSQSAMALGSGFIISPDGIIVTNNHVIENATN 138

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V L D TELPAKL+G DA  DLAVLK+Q+ +    V + D++ +++G+ +  IGNPF 
Sbjct: 139 IKVTLDDGTELPAKLLGADAKSDLAVLKIQAPKPLATVAWGDSDKLKLGDQILAIGNPFG 198

Query: 195 LRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G+V+G+N  I +   
Sbjct: 199 IGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDREGNVVGINTAIYSPNG 258

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +GVG  IP    K  +  L   G +DHG+ G+  Q +T ++A  +GL   +G+L+ +V
Sbjct: 259 GSVGVGFAIPSDEAKAIVAKLEKNGSIDHGYLGVAIQPVTSDIANAVGLSQPQGALVASV 318

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
              +PA +AG+K GD++  ++   +K+ +D    +A  SP ++  +++ ++G    V V 
Sbjct: 319 NDGTPAARAGIKSGDIVTAVNDETVKTPKDLSRLVADLSPGDKRSLTVWRDGKSMDVNVT 378

Query: 374 LGSSPTAKNDMH------LEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNRER 420
           +G +   K   +      +   ++  +G+ L D+    ++ +         V  + N ++
Sbjct: 379 IGGNDDGKQAANDGGDGKVLPSNQPSIGVGLADLTPDLREQLNLPHSVQGAVVASVNPDK 438

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
              A GIQ G  IVSVN   V    DV+  + +A +  R SVLL I+   D         
Sbjct: 439 SAAAAGIQAGDVIVSVNDQPVHSAHDVQSAVAEAGKAGRKSVLLLIERGGDKT------- 491

Query: 481 RFVSLK 486
            FV++ 
Sbjct: 492 -FVAVP 496


>gi|310329|gb|AAA97430.1| antigen [Bartonella henselae str. Houston-1]
          Length = 503

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 184/515 (35%), Positives = 276/515 (53%), Gaps = 39/515 (7%)

Query: 1   MFKRQI---LSVKSICTVALTCVIFS---STYLVLEAKLPPSSVD------LPPVIARVS 48
           M K+     L+  S      T + FS   S+    +A                 ++++V 
Sbjct: 1   MVKKTFFTTLAAVSFSAALETALFFSGCGSSLWTTKAHANSVFSSLMQQQGFADIVSQVK 60

Query: 49  PSIVSVMVEPKKKVSV---EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV 105
           P++VSV V+  KK         F+  GF  LP+ HPLK +F+  +++     + +     
Sbjct: 61  PAVVSVQVKSNKKKKEWFFSDFFSTPGFDQLPDQHPLKKFFQDFYNRDKPSNKSLQRSHR 120

Query: 106 -ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
              + FGSGFFI+ DGYI+T+NH++ DG S++V+L D TEL AKL+GTD   DLAVLKV 
Sbjct: 121 LRPIAFGSGFFISSDGYIVTNNHVISDGTSYAVVLDDGTELNAKLIGTDPRTDLAVLKVN 180

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR-PGTFTQIDA 223
             RKF  V+F D + +RVG+ V  IGNPF L GTV+AGIVSA  RDI       F QIDA
Sbjct: 181 EKRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGTGVYDDFIQIDA 240

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N+GNSGGP F+  G V+GVN  I +    ++G+   IP +   + +  LI KG V  G
Sbjct: 241 AVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAATANEVVQQLIEKGLVQRG 300

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           W G+  Q +T+E++  +GL+  KG+LIT  +K  PA KAG+K GDVI  ++G  I   +D
Sbjct: 301 WLGVQIQPVTKEISDSIGLKEAKGALITDPLK-GPAAKAGIKAGDVIISVNGEKINDVRD 359

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE---------LL 394
              +IA+ SP E V + + K G + ++ V L S P  +N         E           
Sbjct: 360 LAKRIANMSPGETVTLGVWKSGKEENIKVKLDSMPEDENMKDGSKYSNEHGNSDETLEDY 419

Query: 395 GMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           G+++   +D     + +V  + + + +   KGI+ G  IV+VN   V  + D+   I  A
Sbjct: 420 GLIVAPSDD----GLGLVVTDVDPDSDAADKGIRPGDVIVTVNNKSVKKVSDITDTIKNA 475

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++  R ++LLQ++         ++ +RFV+L I K
Sbjct: 476 QKLGRKAILLQVR--------TNDQNRFVALPIFK 502


>gi|150395861|ref|YP_001326328.1| protease Do [Sinorhizobium medicae WSM419]
 gi|150027376|gb|ABR59493.1| protease Do [Sinorhizobium medicae WSM419]
          Length = 517

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 174/513 (33%), Positives = 272/513 (53%), Gaps = 40/513 (7%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKL---PPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           +  +V  +  V LT  + +         +    P+      V+  VSP++VSV V+ +++
Sbjct: 16  KTTTVAGVAAVLLTTGLPAQITQSFAEAVSVPAPAVPSFANVVEAVSPAVVSVRVQAREQ 75

Query: 62  VSVEQM-----FNAYGFGNLPEDHPLKNYFRKDFHKFFSGE-------EPILSDTVERLM 109
            S ++      F   GF +LPEDHPL+ +FR+   +             P     +    
Sbjct: 76  ASDDESNFTFDFGGRGFDDLPEDHPLRRFFREFDPRDNDRADRWRDRRGPRGEGRLRPRA 135

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGFFIT+DGY++T+NH++ DG++F+VI+ D TEL AKLVG D+  DLAVLKV + RKF
Sbjct: 136 QGSGFFITEDGYLVTNNHVISDGSAFTVIMDDGTELEAKLVGKDSRTDLAVLKVDAKRKF 195

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQG 228
             V F D   +RVG+ V  +GNPF L GTV+AGI+SA  RDI   P   + Q+DA +N+G
Sbjct: 196 THVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIISARGRDIGSGPYDDYLQVDAAVNRG 255

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP FN  G V+G+N  I +    ++G+   IP S+ K  + SLI  G V  GW G+ 
Sbjct: 256 NSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVVDSLIKDGTVSRGWLGVQ 315

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q +T+++A  LGL   KG+L+      SP +KAG+K GDV+  L+G  +K  +D   ++
Sbjct: 316 IQPVTKDIAESLGLAEAKGALVVEPQTGSPGEKAGIKNGDVVTALNGEPVKDPRDLARRV 375

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL------------LGM 396
           A+  P    +++L + G   +V + +G+ P+   +     G+ +             LG+
Sbjct: 376 AALRPGSTAEVTLWRSGKSETVKLEIGTLPSDAKETAPTTGEAQPDEGQASDEALAGLGL 435

Query: 397 VLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
            +    D       +   + + + +   +G+++G  IVSVN  EV    D+ ++I  A++
Sbjct: 436 TVTPSEDDR----GVTITSVDPDSDASDRGLKQGEKIVSVNNQEVKSADDILKVINNARK 491

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
             R   L QI+            SRFV+L I +
Sbjct: 492 DNRTKALFQIE--------AQEGSRFVALPIAQ 516


>gi|288941446|ref|YP_003443686.1| protease Do [Allochromatium vinosum DSM 180]
 gi|288896818|gb|ADC62654.1| protease Do [Allochromatium vinosum DSM 180]
          Length = 474

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 140/491 (28%), Positives = 241/491 (49%), Gaps = 28/491 (5%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           ++ + T +LT  +     L +   L     D   ++A   P++V++  +     S+ Q  
Sbjct: 1   MRPLSTPSLTRAVLLGCLLAVGPALGRDLPDFTRLVAENGPAVVNISTKQ--SSSITQRL 58

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
             Y   NLPE  PL++ FR  F +    E PI  ++++    GSGFF++ DGY+LT++H+
Sbjct: 59  QPYSIPNLPEGSPLEDLFRHFFDE----EGPIPDESLQARSLGSGFFVSGDGYVLTNSHV 114

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           VE      V  SD  E  A+L+GTD   D+A+LKV+++            +++VGE V  
Sbjct: 115 VEGAEEIIVRTSDRREFVARLIGTDKRSDIALLKVEAEGL-PAARIGSGKDLQVGEWVLA 173

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IG+PF    + +AGIVSA  R +P      F Q D  IN GNSGGP FN  G V+GVN+ 
Sbjct: 174 IGSPFGFESSATAGIVSAKGRSLPSENYVPFIQTDVAINPGNSGGPLFNLDGEVVGVNSQ 233

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I +     MG+   IP+ +    +  L +KGRV  GW G++ Q++T+ELA   G+   +G
Sbjct: 234 IYSRTGGFMGLSFAIPIEVAMDVVEQLKTKGRVSRGWLGVLIQDVTRELAESFGMSQPRG 293

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+  V+ +SPA  AG++ GDVI   +GR + +       + +    E   + + + G +
Sbjct: 294 ALVAQVLPDSPAATAGLQPGDVILSYNGRDVPTSSSLPPLVGATPVGESAGLVVLRRGER 353

Query: 368 HSVAVVLGSSPTAK----NDMHLEVGDKELLGMVLQDINDGNKKLV-----RIVALNPNR 418
             + + +   P            +  +   LG+V++D+    +         ++  + ++
Sbjct: 354 IELTIKIQELPEDDQLAAEPGPTDKPEANRLGVVVRDLTPEMRHQFEIEQGGVLIESVDQ 413

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
                + G+  G  I+ ++   V  + D ER++G  +  +  +VL+Q            +
Sbjct: 414 G-PAASAGLNAGDVILMLDNQPVGNLADFERILGAIEPGRATAVLVQ----------RGD 462

Query: 479 MSRFVSLKIDK 489
              F +LK+ K
Sbjct: 463 TRMFYALKLPK 473


>gi|254441538|ref|ZP_05055031.1| protease Do subfamily [Octadecabacter antarcticus 307]
 gi|198251616|gb|EDY75931.1| protease Do subfamily [Octadecabacter antarcticus 307]
          Length = 462

 Score =  213 bits (542), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 135/483 (27%), Positives = 213/483 (44%), Gaps = 46/483 (9%)

Query: 28  VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFR 87
           V+ A           +   VSP++V++                   G +PE  P +++F+
Sbjct: 4   VVSADAQNRPATFADLAEIVSPAVVNITTSTVVAGRTGPQ------GVVPEGSPFEDFFQ 57

Query: 88  KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE--- 144
           +                      GSGF I+ DGYI+T+NH++E      +          
Sbjct: 58  EFGEDGP----------RRSSALGSGFVISADGYIVTNNHVIEGADEIEIEFFPGDNQPS 107

Query: 145 --LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI--RVGEAVFTIGNPFRLRGTVS 200
             LPA LVGTD   D+A+LKV+ D     V F D+N    RVG+ V  +GNP     +VS
Sbjct: 108 KLLPAVLVGTDPNTDIALLKVEYDTPLSFVSFGDSNGPGSRVGDWVMAMGNPLGQGFSVS 167

Query: 201 AGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           AGI+SA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G 
Sbjct: 168 AGIISARNRSLQGTYDDYIQTDAAINRGNSGGPLFNMNGDVIGVNTAILSPNGGSIGIGF 227

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            +   ++   I  L   G    GW G+  Q++T ++   +         +   V   PA+
Sbjct: 228 AMSSDVVSNVIDQLEEFGETRRGWLGVRIQDVTADMIDAIDGLQEARGAMVTDVPAGPAE 287

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
            AGM+ GD+I   DG  I+  ++ V  + +    ++V + + + G    + VVLG   TA
Sbjct: 288 DAGMESGDIILQFDGIAIEDTRELVQIVGNSPVGKEVPVEILRGGEMVDLTVVLGRRETA 347

Query: 381 KNDMHLEVGD---------KELLGMVLQDINDGNKKLVRI------VALNPNREREVEAK 425
           +       GD           +LGM L +I    ++ + +      V +    +   E K
Sbjct: 348 EAVAFPLDGDTPDEGTPNTSNMLGMTLSEITPDMEESLGVEAGSGLVIVEVEADSGAETK 407

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           G+  G  I       +S I D E  +  A+E  R S+LL ++ D           RFV++
Sbjct: 408 GLLAGDLITEAGQQNISSIADFEARVEDAQEAGRKSLLLLVRRD--------GAPRFVAI 459

Query: 486 KID 488
            ++
Sbjct: 460 GLE 462


>gi|154251399|ref|YP_001412223.1| protease Do [Parvibaculum lavamentivorans DS-1]
 gi|154155349|gb|ABS62566.1| protease Do [Parvibaculum lavamentivorans DS-1]
          Length = 491

 Score =  213 bits (541), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 151/503 (30%), Positives = 257/503 (51%), Gaps = 37/503 (7%)

Query: 3   KRQILSVK---SICTVALTCVIFSSTYLVLEAKLPPSS-----VDLPPVIARVSPSIVSV 54
           +++ L++    ++   A +    +   L   +  P S+          ++ +V+P++VS+
Sbjct: 9   RQRTLALAVAGALVFGAWSSGALAQEPLDTRSAAPASTALENLPSFADLVEKVNPAVVSI 68

Query: 55  MVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGF 114
            V+ +       + +       P   P + +FR    +      P           GSGF
Sbjct: 69  RVDEEVAARSSGVPDLP----FPPGSPFEKFFRDMQPQQGPDGAPPR---RHATALGSGF 121

Query: 115 FITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEF 174
            I+ DG+++T+NH+V DG   +V+ SD +E+ AKL+G D   DLA++KV+S      V F
Sbjct: 122 LISADGFVVTNNHVVGDGKDITVVRSDGSEMKAKLIGRDPKTDLALVKVESKEPLPYVVF 181

Query: 175 EDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGP 233
            +++N+RVG+ V  +GNPF L GTV+ GIVSA  R+I   P   F QIDA IN+GNSGGP
Sbjct: 182 GNSDNVRVGDWVLAVGNPFGLGGTVTTGIVSARGREIGAGPYDDFIQIDASINKGNSGGP 241

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
            F+  G+V+GVN  I +     +G+G  IP SI +  I  L   G+V  GW G+  Q + 
Sbjct: 242 TFDVRGNVVGVNTAIFSPTGGSVGIGFAIPSSIAQNVIAQLKEDGKVTRGWLGVTIQQVD 301

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
           +++A  L L   +G+L+  V ++SPA KAG++ GDVI  +DG+ ++  +     +A   P
Sbjct: 302 EDVASTLALDKPRGALVAQVAEDSPAKKAGIQTGDVILNVDGKEMEDVRAVSRTVADLQP 361

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTA-------KNDMHLEVGDKELLGMVLQDINDGNK 406
             + +I L ++G + +++  +G+ P                 G  E LG+ L       +
Sbjct: 362 DTRSQIVLWRDGKRKNISAQIGTFPEEIAAAAASPTGEAPAAGTTESLGLAL------TR 415

Query: 407 KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               ++  + +   +   KG++ G  IV V+  +V+   DV   + +A +  ++SVLL +
Sbjct: 416 SPEGVMVQSVDPASDAAEKGVRPGDIIVKVSGKDVTEPADVVARVAEAGKADKNSVLLLL 475

Query: 467 KYDPDMQSGNDNMSRFVSLKIDK 489
           +         DN  RFV+L ++K
Sbjct: 476 R--------TDNQQRFVALTLEK 490


>gi|83593536|ref|YP_427288.1| peptidase S1C, Do [Rhodospirillum rubrum ATCC 11170]
 gi|83576450|gb|ABC23001.1| Peptidase S1C, Do [Rhodospirillum rubrum ATCC 11170]
          Length = 508

 Score =  213 bits (541), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 144/495 (29%), Positives = 234/495 (47%), Gaps = 34/495 (6%)

Query: 14  TVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGF 73
            +A   V FS       A+          +   + P++V++                   
Sbjct: 23  ALAPALVAFSLAIAPFSAQAREIPESFADLAEGLLPAVVNISTTQTIDA-----DRGPEM 77

Query: 74  GNLPEDHPLKNYFRKDFHKFFSGEEP-ILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
              P   P + +F+  F +                   GSGF +   GYI+T+NH+++D 
Sbjct: 78  PQFPPGSPFEEFFKDFFERHGGPGGGVQPKTPRRATSLGSGFIVDAAGYIVTNNHVIQDA 137

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
              +VIL DDT + A+LVG D   D+A+L++++D+    V + ++   RVG+ V  IGNP
Sbjct: 138 DEITVILHDDTAIKAELVGKDEKTDVALLRIKTDKPLTAVPWGNSEAARVGDWVMAIGNP 197

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP FN  G VIG+N  I + 
Sbjct: 198 FGLGGTVTAGIISAKTRDINAGPYDSFIQTDAAINKGNSGGPLFNMHGEVIGINTAIFSP 257

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+G  +P ++  + I  +   GR   GW G+  Q++T E+A  LGL  + G+LI 
Sbjct: 258 SGGSIGIGFSVPSNLAHQVIDDIKKFGRTRRGWIGVRIQSVTDEIAEGLGLEKSAGALIA 317

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
           AV    PA  AG+KVGDVI   DGR +   +     +A     +   I + +EG +  + 
Sbjct: 318 AVTPGGPAAAAGLKVGDVIVSFDGRPVPDMRTLPRIVAETEIGKDAAIGVWREGKRQDLK 377

Query: 372 VVLGSSPTAKNDMHLEVGDKEL------------LGMVLQDINDGNKKLVR-------IV 412
           + +G    A+++  L   +               +G+ +  ++D  +           +V
Sbjct: 378 MKVGELEVAEDEGLLNEPETSGVTDSQGGTAVATIGLTVTKLDDRLRSQFGFDAASEGVV 437

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
             +   E + + KG++ G  IV +N  EV+  +DV + + KAK++ R +VLL ++     
Sbjct: 438 VTDVTNESDAQEKGLEPGTLIVKINQTEVASPEDVVKAVAKAKDEGRKTVLLLVE----- 492

Query: 473 QSGNDNMSRFVSLKI 487
                    F+ +K+
Sbjct: 493 ---LRGTRTFIPVKM 504


>gi|152995133|ref|YP_001339968.1| protease Do [Marinomonas sp. MWYL1]
 gi|150836057|gb|ABR70033.1| protease Do [Marinomonas sp. MWYL1]
          Length = 469

 Score =  213 bits (541), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 138/475 (29%), Positives = 227/475 (47%), Gaps = 19/475 (4%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           +  V+ SS  +        S  D   ++ + SP++V++  E                 N 
Sbjct: 8   VCMVVVSSFMMASMLTHAASLPDFTELVEKASPAVVNISTEQTVTTKTANEGGQQLGPNS 67

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
            E   L  +F+  F +   G++       +R   GSGF I+ DGY+LT+NH+++      
Sbjct: 68  EE---LNEFFKHFFGQQPFGQQ-APPQQGQRSSLGSGFIISHDGYVLTNNHVIDGADVIH 123

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V L+D  E  AKLVGTD   DLA+LK+++D     V+  D++ ++ G+ V  IG+PF   
Sbjct: 124 VRLNDRREYVAKLVGTDPRTDLALLKIEADDL-PIVKMGDSDKLKPGQWVLAIGSPFGFD 182

Query: 197 GTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
            TV+AGIVSA  R +P      F Q D  IN GNSGGP FN  G V+G+N+ I T     
Sbjct: 183 YTVTAGIVSATGRSLPSDNYVPFIQTDVAINPGNSGGPLFNLDGEVVGINSQIYTRSGGF 242

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           MGV   IP  +    +  L S G+V   W G++ Q++  ELA   GL  + G+LI+ V+ 
Sbjct: 243 MGVSFAIPSKVAMSVVDQLKSDGKVSRAWLGVLIQDVNNELAESFGLDRSNGALISRVLP 302

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
           +SPA+KAG+K GD+I   +G+ I    +  + +      E+V   + ++G + +++V L 
Sbjct: 303 DSPAEKAGLKSGDIILEFNGQSIAHSGELPYIVGQMKADEKVDAKVYRDGKEQTISVTLE 362

Query: 376 SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMT 432
           + P     +     D+  LGM++ ++     K   I   V +           G+Q+G  
Sbjct: 363 ARPNDPKVVAQSQQDQNRLGMIVGEVPADMAKKFEIDNGVVIEQVLGGTAARNGLQQGDV 422

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           I  +N   ++ + +  ++       +  SV +++               F+  KI
Sbjct: 423 ITMLNGKRITSVAEFAKIAKDIPSGR--SVPMRVIR--------QGYPMFIPFKI 467


>gi|220926274|ref|YP_002501576.1| protease Do [Methylobacterium nodulans ORS 2060]
 gi|219950881|gb|ACL61273.1| protease Do [Methylobacterium nodulans ORS 2060]
          Length = 502

 Score =  213 bits (541), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 166/503 (33%), Positives = 252/503 (50%), Gaps = 33/503 (6%)

Query: 3   KRQILSVKSICTVA---LTCVIFSSTYLVLEAKLPPSSV--------DLPPVIARVSPSI 51
           ++ + SV ++  VA   L       +  VL   LP + +           P++ RV P +
Sbjct: 12  RKALASVAAVTLVATGALGTAFLPPSTPVLAQALPQTPITVPEHPPGSFAPIVNRVKPGV 71

Query: 52  VSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFG 111
           VSV V    K   +         NLP    L+ +FR+       G          R   G
Sbjct: 72  VSVKVS--LKDGADDDDGPGSVQNLPPQ--LREFFRRFGEN---GMPNRPHRNGGRAAQG 124

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGFFI+ DGY++T+NH+VE+  S  V L D   L AK++GTD   DLA+LKV     F  
Sbjct: 125 SGFFISPDGYVVTNNHVVENAQSVEVTLDDGRTLAAKVIGTDPKTDLALLKVTEGGPFPY 184

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNS 230
           V+       +VG+ V  IGNPF L GTV+AGIVSA  RDI   P   F QIDAPIN+GNS
Sbjct: 185 VKLAH-GAPQVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDAPINKGNS 243

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP FN  G V+GVN  I +    ++G+   IP   ++  +  L + G+V  G+ G+  Q
Sbjct: 244 GGPTFNVSGEVVGVNTAIASPSGGNVGLAFAIPSETVQAVVDQLRTDGKVARGYLGLQIQ 303

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            +T+++A  LGL   KG+L+T+    +PA KAG+K GDV+  ++G  +   ++   +IA+
Sbjct: 304 PVTKDIAEGLGLDKAKGALVTSTQDGTPAAKAGLKSGDVVQAVNGEPVSDARELSRRIAA 363

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPTA-----KNDMHLEVGDKELLGMVLQDINDGN 405
             P  +V++S  + G   +  V LG+ P       +++       +  LG+ L   +   
Sbjct: 364 MKPGTKVELSYLRGGKTDTATVELGTLPNDIKVASRDERGRGSDAQPRLGLSLAPADAVG 423

Query: 406 KKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +  +N + +    AKGI+ G  I+ V    VS + DV+  I  A+   R +VL++
Sbjct: 424 AGTEGVAVVNVDPDGPAAAKGIEPGDIILDVGGQPVSSVSDVQSRIRSAERDGRKAVLMR 483

Query: 466 IKYDPDMQSGNDNMSRFVSLKID 488
           IK D  +        RFV++ + 
Sbjct: 484 IKSDKGV--------RFVAIGLQ 498


>gi|254476627|ref|ZP_05090013.1| protease DO [Ruegeria sp. R11]
 gi|214030870|gb|EEB71705.1| protease DO [Ruegeria sp. R11]
          Length = 500

 Score =  213 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 147/502 (29%), Positives = 244/502 (48%), Gaps = 44/502 (8%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM 67
           S + +    L  ++  +   + +A+       L P+  +VSP+            +    
Sbjct: 23  SARVMLLAGLAMMMVLAQVAIAQAR----PDSLAPLADKVSPA------VVNITTTTVVE 72

Query: 68  FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNH 127
             A   G +PE  P +++FR+   +   G  P           GSGF I++DGYI+T+NH
Sbjct: 73  GRAGPQGIVPEGSPFEDFFREFQDRNGQGNRP-----RRSSALGSGFVISEDGYIVTNNH 127

Query: 128 IVEDGASFSVILSDD-----TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           ++E+     +            LPAK+VGTD   D+A+LKV +      V+F D++  RV
Sbjct: 128 VIEEADEIEIEFFPGDGQPAQPLPAKVVGTDPNTDIALLKVDAPMPLSFVKFGDSDIARV 187

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVI 242
           G+ V  +GNP     +VSAGIVSA +R++      + Q DA IN+GNSGGP FN  G VI
Sbjct: 188 GDWVVAMGNPLGQGFSVSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMDGEVI 247

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           GVN  I++     +G+G  +  +++ K +  L   G    GW G+  Q++T ++A  +G+
Sbjct: 248 GVNTAILSPNGGSIGIGFSMASNVVTKVVDQLREYGETRRGWLGVRIQDVTSDVAEAMGM 307

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
              KG+L+T  V E PA  AG+  GDVI   DG  ++  +  V Q+ +    + V++ + 
Sbjct: 308 DSAKGALVTD-VPEGPAKDAGLLAGDVILSFDGADVEDTRGLVRQVGNTEVGKAVRVVVY 366

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVG--------DKELLGMVLQDINDGNKKLV----- 409
           +EG   ++ V LG    A+     + G        +KELLG+ +  ++D  +  +     
Sbjct: 367 REGKTETLRVTLGRREDAQRQAGADTGSEIAPDTREKELLGLTVSRLSDDQRSELNVPEG 426

Query: 410 --RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              +V    +   E   KG++ G  I      ++S I ++E  I +AKE  R S+LL ++
Sbjct: 427 TDGLVITGVDETSEAFEKGLRAGDIITEAGQQKLSTIAELEDRISEAKEAGRKSLLLLVR 486

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
              +         RFV+L + +
Sbjct: 487 RAGE--------PRFVALNLAE 500


>gi|262277522|ref|ZP_06055315.1| protease Do [alpha proteobacterium HIMB114]
 gi|262224625|gb|EEY75084.1| protease Do [alpha proteobacterium HIMB114]
          Length = 472

 Score =  213 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 144/484 (29%), Positives = 239/484 (49%), Gaps = 32/484 (6%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           +  +IF    L+  A     S     +  ++ PS+V++      +   ++          
Sbjct: 7   ILVIIFIFQGLINSAYSIDVSKGFSKLAEKLMPSVVNISATTIVETRSQEFP-----FQF 61

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
           P   P + +F+         ++       +    GSGF I ++G ++T+NH++++     
Sbjct: 62  PPGSPFEEFFKDF-------QQNQGPQKRKSTALGSGFVIKENGTVITNNHVIQNAEGIF 114

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           V  +D  E  AKL+GTD + D+AVLK+QSD+KF  V F +++  +VG+ V  IGNPF L 
Sbjct: 115 VKFTDGKEYEAKLIGTDPVSDIAVLKIQSDKKFPAVNFANSDEAKVGDWVIAIGNPFGLG 174

Query: 197 GTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
           GTV+ GIVSA++RDI       F Q DA INQGNSGGP FN  G V+G+N  I ++    
Sbjct: 175 GTVTQGIVSAINRDINMGRYDNFIQTDASINQGNSGGPLFNMDGEVLGINTAIFSNSGGS 234

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           +G+G  IP +  K  I  LI  G    GW G+  Q +T+E+A  LGL+   G+LIT + K
Sbjct: 235 VGIGFAIPSNFAKNVIDQLIKFGETKRGWLGVRIQTVTKEIADSLGLKEAIGALITDINK 294

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
            SPADKAG+  GD+I   +G+ +K+ +D    +      +   + + ++  + S  VVLG
Sbjct: 295 GSPADKAGLNSGDIIIKFNGKKVKTTRDLQRLVGESPVGKAANLKIWRDKKEISKTVVLG 354

Query: 376 SSPTAKNDMHLEVGDK-----ELLGMVLQDINDGNK-------KLVRIVALNPNREREVE 423
                    +             LG+ ++DI + +K       K   ++    N    + 
Sbjct: 355 RLEDTAEFKNKIPTKSKEQTLSSLGIDVRDIKEEDKKNRNKLEKKSGVIIQKINPNGAMA 414

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
              ++ G  I+S+  + +  +KD E+ + K  +  + ++LL I           N +R++
Sbjct: 415 LLPVRPGDAIISLQNNSIKNVKDFEKQLKKQIKSGKKTLLLTI-------IDLQNTTRYI 467

Query: 484 SLKI 487
            +KI
Sbjct: 468 GVKI 471


>gi|209885692|ref|YP_002289549.1| protease Do subfamily [Oligotropha carboxidovorans OM5]
 gi|209873888|gb|ACI93684.1| protease Do subfamily [Oligotropha carboxidovorans OM5]
          Length = 528

 Score =  213 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 141/511 (27%), Positives = 244/511 (47%), Gaps = 38/511 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD-----------LPPVIARVSPSI 51
           +R  L    +  +       + +          + V+              ++ RV PS+
Sbjct: 31  RRFALMASVVAGLGAAAYGLAPSAPPSFVSAAHAQVNKDVRQVERPIGFADIVERVKPSV 90

Query: 52  VSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-RLMF 110
           +SV V+ ++K S  +    +     P   P++ +FR+                       
Sbjct: 91  ISVRVKIEEKQSANEDDLPF-----PPGSPMERFFRRFGGPDGFPGGRGPRGRGHLTTGQ 145

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGFFI+ DGY +T+NH+V+      V   D     AK++G+D   DLA++KV+    F 
Sbjct: 146 GSGFFISADGYAVTNNHVVDGAEQVEVTTDDGKTYKAKVIGSDKRTDLALIKVEGGSDFP 205

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGN 229
             +  D+   R+G+ V  +GNPF L GTV++GI+SA  RDI + P   F QIDA +N+GN
Sbjct: 206 FAKLSDSEP-RIGDWVLAVGNPFGLGGTVTSGIISARGRDIGNGPYDDFIQIDAAVNKGN 264

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP FN  G VIGVN  I +     +G+   IP + +K  +  L  KG V  GW G+  
Sbjct: 265 SGGPAFNTAGEVIGVNTAIYSPSGGSVGIAFSIPSATVKNVVAQLKDKGSVSRGWIGVQI 324

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           Q +T E+A  LGL+  +G+L+       PA KAG++ GDVI  ++ + +K  ++    I 
Sbjct: 325 QPVTPEIADSLGLKKPEGALVAEPQANGPAAKAGIESGDVINKVNDQPVKDARELARTIG 384

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSP----------TAKNDMHLEVGDKELLGMVLQ 399
             +P   +K+ +  +G++ +V + LG  P           ++++   +  D   LG+ + 
Sbjct: 385 GLAPGASIKLGVLHKGAEKTVTLTLGELPNNVSPKSFNPESRSERPGQGADVPNLGLTVA 444

Query: 400 DI-NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
              +        +V  + +       +G+++G  I+ V    V+   D+   +  A+++ 
Sbjct: 445 PARSVAGAGREGVVITSVDPGGASAERGLKEGDVILEVAGKSVATAGDIRSALTTARDEN 504

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++SVL++I+        + + SRFV+L + K
Sbjct: 505 KNSVLIRIR--------SGDASRFVALPVGK 527


>gi|311693670|gb|ADP96543.1| serine protease MucD precursor [marine bacterium HP15]
          Length = 474

 Score =  212 bits (539), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 132/476 (27%), Positives = 214/476 (44%), Gaps = 17/476 (3%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + +   + L+ ++ +       A+   S  D   ++   + ++V++    +         
Sbjct: 1   MPAALLILLSAMVLAGWSQASSAR---SLPDFTELVEDNAGAVVNISTTTEPTRRNSGAP 57

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                    E  P   +F+  F    S       ++  R   GSGF ++ DGY+LT+NH+
Sbjct: 58  GMPFDERQLEQLP--EFFQDFFRGPQSPFGGGPGNSQPRRSMGSGFIVSSDGYVLTNNHV 115

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           VE      V L+D  ELPA LVGTD   D+AVLK+++      V+   + +++VGE VF 
Sbjct: 116 VEGADEIIVRLNDRRELPATLVGTDPRSDMAVLKIENGDDLPVVQVGRSRDLKVGEWVFA 175

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IG+PF    TV+AGIVSAL R +P      F Q D  IN GNSGGP FN  G V+G+N+ 
Sbjct: 176 IGSPFGFDYTVTAGIVSALGRSLPSENYVPFIQTDVAINPGNSGGPLFNLEGEVVGINSQ 235

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I T     MGV   IP+         L   G V  GW G++ Q + ++LA   GL+  +G
Sbjct: 236 IYTRSGGFMGVSFAIPIDDAMNVFRQLRDNGSVSRGWLGVLIQEVNRDLAESFGLKRPRG 295

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +LI  V+  SPA  AG++ GD++   DG  ++   D    +      E  ++ + + G +
Sbjct: 296 ALIAEVMSGSPAQAAGLQAGDIVLSYDGDEVQLSSDLPPMVGRTPVGETAELRVLRGGEE 355

Query: 368 HSVAVVLGSSPTA------KNDMHLEVGDKELLGMVLQDINDGNKKLVRI---VALNPNR 418
             + V +G  P              +      LGM+++ +       + I   V +N   
Sbjct: 356 IELQVEIGRLPEEGSQQASAPASDSDGPGSAPLGMMVEPLPTDMADSMGIEGGVVVNNVA 415

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
                  GI+ G  I  +N  +V+ +++    +    E K  SV  ++        
Sbjct: 416 RGAASEAGIRAGDVITEMNRQKVTSVQEFREAVQSLPEGKAVSV--RVVRQGRALY 469


>gi|209884421|ref|YP_002288278.1| protease Do subfamily [Oligotropha carboxidovorans OM5]
 gi|209872617|gb|ACI92413.1| protease Do subfamily [Oligotropha carboxidovorans OM5]
          Length = 503

 Score =  212 bits (539), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 149/509 (29%), Positives = 234/509 (45%), Gaps = 36/509 (7%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE 65
            +    +  +A+   +F  T              +     +V  ++V++      K    
Sbjct: 5   FVRFGRLLPLAVAGGLFVLTAGTPVPASARGPEGIADTAEKVIDAVVNISTSQTLKNRDR 64

Query: 66  QMFNAY-------GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
               A        G   LP D P    F + F      + P      +    GSGF I  
Sbjct: 65  DEDAAPKKNGREKGDPRLPPDSPFNELFDEFFKNRRGDKSPQQH---KVNSLGSGFIIDT 121

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF-IPVEFEDA 177
           DG+++T+NH++ D    +VIL+D +++ A+L+G D   DLAVLK Q   K    V+F D+
Sbjct: 122 DGFVVTNNHVIADADEINVILNDGSKIKAELIGRDKKSDLAVLKFQPPEKKLTAVKFGDS 181

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFN 236
           + +R+GE V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP FN
Sbjct: 182 DKLRLGEWVVAIGNPFSLGGTVTAGIVSARNRDINSGPYDNYIQTDAAINRGNSGGPLFN 241

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+GVN  I++     +G+G  +P + +   +  L     V  GW G+  Q +T E+
Sbjct: 242 LEGEVVGVNTAIISPSGGSIGIGFAVPSNTVVGIVNQLRQYKEVRRGWLGVRIQQVTDEI 301

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  LG++  +G+L+  V  + PA  AG++ GDVI   DG+ I+  +D    +A     + 
Sbjct: 302 ADSLGIKPPRGALVAGVDDKGPAKPAGIEAGDVIISFDGKAIREMKDLPRAVADAPVGKN 361

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----------LGMVLQDINDGNK 406
           V +   ++G + +  V LG     +      +   E           LG+ L  +    +
Sbjct: 362 VDVVFIRKGKEETRKVTLGRLDDGEKLAEASLKVPEPEVEKTVTQKALGLDLASLGKDLR 421

Query: 407 KLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
              +I       V +  +R  +   + +  G  IV V    V+   DV+  I K K+  +
Sbjct: 422 TRYKIKEKVKGVVIVGVDRNSDAAERRLSAGDVIVEVAQEAVNSPADVKTRIDKLKKDGK 481

Query: 460 DSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            SVLLQ+          +   RFV+L +D
Sbjct: 482 KSVLLQVSNG-------EGELRFVALSVD 503


>gi|26988163|ref|NP_743588.1| protease Do [Pseudomonas putida KT2440]
 gi|24982897|gb|AAN67052.1|AE016334_1 alginate biosynthesis negative regulator, serine protease AlgY
           [Pseudomonas putida KT2440]
          Length = 492

 Score =  212 bits (539), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 134/494 (27%), Positives = 225/494 (45%), Gaps = 28/494 (5%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           +S+  + +  +          V+ A+   +  D   ++ + SP++V++  + K       
Sbjct: 16  MSIPRLKSYLMMFAAVLMLGQVVAAQAEEALPDFTTLVEQASPAVVNISTKQKLPDRRIA 75

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILT 124
                    LP        FR+ F +    +   P      E    GSGF I+ DGY+LT
Sbjct: 76  ANQMPDLEGLPP------MFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYVLT 129

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH+V D     V LSD +EL AKLVGTD   D+A+LKV        V+  D+  ++VGE
Sbjct: 130 NNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKVDGKNL-PTVKLGDSEKLKVGE 188

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  G V+G
Sbjct: 189 WVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGEVVG 248

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL 
Sbjct: 249 INSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFGLD 308

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+  V++  PA K G++VGDVI  ++G+ I    D    +      E+ K+ + +
Sbjct: 309 KPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGEKAKLEIIR 368

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---RIVALN 415
            G + ++ + +G+ P    D+              LG+ + D+    KK +     V + 
Sbjct: 369 NGKRQNLDISVGALPDDDVDIGAGTEGSAERSSNRLGVSVADLTAEQKKSLELKGGVVIK 428

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
             ++      G++ G  I  +N   +   K+   +  +  + +  S+ +           
Sbjct: 429 EVQDGPAAMIGLRPGDVISHLNNQAIGSAKEFTEIAKELPKNRSVSMRVL---------- 478

Query: 476 NDNMSRFVSLKIDK 489
               + F++ K+ +
Sbjct: 479 RQGRASFITFKLAE 492


>gi|258404964|ref|YP_003197706.1| protease Do [Desulfohalobium retbaense DSM 5692]
 gi|257797191|gb|ACV68128.1| protease Do [Desulfohalobium retbaense DSM 5692]
          Length = 476

 Score =  212 bits (539), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 139/498 (27%), Positives = 236/498 (47%), Gaps = 40/498 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
            ++  ++   +C +AL  +  S+              +   +      ++V++       
Sbjct: 1   MRK--IASTIVCGLALLVLSGSTALA--------QLPEFTELAKSAGKAVVNISTVKTVD 50

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
            S  Q    +         P +++F + F +FF    P      ++   GSGF ++ DGY
Sbjct: 51  QS--QGVEEFFNRFHRRGGPFEDFFDQ-FERFFG---PQQMPKRQQRSLGSGFIMSRDGY 104

Query: 122 ILTSNHIVEDGASFSVILSDDTE-LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           I+T+NH+VE     +V L        A +VG D   DLA+LK++ DR+   +EF D+  +
Sbjct: 105 IVTNNHVVEQADKITVNLQGGETSYQADIVGRDPETDLALLKIEVDRELPVLEFGDSGEM 164

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
            +G+ V  IGNPF L  +V+AGI+SA  R I   P   F Q DA IN GNSGGP  N  G
Sbjct: 165 EIGDWVMAIGNPFGLDHSVTAGIISAKGRVIGAGPYDDFLQTDASINPGNSGGPLLNTDG 224

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIG+N  I+ S     G+G  IP  + K+ I  L    +V  GW G+  Q++ + +A  
Sbjct: 225 KVIGINTAIIAS---GQGIGFAIPSDMAKQVIAQLKKYQKVKRGWLGVTIQDVDENMAKA 281

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           LGL   KG+LI  V    PAD+AG+K GDV+  L+G  ++       +I    P  +  +
Sbjct: 282 LGLDAPKGALIAGVRAGDPADEAGLKAGDVVVSLNGEPVEDADGLTRRIGRMEPDTKANM 341

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE----LLGMVLQDINDGNKKLVR----- 410
           ++ ++G    +AVVLG   TA+ +   E  D E     LG+V++ + D   + +      
Sbjct: 342 TIWRQGKVKKIAVVLGERDTAQEEARAEQPDSEQTSGRLGIVVRPVRDEEARALGMDEAR 401

Query: 411 -IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            ++  +  +       G++ G  I++ N  EV  ++ + +++ +    ++ +VL  +   
Sbjct: 402 GLLIQDVEQASLAAEAGLRPGDVILAANGQEVETVRGLSQILNE-DAAEKGAVLFLVNR- 459

Query: 470 PDMQSGNDNMSRFVSLKI 487
                     + FVS+ +
Sbjct: 460 -------KGQNLFVSIPL 470


>gi|167835612|ref|ZP_02462495.1| serine protease [Burkholderia thailandensis MSMB43]
          Length = 484

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 135/495 (27%), Positives = 229/495 (46%), Gaps = 34/495 (6%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSS--------------VDLPPVIARVSPSIVSVMVEP 58
              AL+    + T       + P+                D   ++    P++V++  + 
Sbjct: 3   VAAALSAGYVAGTRHAEPQVITPAVAALMPAEAAAKTGIPDFSGLVETYGPAVVNISAKH 62

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVERLMFGSGFFI 116
             + + ++          P D P   +FR  + +     G      D       GSGF I
Sbjct: 63  VVQRAAQRRAAPQQLPIDP-DDPFYQFFRHFYGQIPGMGGGRQPQPDDQPSTSLGSGFII 121

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           + DGYILT+ H+++     +V L+D  E  AK++GTD   D+AVLK+ +      V+  D
Sbjct: 122 SADGYILTNAHVIDGANVVTVKLTDKREYKAKVIGTDKQSDVAVLKIDASGL-PTVKIGD 180

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCF 235
               +VG+ V  IG+P+    TV++GI+SA  R +PD   T F Q D P+N GNSGGP F
Sbjct: 181 PAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPFIQTDVPVNPGNSGGPLF 240

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N+MI +      G+   IP++   K    L+  G V  G  G+  Q L Q 
Sbjct: 241 NLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKTGHVSRGRLGVAVQGLNQT 300

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA   GL+   G+L+++V  + PA KAG++ GDVI  +DG  ++       QIA   P  
Sbjct: 301 LASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILGVDGVPVQDSTMLPAQIAGMKPGT 360

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE-VGDKELLGMVLQDINDGNKKLVRIVAL 414
           +  + + ++ SK +V+V L S    +    ++   ++  LG+ ++ ++   +    +   
Sbjct: 361 KADLQIWRDRSKKTVSVTLASLTDDQAKAGVDGPVEQGRLGVAVRPLSPRERNGSSLTHG 420

Query: 415 NPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
              ++      + GIQ G  I++VN   V+  + +   + +A     +S+ L I+ D   
Sbjct: 421 LVVQQSTGPAASAGIQPGDVILAVNGRPVTSAEQLRDAVKRA----GNSLALLIQRD--- 473

Query: 473 QSGNDNMSRFVSLKI 487
                +   FV + +
Sbjct: 474 -----DAQIFVPVDL 483


>gi|167568966|ref|ZP_02361840.1| serine protease [Burkholderia oklahomensis C6786]
          Length = 482

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 137/494 (27%), Positives = 228/494 (46%), Gaps = 34/494 (6%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSS--------------VDLPPVIARVSPSIVSVMVEP 58
              AL+    + T       + P+                D   ++    P++V++  + 
Sbjct: 3   VAAALSAGYVAGTRHAEPQIIAPAVAALMPAEAAAKTGIPDFSGLVETYGPAVVNISAKH 62

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK-FFSGEEPILSDTVERLMFGSGFFIT 117
             + + ++   A     +  D P   +FR  + +    G      D       GSGF I+
Sbjct: 63  VVQRTAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMGGGQQQPDDQPSTSLGSGFIIS 120

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGYILT+ H+++     +V L+D  E  AK+VG D   D+AVLK+ +      V   D 
Sbjct: 121 PDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQSDVAVLKIDASSL-PTVRIGDP 179

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFN 236
              +VG+ V  IG+P+    TV++GI+SA  R +PD   T F Q D P+N GNSGGP FN
Sbjct: 180 AQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPFIQTDVPVNPGNSGGPLFN 239

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G VIG+N+MI +      G+   IP++   K    L+  G V  G  G+  Q L Q L
Sbjct: 240 LNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKTGHVSRGRLGVAVQGLNQTL 299

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL+   G+L+++V  + PA KAG++ GDVI  +DG  ++       QIAS  P  +
Sbjct: 300 ASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILSVDGVPVQDSTTLPAQIASMKPGTK 359

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKELLGMVLQDINDGNKKLVRIVALN 415
             + + ++ SK +V+V L S    +    + E  ++  LG+ ++ ++   +    +    
Sbjct: 360 ADLQVWRDKSKKTVSVTLASLTDDQAKAGVDEPVEQGRLGVAVRPLSPRERNGSSLTHGL 419

Query: 416 PNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
             ++        GIQ G  I++VN   V+  + +   + +A     +S+ L I+ D    
Sbjct: 420 VVQQSTGPAANAGIQPGDVILAVNGRPVTSAEQLRDAVKRA----GNSLALLIQRD---- 471

Query: 474 SGNDNMSRFVSLKI 487
               +   FV + +
Sbjct: 472 ----DAQIFVPVDL 481


>gi|39937630|ref|NP_949906.1| serine protease [Rhodopseudomonas palustris CGA009]
 gi|39651489|emb|CAE30012.1| putative serine protease htrA/degQ/degS family [Rhodopseudomonas
           palustris CGA009]
          Length = 520

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 161/512 (31%), Positives = 248/512 (48%), Gaps = 36/512 (7%)

Query: 4   RQILSVKSICTVA----LTCVIFSSTYLVLEAKLP-------------PSSVDLPPVIAR 46
           R++L  + +  +A    L+ V+       L  ++P             P+      ++ +
Sbjct: 18  RKVLRPRRLSLLASAAGLSMVVALGGAGFLTREMPSLTSSAYAAENGKPAPAGFGDLVDK 77

Query: 47  VSPSIVSVMVEPKKKVSVEQMFNAYGFG---NLPEDHPLKNYFRKDFHKFFSGEEPILSD 103
           V P+++SV V+         +    G G    +P        F + F   F G E +   
Sbjct: 78  VKPAVISVRVKIDDDRQTTPLVRDDGDGDQMQMPRGLAPFQQFERQFG--FRGPEGMPKR 135

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
                  GSGFFIT DGY +T+NH+V+   S  V   D T   AK+VGTD   DLA++KV
Sbjct: 136 HQMITGEGSGFFITADGYAVTNNHVVDHAKSVQVTTDDGTIYTAKVVGTDDKTDLALIKV 195

Query: 164 QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQID 222
                F  V F D+   RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + QID
Sbjct: 196 DGKTDFPHVNFADS-PARVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYVQID 254

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
           APIN+GNSGGP F+  G+VIGVN  I +     +G+G  IP +  K  +  L  KG V  
Sbjct: 255 APINKGNSGGPAFDTNGNVIGVNTAIYSPSGGSVGIGFDIPAATAKLVVSQLKDKGYVTR 314

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           GW G+  Q +T E+A  LG++  +G+L+      SPA KAG+K GDVI  +DG+ +K  +
Sbjct: 315 GWLGVQVQPVTAEIADSLGMKQARGALVDGPQDGSPAAKAGIKAGDVITAVDGKEVKDSR 374

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----ELLGMVL 398
                I++ +P   VK+ +   G   ++ + L   P     +    GD+      LG+ +
Sbjct: 375 ALARTISTLAPGSSVKLDVLHNGQSKTMDLTLAEMPGDHQKVADSSGDRDATRPYLGLRV 434

Query: 399 QDIND-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK 457
              ++        +V    + +     KG++ G  I+ V    V+   DV   + +A + 
Sbjct: 435 APASEVDGAGKNGVVVTGVDPDGPAADKGLRTGDVILDVGGKSVTNTGDVRNALTEASKD 494

Query: 458 KRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            + +VL+++K         D+ +RFV++ I K
Sbjct: 495 GKKTVLMRVK-------TADSAARFVAVPIAK 519


>gi|148549497|ref|YP_001269599.1| protease Do [Pseudomonas putida F1]
 gi|148513555|gb|ABQ80415.1| protease Do [Pseudomonas putida F1]
          Length = 477

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 134/494 (27%), Positives = 225/494 (45%), Gaps = 28/494 (5%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           +S+  + +  +          VL A+   +  D   ++ + SP++V++  + K       
Sbjct: 1   MSIPRLKSYLMMFAAVLMLGQVLTAQAEEALPDFTTLVEQASPAVVNISTKQKLPDRRIA 60

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILT 124
                    LP        FR+ F +    +   P      E    GSGF I+ DGY+LT
Sbjct: 61  AGQMPDLEGLPP------MFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYVLT 114

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH+V D     V LSD +EL AKLVGTD   D+A+LKV        V+  D+  ++VGE
Sbjct: 115 NNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKVDGKNL-PTVKLGDSEKLKVGE 173

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  G V+G
Sbjct: 174 WVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGEVVG 233

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL 
Sbjct: 234 INSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFGLD 293

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+  V++  PA K G++VGDVI  ++G+ I    D    +      E+ K+ + +
Sbjct: 294 KPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGEKAKLEIIR 353

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---RIVALN 415
            G + ++ + +G+ P    ++              LG+ + D+    KK +     V + 
Sbjct: 354 NGKRQNLDISVGALPDDDVEIGAGTEGGAERSSNRLGVSVADLTAEQKKSLELKGGVVIK 413

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
             ++      G++ G  I  +N   +   K+   +  +  + +  S+ +           
Sbjct: 414 EVQDGPAAMIGLRPGDVISHLNNQAIGSAKEFTEIAKELPKNRSVSMRVL---------- 463

Query: 476 NDNMSRFVSLKIDK 489
               + F++ K+ +
Sbjct: 464 RQGRASFITFKLAE 477


>gi|319784553|ref|YP_004144029.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170441|gb|ADV13979.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 517

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 168/502 (33%), Positives = 262/502 (52%), Gaps = 37/502 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA- 70
           I   ALT    S           P       V+ RVSP++VSV V+ K   + +   +  
Sbjct: 28  IGVGALTSGT-SPVLADAVRVEAPQVPGFADVVERVSPAVVSVKVKAKISPAADDGSDPS 86

Query: 71  ---YGFGNLPEDHPLKNYFRKDFH----------KFFSGEEPILSDTVERLMFGSGFFIT 117
               G  NLP +  L+ +F++                       +D    +  GSGFFI+
Sbjct: 87  DDQDGMNNLPNNPQLRRFFKEFRGFGDQDGQGGGNRRFSHRDRNNDQPRPVAQGSGFFIS 146

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
           DDGY++T+NH+V +G++F+V+++D  EL AKL+GTD   DLAVLKV    KF  V+F D 
Sbjct: 147 DDGYLVTNNHVVSEGSAFTVVMNDGKELDAKLIGTDPRTDLAVLKVDGVGKFTYVDFADD 206

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFN 236
           + +RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   F QIDA +N+GNSGGP FN
Sbjct: 207 SKVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGPYDDFIQIDASVNRGNSGGPTFN 266

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N  I +     +G+   IP S  K+ +  L+  G V  GW G+  Q +T ++
Sbjct: 267 LNGQVVGINTAIFSPSGGSVGIAFDIPASTAKQVVQDLMKSGSVQRGWLGVEIQPVTSDI 326

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  LGL+   G+L+++   + P  KAG+  GDVI  ++G+ + S ++    I + SP + 
Sbjct: 327 AESLGLKSNNGALVSSAQDDGPGKKAGITAGDVITQVNGKDVASPKELARLIGAYSPGKS 386

Query: 357 VKISLCKEGSKHSVAVVLGSSPTA---------KNDMHLEVGDKELLGMVLQDINDGNKK 407
           V +++ ++G   +V V LG  P++         +     +      LG+ +      ++ 
Sbjct: 387 VDVTVWRDGKSQTVKVDLGKLPSSDKQASVDQSQPAAPAKPDTLADLGLTVT----KSEN 442

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              +V  + + + +   +GIQ G  I SVN+ EV+   DV + + +A +  R +VL+QI 
Sbjct: 443 GKGLVVTDVDPDSDAADRGIQPGDVITSVNSTEVNGTDDVTKAMTEAVKSGRKAVLMQIT 502

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
            D        + +RFV+L + K
Sbjct: 503 RD--------DTNRFVALPVAK 516


>gi|104783266|ref|YP_609764.1| serine protease MucD [Pseudomonas entomophila L48]
 gi|95112253|emb|CAK16980.1| serine protease MucD [Pseudomonas entomophila L48]
          Length = 479

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 140/496 (28%), Positives = 230/496 (46%), Gaps = 30/496 (6%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           +S+  + T             VL A+   S  D   ++ + SP++V++  + K       
Sbjct: 1   MSIPRLKTYLSMFAAVLMLGQVLSAQAEESLPDFTTLVEQASPAVVNISTKQKLPDRRIA 60

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILT 124
                    LP        FR+ F +    +   P      E    GSGF I+DDGY+LT
Sbjct: 61  AGQMPDLEGLPP------MFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISDDGYVLT 114

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH+V D     V LSD +EL AKLVGTD   D+A+LKV+       V+  D+  ++VGE
Sbjct: 115 NNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKVEGKNL-PTVKLGDSEKLKVGE 173

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  G V+G
Sbjct: 174 WVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGEVVG 233

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL 
Sbjct: 234 INSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFGLD 293

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+  V++  PA K G++VGDVI  ++G+ I    D    + S    E+ K+ + +
Sbjct: 294 KPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIIMSADLPHLVGSLKDGEKAKLEIIR 353

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVG-------DKELLGMVLQDINDGNKKLV---RIVA 413
            G + ++ + +G+ P    D+   +G           LG+ + D++   KK +     V 
Sbjct: 354 NGKRQNLDITIGALPEDDADIGAGLGADGSAERSSNRLGVSVADLSAEQKKTLELKGGVV 413

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           +   ++      G++ G  I  +N   ++  K    +  +  + +  S+ +         
Sbjct: 414 IKEVQDGPAALIGLRPGDVISHLNNQAIASAKQFTEIAKELPKNRSVSMRVL-------- 465

Query: 474 SGNDNMSRFVSLKIDK 489
                 + F++ K+ +
Sbjct: 466 --RQGRASFITFKLAE 479


>gi|227821359|ref|YP_002825329.1| serine protease do-like precursor [Sinorhizobium fredii NGR234]
 gi|227340358|gb|ACP24576.1| serine protease do-like precursor [Sinorhizobium fredii NGR234]
          Length = 521

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 181/514 (35%), Positives = 273/514 (53%), Gaps = 44/514 (8%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKL---PPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           +V  +  V LT  + +         +    PS      V+  VSP++VSV V+ +++ S 
Sbjct: 19  TVAGLAAVMLTTGLPAQITQSFAEAVKVQAPSVPSFANVVDAVSPAVVSVRVQAREQASN 78

Query: 65  EQM-----FNAYGFGNLPEDHPLKNYFRKDFHKF----------FSGEEPILSDTVERLM 109
           ++      F   GF +LP+DHPLK +FR+                    P     +    
Sbjct: 79  DESNFTFDFGGRGFEDLPDDHPLKRFFREFGGPDSRDGDRADRWRDRRGPRGEGRLRPRA 138

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRK 168
            GSGFFIT+DGY++T+NH+V DG++F+VI++D TEL AKLVG D+  DLAVLKV S +RK
Sbjct: 139 QGSGFFITEDGYLVTNNHVVSDGSAFTVIMNDGTELDAKLVGKDSRTDLAVLKVDSANRK 198

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQ 227
           F  V F D  N+RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + Q+DA +N+
Sbjct: 199 FTHVSFADDKNVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYLQVDAAVNR 258

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP FN  G V+G+N  I +    ++G+   IP S+ K  + SLI  G V  GW G+
Sbjct: 259 GNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVVDSLIKDGSVSRGWLGV 318

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T+++A  LGL    G+L+      SP +KAG+K GD++  L+G  +K  +D   +
Sbjct: 319 QIQPVTKDIAESLGLSEASGALVVEPQAGSPGEKAGIKKGDIVTALNGEPVKDPRDLARR 378

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE------------LLG 395
           +A+  P     ++L ++G   SV + +G+ P        +  D++             LG
Sbjct: 379 VATMRPGATADVTLWRDGKSQSVKLEIGTLPEEAKATTPDTSDEQTDQGQAGEEALADLG 438

Query: 396 MVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
           + +    DG      +   + + + +   +G+++G  IVSVN  EV    D+ ++I  AK
Sbjct: 439 LAVTPSEDGA----GVTIASVDPDSDAADRGLKEGEKIVSVNNQEVKSADDILKVINNAK 494

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +  R   L QI+ D          SRFV+L I +
Sbjct: 495 KDGRSKALFQIQAD--------EGSRFVALPIAQ 520


>gi|167561732|ref|ZP_02354648.1| serine protease [Burkholderia oklahomensis EO147]
          Length = 482

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 137/494 (27%), Positives = 228/494 (46%), Gaps = 34/494 (6%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSS--------------VDLPPVIARVSPSIVSVMVEP 58
              AL+    + T       + P+                D   ++    P++V++  + 
Sbjct: 3   VAAALSAGYVAGTRHAEPQIIAPAVAALMPAEAAAKTGIPDFSGLVETYGPAVVNISAKH 62

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK-FFSGEEPILSDTVERLMFGSGFFIT 117
             + + ++   A     +  D P   +FR  + +    G      D       GSGF I+
Sbjct: 63  VVQRTAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMGGGQQQPDDQPSTSLGSGFIIS 120

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGYILT+ H+++     +V L+D  E  AK+VG D   D+AVLK+ +      V   D 
Sbjct: 121 PDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQSDVAVLKIDASSL-PTVRIGDP 179

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFN 236
              +VG+ V  IG+P+    TV++GI+SA  R +PD   T F Q D P+N GNSGGP FN
Sbjct: 180 AQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPFIQTDVPVNPGNSGGPLFN 239

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G VIG+N+MI +      G+   IP++   K    L+  G V  G  G+  Q L Q L
Sbjct: 240 LNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKTGHVSRGRLGVAVQGLNQTL 299

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL+   G+L+++V  + PA KAG++ GDVI  +DG  ++       QIAS  P  +
Sbjct: 300 ASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILSVDGVPVQDSTTLPAQIASMKPGTK 359

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKELLGMVLQDINDGNKKLVRIVALN 415
             + + ++ SK +V+V L S    +    + E  ++  LG+ ++ ++   +    +    
Sbjct: 360 ADLQVWRDKSKKTVSVTLASLTDDQAKAGVDEPVEQGRLGVAVRPLSPRERSGSSLTHGL 419

Query: 416 PNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
             ++        GIQ G  I++VN   V+  + +   + +A     +S+ L I+ D    
Sbjct: 420 VVQQSTGPAANAGIQPGDVILAVNGRPVTSAEQLRDAVKRA----GNSLALLIQRD---- 471

Query: 474 SGNDNMSRFVSLKI 487
               +   FV + +
Sbjct: 472 ----DAQIFVPVDL 481


>gi|85715371|ref|ZP_01046353.1| peptidase S1C [Nitrobacter sp. Nb-311A]
 gi|85697792|gb|EAQ35667.1| peptidase S1C [Nitrobacter sp. Nb-311A]
          Length = 516

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 144/511 (28%), Positives = 238/511 (46%), Gaps = 38/511 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTY-------------LVLEAKLPPSSVDLPPVIARVSP 49
           ++  L       V +    FS +              +  +       +    ++ RV P
Sbjct: 19  RKLALMASVFAGVGMALYGFSPSADKAELFTSPAYAQVNADVSKVAQPIGFADIVERVKP 78

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF-SGEEPILSDTVERL 108
           S+  + V+ + K   E     + F       P++ +FR+                     
Sbjct: 79  SV--ISVKIRMKDKAEADGEEWSFQ---PGSPMERFFRRFGGPDGLPPGMRGRRGHGFVT 133

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGFFI+ DGY +T+NH+V+      V   D     AK++GTD   D+A++KV+    
Sbjct: 134 GQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYTAKVIGTDPRTDIALIKVEGGSN 193

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQ 227
           F   +  D   +R+G+ V  +GNPF L G+V+AGIVSA  RDI   P   F QIDAP+N+
Sbjct: 194 FAFAKLSDD-KVRIGDWVLAVGNPFGLGGSVTAGIVSASGRDIGTGPYDDFLQIDAPVNK 252

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP FN  G V+GVN  I +     +G+   IP + +K  +  L  KG V  GW G+
Sbjct: 253 GNSGGPAFNMKGDVVGVNTAIYSPSGGSVGIAFSIPANTVKSVVAQLKDKGSVSRGWIGV 312

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T ++A  LGL+  +G+L+      SPA KAG++ GDVI  ++G  +K  ++    
Sbjct: 313 QIQPVTSDIADSLGLKKAEGALVAEPQSNSPAAKAGIQSGDVITAVNGDPVKDARELART 372

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK--------ELLGMVLQ 399
           I S +P   +K+++ ++G    V + LG+ P          GD+          LG+ + 
Sbjct: 373 IGSFAPGTSIKLNILRKGKDKVVNLTLGTLPNTVEARADHHGDRGSLHDSDIPRLGLTVA 432

Query: 400 DI-NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
              +        +V ++ +       +G ++G  I+ V    VS   DV + I  A+   
Sbjct: 433 PAGSVAGAGAEGVVVIDVDPRSPAADRGFKEGDVILEVAGKSVSNSADVRQAITSARADN 492

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++SVL++++          + +RF+++ I K
Sbjct: 493 KNSVLMRVR--------TGSTARFIAMPIAK 515


>gi|188592008|ref|YP_001796606.1| periplasmic protease [Cupriavidus taiwanensis LMG 19424]
 gi|170938382|emb|CAP63369.1| PERIPLASMIC PROTEASE; contains two PDZ domain [Cupriavidus
           taiwanensis LMG 19424]
          Length = 511

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 140/508 (27%), Positives = 234/508 (46%), Gaps = 43/508 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPP------------------SSVDLPPV 43
             RQ ++  ++   AL  +     YL  E   P                     +D   +
Sbjct: 24  MMRQTIARTAVGIAALAALGGGYAYLQREVITPGYAAPAPVVAAAQPAAAVARPMDFSGI 83

Query: 44  IARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSD 103
           +A+  P++V++ V  + + +  QM        +  D PL  +F++   +F   +      
Sbjct: 84  VAQYGPAVVNISVTARAQRTAVQMP-----PGIDPDDPLFQFFKRFGPQFQGPQGGAQQL 138

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
                  GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++GTD   D+AV+++
Sbjct: 139 VR---GQGSGFIVSPDGLILTNAHVVDGAQEVTVKLTDRREFKAKVLGTDPQTDVAVIRI 195

Query: 164 QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQID 222
              R    V   D + +RVGE V  IG+P+    TV+AGIVSA  R +PD     F Q D
Sbjct: 196 -DARDLPTVRLGDPSQVRVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYVPFIQTD 254

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
             +N GNSGGP FN  G V+G+N+ I +    + G+   IP+ +  K    L++ G+V  
Sbjct: 255 VAVNPGNSGGPLFNQRGEVVGINSQIYSQTGGYQGLSFAIPIDVATKVQQQLVAHGKVTR 314

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           G  GI  Q + Q LA   GL    G+L+ +V  +SPA +AG+K GDVI  L+  +I    
Sbjct: 315 GRLGISVQEVNQALAQSFGLPKPTGALVNSVEPDSPAARAGLKPGDVIVQLNNDVIDHSG 374

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-SSPTAKNDMHLEVGDKELLGMVLQDI 401
           D    +A   P  Q  + + ++G   +++V +G +   A             LG+ ++ +
Sbjct: 375 DLPEHVADIKPGTQSSLKIIRKGQPMTLSVTVGSARDQAVAQKAGGKEANGRLGLAVRPL 434

Query: 402 NDGNKKLVRIVALNPNRE--REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
           +   K+   I       +        GIQ G  I+S+N   ++ +  +  L+GK+ ++  
Sbjct: 435 SPAEKRESGIEGGLVVEDVTGPAARVGIQPGDVILSLNGTPIASVDQLRTLVGKSGKQ-- 492

Query: 460 DSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             V L ++ D        +   F+ L +
Sbjct: 493 --VALLVQRD--------DARIFIPLDL 510


>gi|296448435|ref|ZP_06890319.1| protease Do [Methylosinus trichosporium OB3b]
 gi|296254059|gb|EFH01202.1| protease Do [Methylosinus trichosporium OB3b]
          Length = 507

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 155/483 (32%), Positives = 232/483 (48%), Gaps = 27/483 (5%)

Query: 17  LTCVIFSSTYLVLEAKLPPS--SVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           L     +    V     P          ++ RV P++V++  +  +     +        
Sbjct: 36  LAGFAMAEAPPVESQTAPAGLGPKSFADLVERVKPAVVAIKTKAIEVGGGPEEGVPGMPP 95

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
            L  D PL  +FR        G              GSGF IT DGY++T+NH+VE    
Sbjct: 96  ELSPDDPLYRFFRHF------GPPQGRRQKHVTQAQGSGFVITSDGYVVTNNHVVEHATQ 149

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V   D   LPAK+VGTD   DLA+LK+  D   +      + + R+G+ V  +GNPF 
Sbjct: 150 VEVSFDDGRTLPAKIVGTDKRTDLALLKIS-DGNKLAHVDWASTSPRIGDWVIAVGNPFG 208

Query: 195 LRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
           L GTV+AGIVSA  RDI   P   F QIDAP+N+GNSGGP F+  G VIGVN  I +   
Sbjct: 209 LGGTVTAGIVSARGRDIGAGPYDDFLQIDAPVNRGNSGGPSFDERGQVIGVNTAIYSPSG 268

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             +G+G  IP  + K  I +L  KG+V  GW G+  Q +TQE+A  LGL+ TKG+L+   
Sbjct: 269 GSIGIGFAIPAEVAKDVIAALKDKGQVARGWIGVQIQPVTQEIAESLGLKSTKGALVAQP 328

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
            +  PAD AG+K GDVI  +DG+ I + ++   +IA+  P +   I+  + GS+ +  + 
Sbjct: 329 QRGGPADAAGLKSGDVITAVDGQKIDNPRELARRIATLGPGKTADITYLRGGSEKTARLK 388

Query: 374 LGSSPTAKNDMHLEVGDK-------ELLGMVLQDINDGNKKLVRI--VALNPNREREVEA 424
           LG  P+ K        D           G+ +   ++   +      + +  +       
Sbjct: 389 LGKLPSEKEAATETEDDGVEQGSALAAYGIEVAPASELRGRGGGEGLIVVGIDPNGSAAQ 448

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVS 484
           KG+Q+G  I+  N   +    D+   I   K++ R SVLL++K        +   +RFV+
Sbjct: 449 KGLQQGDVILEANGRSMKRPGDLSDAIDAVKKEGRKSVLLRVK--------SQGGTRFVA 500

Query: 485 LKI 487
           L +
Sbjct: 501 LSV 503


>gi|289209113|ref|YP_003461179.1| protease Do [Thioalkalivibrio sp. K90mix]
 gi|288944744|gb|ADC72443.1| protease Do [Thioalkalivibrio sp. K90mix]
          Length = 473

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 133/486 (27%), Positives = 221/486 (45%), Gaps = 34/486 (6%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
             L  ++F+ +       LP    D  P+    SP++V++          E+     G  
Sbjct: 8   ALLGLILFAFSLPASACMLP----DFVPLAEEHSPAVVNISTTR------EREGGQTGGH 57

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
              E  P ++ F + F     GE        ER   GSGF  T+DGYI+T+NH+VE  + 
Sbjct: 58  PDFEGSPFEDLFERFFGSPPGGEGGQG-RMPERSSLGSGFIYTEDGYIITANHVVEGASE 116

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V LSD     A++VG D   D+A+LK+ +D     +E   +++++VGE V  IG+PF 
Sbjct: 117 VVVHLSDRRVFDAEVVGKDPQSDVALLKIDADDL-PTLELGSSDDLKVGEWVLAIGSPFG 175

Query: 195 LRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
              +V+AGIVSA  R++P      F Q D  IN GNSGGP  N  G V+G+NA I +   
Sbjct: 176 FDHSVTAGIVSAKGRNLPTENYVPFIQTDVAINPGNSGGPLLNLDGKVVGINAQIYSRTG 235

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             MG+   +P+ +++  +  L   G V  GW G++ Q +T++LA   G+    G+L+  V
Sbjct: 236 GFMGLSFAVPIEMVEDVVKQLREHGEVTRGWLGVLIQEVTRDLAESFGMDKPSGALVARV 295

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
             +SPA+KAG + GDVI   +G  + +       +       + ++ + +     ++ V 
Sbjct: 296 QSDSPAEKAGFETGDVILKFNGIEVPNSSALPPIVGRTPVGTEAEVEIRRGEETRTLMVE 355

Query: 374 LGSSPTA--------KNDMHLEVGDKELLGMVLQDINDGNKKLVRI---VALNPNREREV 422
           +   P          + +       + LLGM L+ ++    + + +   + +        
Sbjct: 356 IERLPDDIAAERGGPQPEQGERAEPQSLLGMHLEPLDAAQAEELGLDGGLVVTEVTGNPA 415

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
            + GI+ G  IV    H V  +  +E  I  A   +   VL+            D    F
Sbjct: 416 RSSGIRPGDVIVQFGRHSVDSLDALEEQIEAAGSGRTVPVLI----------HRDGNPTF 465

Query: 483 VSLKID 488
           ++L+I 
Sbjct: 466 IALRIP 471


>gi|170720256|ref|YP_001747944.1| protease Do [Pseudomonas putida W619]
 gi|169758259|gb|ACA71575.1| protease Do [Pseudomonas putida W619]
          Length = 479

 Score =  211 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 139/502 (27%), Positives = 228/502 (45%), Gaps = 36/502 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L          VL A+   +  D   ++ + SP++V++  + K 
Sbjct: 1   MSIPRLKSYLSMFAAVLMLG------QVLSAQAEEALPDFTTLVEQASPAVVNISTKQKL 54

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITD 118
                          LP        FR+ F +    +   P      E    GSGF I+ 
Sbjct: 55  PDRRIAAGQMPDLEGLPP------MFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISS 108

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DGY+LT+NH+V D     V LSD +EL AKLVGTD   D+A+LKV        V+  D+ 
Sbjct: 109 DGYVLTNNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKVDGKNL-PTVKLGDSE 167

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNA 237
            ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN 
Sbjct: 168 KLKVGEWVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNM 227

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+G+N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA
Sbjct: 228 NGEVVGINSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLA 287

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
              GL    G+L+  V+++ PA K+G++VGDVI  ++G+ I    D    + +     + 
Sbjct: 288 ESFGLDKPAGALVAQVLEDGPAAKSGLQVGDVILSMNGQPIVMSADLPHLVGTLKAGAKA 347

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-------DKELLGMVLQDINDGNKKLV- 409
           K+ + + G + ++ V +G+ P    D+    G           LG+ + D+    KK + 
Sbjct: 348 KLEIIRNGKRQNLDVTIGAMPDDDADIGTGTGADGSAERSSNRLGVSVSDLTAEQKKSLE 407

Query: 410 --RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
               V +   ++      G++ G  I  +N   ++  K    +     + +  S+ +   
Sbjct: 408 LKGGVVIKEVQDGPAAMIGLRPGDVISHLNNQAIASAKQFTEIAKDLPKNRSVSMRVL-- 465

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
                       + F++ K+ +
Sbjct: 466 --------RQGRASFITFKLAE 479


>gi|209548367|ref|YP_002280284.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534123|gb|ACI54058.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 501

 Score =  211 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 146/492 (29%), Positives = 242/492 (49%), Gaps = 39/492 (7%)

Query: 16  ALTCVIFSSTYLVLEAKL---PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
            L   I ++  +   A       +S     ++    P++V++    K             
Sbjct: 24  CLPFTITAANAVASPADAGGILAASGSFASIVDADKPAVVTITTTMKATDVSADQ----- 78

Query: 73  FGNLPEDHPLKNYFRKDFHKFF---SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                +  P+   FR+ F         + P    + + +  GSGF I+ DG I+T+NH++
Sbjct: 79  -----QQSPMDEQFRQFFEDQGIPLPRQAPKNRSSQQTMALGSGFIISPDGVIVTNNHVI 133

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           ++     V L D TELPAKL+GTD   D+AV+K+++ +    + + D++ +++G+ +  I
Sbjct: 134 DNAVDIKVTLDDGTELPAKLIGTDPKSDVAVVKIEAGKPLQTIAWGDSDRLKLGDQILAI 193

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G+V+G+N  I
Sbjct: 194 GNPFGIGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDRSGNVVGINTAI 253

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     +GVG  IP    K  +  L   G +DHG+ G+  Q +T+++A  +GL  T G+
Sbjct: 254 YSPNGGSVGVGFAIPSDEAKAIVAKLQKDGSIDHGYLGVQIQPVTKDVADAVGLDKTGGA 313

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+ AV  ++PA  AG+K GD+I  + G  +K+ +D    +A  SP  +  + + ++G   
Sbjct: 314 LVAAVTADTPAAHAGVKPGDIITSVGGESVKTPKDLSRLVADLSPGAKKSLGIWRDGKTI 373

Query: 369 SVAVVLGSSPTAKNDMHLEVGD-------KELLGMVLQDINDGNKKLV-------RIVAL 414
            + V +G +   +     E  D       +  LG+ L D+    ++ +         V  
Sbjct: 374 DLNVTVGGNEDGQKQAAAESSDSKGESSGQPSLGIGLADLTPDVREQLTLPRAVSGAVVA 433

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           + + ++   A GIQ G  IVSVN   V   +DV+  I +A +  R SVLL ++ D     
Sbjct: 434 SVDPDKSAAAAGIQSGDVIVSVNDRPVHSTRDVKTAIAEAGKAGRKSVLLLVERDGGKT- 492

Query: 475 GNDNMSRFVSLK 486
                  FV++ 
Sbjct: 493 -------FVAVP 497


>gi|288962879|ref|YP_003453173.1| trypsin-like serine protease [Azospirillum sp. B510]
 gi|288915145|dbj|BAI76629.1| trypsin-like serine protease [Azospirillum sp. B510]
          Length = 543

 Score =  211 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 148/531 (27%), Positives = 238/531 (44%), Gaps = 55/531 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLE---------AKLPPSSVDLPPVIARVSPSIV 52
            +R  L   ++C +    V   +  +  +         A    +      +      ++V
Sbjct: 13  LRR--LPAVALCALLFGAVFSPAAPVAAQDAPAGPQPGASRTYAPPSFRDLARTQIDTVV 70

Query: 53  SVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------- 105
           ++                 G   +P   PL+ +FR   ++   G      +         
Sbjct: 71  NISSTQAPSAPAGAGRLPEGMD-IPPGSPLEEFFRGFRNRQRGGPGERPGERPGNGAGDG 129

Query: 106 ---------ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
                      +  GSGF I   G ++T+NH+V D A  +V L D T LPAKLVG DA  
Sbjct: 130 PGSGGPPVPPSMALGSGFIIDPSGLVVTNNHVVADAAEIAVTLHDGTRLPAKLVGADAPT 189

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG 216
           DLA+LKV+SDR      + D+ ++ VG+ V  IGNPF L G+V+AGI+SA  RDI   P 
Sbjct: 190 DLALLKVESDRPLAATHWGDSESVEVGDWVVAIGNPFGLGGSVTAGILSARARDIQQGPY 249

Query: 217 T-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             + Q DA IN+GNSGGP ++  G VIG+N  I +     +G+G  IP S+ K  +  L 
Sbjct: 250 DEYLQTDAAINRGNSGGPLYDVGGAVIGINTAIYSPTGGSVGIGFAIPSSLAKPIVDQLK 309

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
             G+V  GW G+  Q +T ++A  LG++GT G+L+T+V   SPA  AG++ GDVI   DG
Sbjct: 310 DGGKVRRGWLGVQVQRVTPDIAESLGVQGTGGALVTSVSPGSPAAAAGLRQGDVITAFDG 369

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND-----------M 384
             ++  +     +AS +    V ++L + G + SV V +G                    
Sbjct: 370 GPLEQMRQLPRLVASTAIGRTVPLTLLRAGKERSVQVTVGELRNEPQQLAMSGSSGAPRS 429

Query: 385 HLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVN 437
                    LG+ L  +  G ++          +V     R+     +G+  G  IV V 
Sbjct: 430 AQPEESASALGLKLAPLTPGLRESFSIGEDVNGLVVTEVERDSPAAERGLDLGDVIVEVG 489

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
              ++   D++  I +A+E+ R ++L+ +    ++        R+V L + 
Sbjct: 490 QEPLATPADLDSRIARAREQGRKTLLMLVSRGGEL--------RYVPLTLP 532


>gi|299133553|ref|ZP_07026747.1| protease Do [Afipia sp. 1NLS2]
 gi|298591389|gb|EFI51590.1| protease Do [Afipia sp. 1NLS2]
          Length = 525

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 149/516 (28%), Positives = 243/516 (47%), Gaps = 41/516 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLV------------LEAKLPPSSVDLPPVIARVSP 49
            ++  L    +  +       S+ Y               + +     V    ++ RV P
Sbjct: 22  MRKFALMASVVVGLGAAAYGLSTPYATDMFVGTAHAQVNKDVRQVQQPVGFADIVERVKP 81

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVER-- 107
           S++SV V  ++K + +   +       P   P++ +FR+          P          
Sbjct: 82  SVISVRVRIEEKQTADNNDDLP----FPPGSPMERFFRRFGGPDGFPGGPGGRRGRGNLV 137

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSGFFI+ DGY +T+NH+V+      V   D     AK++GTD   DLA++KV+   
Sbjct: 138 TGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDKRTDLALIKVEGGS 197

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPIN 226
            F   +       R+G+ V  +GNPF L GTV+AGIVSA  RDI + P   F QIDAP+N
Sbjct: 198 NFPFAKLS-DGEPRIGDWVLAVGNPFGLGGTVTAGIVSARGRDIGNGPYDDFIQIDAPVN 256

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
           +GNSGGP FN  G VIGVN  I +     +G+   IP + +K  +  L  KG V  GW G
Sbjct: 257 KGNSGGPAFNTEGEVIGVNTAIYSPSGGSVGIAFSIPSATVKNVVAQLKDKGSVSRGWIG 316

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q +T E+A  LGL+  +G+L+       PA KAG++ GDVI  ++ + +K  ++   
Sbjct: 317 VQIQPVTPEIADSLGLKKAEGALVAEPQTNGPAAKAGIESGDVINKVNDQPVKDARELAR 376

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN------------DMHLEVGDKELL 394
            I   +P   +K+ +  +GS+ ++ + LG  P AK+              +    D   L
Sbjct: 377 TIGGMAPGASIKLGVLHKGSEKTLTLTLGELPNAKSIKTGFNDNDNGLGRNGNGSDVPNL 436

Query: 395 GMVLQDI-NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           G+ +    +        +V  N N +     +G+++G  I+ V    V+   D+   +  
Sbjct: 437 GLTVAPARSVAGAGKEGVVVTNVNPDGASAERGLKEGDVILEVAGKSVATADDIRNELNT 496

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           A+  K++SVL++++        + + SRFV+L + K
Sbjct: 497 ARADKKNSVLIRVR--------SGDSSRFVALPVGK 524


>gi|70728830|ref|YP_258579.1| protease Do [Pseudomonas fluorescens Pf-5]
 gi|68343129|gb|AAY90735.1| S1C (protease Do) subfamily peptidase MucD [Pseudomonas fluorescens
           Pf-5]
          Length = 476

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 135/495 (27%), Positives = 229/495 (46%), Gaps = 30/495 (6%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
            I  +KS  T+  T ++         A+LP    D   ++ + SP++V++    K     
Sbjct: 2   SIPRLKSYFTILATVLVLGQAVSAQAAELP----DFTQLVEQASPAVVNISTTQKLPDRR 57

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDDGYIL 123
                      +P+   L    R+ F +       P      E    GSGF I+ DGYIL
Sbjct: 58  VSNS-----AQMPDLEGLPPMLREFFERGMPQPRSPRGDRQREAQSLGSGFIISADGYIL 112

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+NH++ D     V L+D +EL AKL+GTD   D+A+LK+        ++   + +++ G
Sbjct: 113 TNNHVIADADEILVRLADRSELKAKLIGTDPRSDVALLKIDGKDL-PVLKLGKSQDLKAG 171

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVI 242
           + V  IG+PF    TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN  G V+
Sbjct: 172 QWVVAIGSPFGFDHTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAGEVV 231

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N+ I T     MGV   IP+ +       L + G+V  GW G++ Q + ++LA   GL
Sbjct: 232 GINSQIYTRSGGFMGVSFAIPIDVAMDVSNQLKTGGKVSRGWLGVVIQEVNKDLAESFGL 291

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
               G+L+  +  + PA K G++VGDVI  L+G+ I    D    + +     +  + + 
Sbjct: 292 EKPAGALVAQIQDDGPAAKGGLQVGDVILSLNGQPIVMSADLPHLVGALKAGAKANLEVI 351

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVGD-----KELLGMVLQDINDGNKKLV---RIVAL 414
           ++G + +V + +G+ P    D+ +            LG+ + ++ND  KK       V +
Sbjct: 352 RDGKRKNVELTVGAIPEEDKDLSMLPKSGVERSSNRLGVAVVELNDEQKKAFDLKGGVVI 411

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
              ++      G+Q G  I  +N   ++  K+   +     + +  S+ +          
Sbjct: 412 KEVQDGPAALIGLQPGDVITHLNNQAITSAKEFTEIAKALPKNRSVSMRVL--------- 462

Query: 475 GNDNMSRFVSLKIDK 489
                + F++ K+ +
Sbjct: 463 -RQGRASFITFKLAE 476


>gi|167035370|ref|YP_001670601.1| protease Do [Pseudomonas putida GB-1]
 gi|166861858|gb|ABZ00266.1| protease Do [Pseudomonas putida GB-1]
          Length = 477

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 135/494 (27%), Positives = 225/494 (45%), Gaps = 28/494 (5%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           +S+  + +             VL A+   +  D   ++ + SP++V++  + K       
Sbjct: 1   MSIPRLKSYLTMFAAVLMLGQVLTAQAEEALPDFTSLVEQASPAVVNISTKQKLPDRRIA 60

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILT 124
                    LP        FR+ F +    +   P      E    GSGF I+ DGY+LT
Sbjct: 61  AGQMPDLEGLPP------MFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYVLT 114

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH+V D     V LSD +EL AKLVGTD   D+A+LKV+       V+  D+  ++VGE
Sbjct: 115 NNHVVADADEIIVRLSDRSELQAKLVGTDPRTDVALLKVEGKNL-PIVKLGDSEKLKVGE 173

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  G V+G
Sbjct: 174 WVLAIGSPFGFDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGEVVG 233

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I T     MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL 
Sbjct: 234 INSQIFTRSGGFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFGLD 293

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+  V++  PA K G++VGDVI  ++G+ I    D    +      E+ K+ + +
Sbjct: 294 KPAGALVAQVLENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGEKAKLEIIR 353

Query: 364 EGSKHSVAVVLGSSPTAKNDMHL-----EVGDKELLGMVLQDINDGNKKLV---RIVALN 415
            G + ++ + +G+ P    D+              LG+ + D+    KK +     V + 
Sbjct: 354 NGKRQNLDISVGALPDDDADIGTGAEGSAERSSNRLGVSVADLTAEQKKSLELKGGVVIK 413

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
             ++      G++ G  I  +N   +   K+   +  +  + +  S+ +           
Sbjct: 414 EVQDGPAAMIGLRPGDVISHLNNQAIGSAKEFTEIAKELPKNRSVSMRVL---------- 463

Query: 476 NDNMSRFVSLKIDK 489
               + F++ K+ +
Sbjct: 464 RQGRASFITFKLAE 477


>gi|330808072|ref|YP_004352534.1| serine protease precursor [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376180|gb|AEA67530.1| serine protease precursor [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 476

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 129/494 (26%), Positives = 228/494 (46%), Gaps = 28/494 (5%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
            I  +K+  ++  T ++       +  +LP    D   ++ + SP++V++    K     
Sbjct: 2   SIPRLKTYFSILATVLVLGQAVPAVAVELP----DFTQLVEQASPAVVNISTTQKLPDRR 57

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
                      LP    L+ +F +          P      E    GSGF I+ DGYILT
Sbjct: 58  VSDQQMPDLEGLPPM--LREFFER--GMPQQPRSPGGGRQREAQSLGSGFIISPDGYILT 113

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH++ D     V L+D +EL AKL+GTD   D+A+LK++       ++   + +++ G+
Sbjct: 114 NNHVIADADEILVRLADRSELKAKLIGTDPRSDVALLKIEGKDL-PVLKLGKSQDLKAGQ 172

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IG+PF    TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN  G V+G
Sbjct: 173 WVVAIGSPFGFDHTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAGEVVG 232

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I T     MGV   IP+ +       L S+G+V  GW G++ Q + ++LA   GL 
Sbjct: 233 INSQIYTRSGGFMGVSFAIPIDVAMDVSNQLKSEGKVSRGWLGVVIQEVNKDLAESFGLE 292

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+  + +  PA K G++VGDVI  ++G+ I    D    + +     +  + + +
Sbjct: 293 KPAGALVAQIQEGGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGALKAGAKANLEVIR 352

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVGD-----KELLGMVLQDINDGNKKLV---RIVALN 415
           EG + +V + +G+ P    ++              LG+ + ++ +  K+ +     V + 
Sbjct: 353 EGKRKNVELTVGAIPEEGKELDSLPKSGVERSSNRLGVAVAELTEEQKRTLELQGGVVIK 412

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
             ++      G+Q G  I  +N   +   K+   +     + +  S+ +           
Sbjct: 413 EVQDGPAALIGLQPGDIITHLNNQAIGSAKEFTDIAKALPKNRSVSMRVL---------- 462

Query: 476 NDNMSRFVSLKIDK 489
               + F++ K+ +
Sbjct: 463 RQGRASFITFKLAE 476


>gi|84516428|ref|ZP_01003787.1| possible serine protease [Loktanella vestfoldensis SKA53]
 gi|84509464|gb|EAQ05922.1| possible serine protease [Loktanella vestfoldensis SKA53]
          Length = 475

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 130/502 (25%), Positives = 223/502 (44%), Gaps = 42/502 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
            +R +++  S   +A++ ++       + A           +   VSPS+V++       
Sbjct: 1   MRRILIACASAILLAVSFLVM----QAVAASAQDRPPSFADLAELVSPSVVNITTSTTIA 56

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
                       G +P+  P +++F                        GSGF I+ DG+
Sbjct: 57  ERT------MPRGIVPDGSPFEDFF----------NNGPRGGPQRSSALGSGFVISADGF 100

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDANNI 180
           I+T+NH++E      +      ELPA+L+GTD   D+AVLKV  SD  F+     +A   
Sbjct: 101 IVTNNHVIEGADEILIEFYSGVELPAELIGTDPNTDIAVLKVDASDLPFVAFGDSNAEGA 160

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
           RVG+ V  +GNP     +VS GIVSA +R +      + Q DA IN+GNSGGP FN  G 
Sbjct: 161 RVGDWVMAMGNPLGQGFSVSVGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGQ 220

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVN  I++     +G+G  +   ++   +  LI  G    GW G+  Q++T ++   +
Sbjct: 221 VIGVNTAILSPTGGSIGIGFAMSSDVVVNVVDQLIEFGETRRGWLGVRIQDVTPDMVSAI 280

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
                    +   V   PA+++GM  GDVI + DG  I   ++ V  + +    ++V + 
Sbjct: 281 DGLDNARGALVTDVPAGPAEESGMLSGDVILIFDGVEIADTRELVRIVGNSPVGKEVPVQ 340

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE-------LLGMVLQDINDGNKKLV---- 409
           + ++G    + VVLG   T++         +        LLG+ L+ ++    +      
Sbjct: 341 VLRDGETEQLIVVLGRRETSEAVAFPAAAPEAPAAEPDTLLGLTLEPVSPELVEQFSLNV 400

Query: 410 --RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              +V      + +  +KG+ +G  I   +   V  + ++   I  A E  R S+L+ ++
Sbjct: 401 DQGLVITAIAPDSDAASKGLIEGDVITEASRQPVGTMDELRAQIDLATEAGRTSILMLVR 460

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
              D         RFV+L +D+
Sbjct: 461 RGGD--------PRFVALVLDQ 474


>gi|209548527|ref|YP_002280444.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534283|gb|ACI54218.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 527

 Score =  210 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 176/518 (33%), Positives = 265/518 (51%), Gaps = 49/518 (9%)

Query: 8   SVKSICTVALTCVIFSS---TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           +V  I    L   +      +Y        P+      V+  VSP++VSV VE +     
Sbjct: 19  TVAGIAAAVLATGVPLEITRSYAEAVKVQAPAVPSFANVVDAVSPAVVSVRVENRVNPVS 78

Query: 65  EQMF---NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV---------------- 105
           +         GF +LP+DHPLK +F++   +  S ++                       
Sbjct: 79  DNDGFSIEGRGFDDLPDDHPLKRFFKQFGGQDPSDQQGHQRRFGQNGPGGQNGPGGKGRL 138

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
             +  GSGFFI++DGYI+T+NH+V DG +F  +++D TEL AKL+G D   DLAVLKV  
Sbjct: 139 RPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAVMNDGTELDAKLIGKDPRTDLAVLKVDG 198

Query: 166 D-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDA 223
             +KF  V + D NN+RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + Q+DA
Sbjct: 199 KGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYLQVDA 258

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N+GNSGGP FN  G V+G+N  I +     +G+   IP S  +  +  L+  G+V  G
Sbjct: 259 AVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSVGIAFAIPASTARDVVADLMKDGQVSRG 318

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           W G+  Q +T+++A  +GL    G+L+ A    SP DKAGMK GDV+  L+G  IK  +D
Sbjct: 319 WLGVQIQPVTKDIAESIGLSEPSGALVVAPQAGSPGDKAGMKAGDVVTALNGETIKDARD 378

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---------- 393
              +I +  P  +V++S+ + G    + V LG+ P  + D + +   +            
Sbjct: 379 LSRRIGAMQPGSKVELSVWRAGKAQPLTVELGTLPADQKDANADDNSQPQQPEAPASEKA 438

Query: 394 ---LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
              LG+ +   +DG      +     + + +   KGI++G  I SVN  EVS   DV ++
Sbjct: 439 LADLGLTVGPSDDGK----GLAITGIDPDSDAADKGIKEGEKITSVNNQEVSSPADVVKV 494

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           + +AK+  R   L QI+        +   SRFV+L I+
Sbjct: 495 LNQAKKDGRTRALFQIQ--------SSEGSRFVALPIN 524


>gi|288958202|ref|YP_003448543.1| hypothetical protein AZL_013610 [Azospirillum sp. B510]
 gi|288910510|dbj|BAI71999.1| hypothetical protein AZL_013610 [Azospirillum sp. B510]
          Length = 554

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 144/476 (30%), Positives = 227/476 (47%), Gaps = 39/476 (8%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           +      +  ++ P++V++                      P   P ++     F + F 
Sbjct: 93  APGSFADLAEKLLPAVVNISTSQN--APPRPQGQRPEIPQFPPGSPFED-----FFRDFF 145

Query: 96  GEEPILSDTVERLMFGSGFFIT-DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDA 154
             +       +    GSGF I   +GY++T+NH+V+D    +VIL DDT + A+LVG D+
Sbjct: 146 DRQQQDQPQRKATSLGSGFIIDAKNGYVVTNNHVVQDADEITVILQDDTNIKAELVGKDS 205

Query: 155 LFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214
             DLA+LK+++    + V F D++ +RVG+ V  IGNPF L G+V+AGI+SA  R+I   
Sbjct: 206 KTDLALLKIKTSHPLVAVPFGDSDAMRVGDWVLAIGNPFGLGGSVTAGIISARQRNIDAG 265

Query: 215 PGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPS 273
           P   F Q DA IN+GNSGGP FN  G VIG+N  I +     +G+G  IP ++ K+ +  
Sbjct: 266 PYDDFLQTDASINRGNSGGPMFNLNGEVIGINTAIFSPSGGSVGIGFAIPSNLAKQVVAQ 325

Query: 274 LISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICML 333
           L   G+   GW G+  Q +T E+A  LGL   KG+L+ +V  + PA K G++ GDV+   
Sbjct: 326 LKDYGKTRRGWLGVRIQAVTPEIAESLGLPNHKGALVASVTPDGPAAKGGIQAGDVVTRF 385

Query: 334 DGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN----------- 382
           DG+ I   +     +A     + V + + ++G   +V V +G    A+            
Sbjct: 386 DGKEIDEMRRLPRVVAETGIDKAVPVEVWRKGKAQTVQVKVGELEAAEEQGLLAAGPDEK 445

Query: 383 ----DMHLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGM 431
               D        E LGM L  I    ++          +V  +         KG++ G 
Sbjct: 446 QQPKDKAPAQKPTESLGMKLTTITPDLRQQYEIKPEMKGVVITDVAGNSTAAEKGLRAGD 505

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            I+ V   EV   +DV   + KAKE+ + SVLL +    D+        RFV++ +
Sbjct: 506 VIIEVGQEEVRKPEDVTAKVQKAKEQSKKSVLLLVDRKGDL--------RFVAIPL 553


>gi|121600278|ref|YP_991952.1| serine protease [Burkholderia mallei SAVP1]
 gi|124383439|ref|YP_001028398.1| serine protease [Burkholderia mallei NCTC 10229]
 gi|126450167|ref|YP_001079633.1| serine protease [Burkholderia mallei NCTC 10247]
 gi|167893048|ref|ZP_02480450.1| serine protease [Burkholderia pseudomallei 7894]
 gi|167917775|ref|ZP_02504866.1| serine protease [Burkholderia pseudomallei BCC215]
 gi|238562737|ref|ZP_00439966.2| serine protease [Burkholderia mallei GB8 horse 4]
 gi|251767806|ref|ZP_04820261.1| serine protease [Burkholderia mallei PRL-20]
 gi|254176920|ref|ZP_04883577.1| serine protease [Burkholderia mallei ATCC 10399]
 gi|254196679|ref|ZP_04903103.1| serine protease [Burkholderia pseudomallei S13]
 gi|254208792|ref|ZP_04915140.1| serine protease [Burkholderia mallei JHU]
 gi|121229088|gb|ABM51606.1| serine protease [Burkholderia mallei SAVP1]
 gi|124291459|gb|ABN00728.1| serine protease [Burkholderia mallei NCTC 10229]
 gi|126243037|gb|ABO06130.1| serine protease [Burkholderia mallei NCTC 10247]
 gi|147750668|gb|EDK57737.1| serine protease [Burkholderia mallei JHU]
 gi|160697961|gb|EDP87931.1| serine protease [Burkholderia mallei ATCC 10399]
 gi|169653422|gb|EDS86115.1| serine protease [Burkholderia pseudomallei S13]
 gi|238522056|gb|EEP85503.1| serine protease [Burkholderia mallei GB8 horse 4]
 gi|243061670|gb|EES43856.1| serine protease [Burkholderia mallei PRL-20]
          Length = 483

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 135/495 (27%), Positives = 228/495 (46%), Gaps = 35/495 (7%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSS--------------VDLPPVIARVSPSIVSVMVEP 58
              AL+    + T       + P+                D   ++    P++V++  + 
Sbjct: 3   VAAALSAGYVAGTRRAEPQIITPAVAALMPAEAAAKTGIPDFSGLVETYGPAVVNISAKH 62

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVERLMFGSGFFI 116
             + + ++   A     +  D P   +FR  + +     G      D       GSGF I
Sbjct: 63  VVQRAAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMGGGRQPQPDDQPSTSLGSGFII 120

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           + DGYILT+ H+++     +V L+D  E  AK+VG D   D+AVLK+ +      V+  D
Sbjct: 121 SADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQSDVAVLKIDASGL-PIVKIGD 179

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCF 235
               +VG+ V  IG+P+    TV++GI+SA  R +PD   T F Q D P+N GNSGGP F
Sbjct: 180 PAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPFIQTDVPVNPGNSGGPLF 239

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N+MI +      G+   IP++   K    L+  G V  G  G+  Q L Q 
Sbjct: 240 NLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKTGHVSRGRLGVAVQGLNQT 299

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA   GL+   G+L+++V  + PA KAG++ GDVI  +DG  ++       QIA   P  
Sbjct: 300 LASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVDGVPVQDSSTLPAQIAGMKPGT 359

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKELLGMVLQDINDGNKKLVRIVAL 414
           +  + + ++ S+ +V+V L S    +      E  ++  LG+ ++ ++   +    +   
Sbjct: 360 KADLQIWRDKSRKTVSVTLASLADDQAKAGADEPVEQGRLGVAVRPLSPRERNGSSLTHG 419

Query: 415 NPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
              ++      + GIQ G  I++VN   V+  + +   + +A     +S+ L I+ D   
Sbjct: 420 LVVQQSAGPAASAGIQPGDVILAVNGRPVTSAEQLRDAVKRA----GNSLALLIQRD--- 472

Query: 473 QSGNDNMSRFVSLKI 487
                +   FV + +
Sbjct: 473 -----DAQIFVPVDL 482


>gi|167814486|ref|ZP_02446166.1| subfamily S1C unassigned peptidase [Burkholderia pseudomallei 91]
          Length = 483

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 135/495 (27%), Positives = 229/495 (46%), Gaps = 35/495 (7%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSS--------------VDLPPVIARVSPSIVSVMVEP 58
              AL+    + T       + P+                D   ++    P++V++  + 
Sbjct: 3   VAAALSAGYVAGTRRAEPQIITPAVAALMPAEAAAKTGIPDFSGLVETYGPAVVNISAKH 62

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVERLMFGSGFFI 116
             + + ++   A     +  D P   +FR  + +     G      D       GSGF I
Sbjct: 63  VVQRAAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMGGGRQPQPDDQPSTSLGSGFII 120

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           + DGYILT+ H+++     +V L+D  E  AK+VG D   D+AVLK+ +      V+  D
Sbjct: 121 SADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQSDVAVLKIDASGL-PIVKIGD 179

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCF 235
               +VG+ V  IG+P+    TV++GI+SA  R +PD   T F Q D P+N GNSGGP F
Sbjct: 180 PAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPFIQTDVPVNPGNSGGPLF 239

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N+MI +      G+   IP++   K    L+  G V  G  G+  Q L Q 
Sbjct: 240 NLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKTGHVSRGRLGVAVQGLNQT 299

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA   GL+   G+L+++V  + PA KAG++ GDVI  +DG  ++       QIA   P  
Sbjct: 300 LASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVDGVPVQDSSTLPAQIAGMKPGT 359

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKELLGMVLQDINDGNKKLVRIVAL 414
           +  + + ++ S+ +V+V L S    +    + E  ++  LG+ ++ ++   +    +   
Sbjct: 360 KADLQIWRDKSRKTVSVTLASLADDQAKAGVDEPVEQGRLGVAVRPLSPRERNGSSLTHG 419

Query: 415 NPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
              ++      + GIQ G  I++VN   V+  + +   + +A     +S+ L I+ D   
Sbjct: 420 LVVQQSAGPAASAGIQPGDVILAVNGRPVTSAEQLRDAVKRA----GNSLALLIQRD--- 472

Query: 473 QSGNDNMSRFVSLKI 487
                +   FV + +
Sbjct: 473 -----DAQIFVPVDL 482


>gi|190890813|ref|YP_001977355.1| serine protease Do protein [Rhizobium etli CIAT 652]
 gi|190696092|gb|ACE90177.1| serine protease Do protein [Rhizobium etli CIAT 652]
          Length = 501

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 150/492 (30%), Positives = 241/492 (48%), Gaps = 39/492 (7%)

Query: 16  ALTCVIFSSTYLVLEA---KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
            L   I SST L   +    +  +S     ++    P++V++    K             
Sbjct: 24  CLPFAINSSTALAAPSDTGGILAASGSFAAIVDADKPAVVTITTTVKATDVSAGQ----- 78

Query: 73  FGNLPEDHPLKNYFRKDFHKFF---SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                +D P+   FR+ F         + P    +   +  GSGF I+ DG I+T+NH++
Sbjct: 79  -----QDSPMDEQFRQFFEDQGIPLPRQAPQQKPSQHAMALGSGFIISPDGVIVTNNHVI 133

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           ++     V L D TELPAKL+GTD   D+AVLK+ + +    + + D++ +++G+ +  I
Sbjct: 134 DNALDIKVTLDDGTELPAKLIGTDPKSDVAVLKIAAGKPLQTIAWGDSDRLKLGDQILAI 193

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G V+G+N  I
Sbjct: 194 GNPFGIGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDREGKVVGINTAI 253

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     +GVG  IP    K  +  L   G +DHG+ G+  Q +T+++A  +GL  T G+
Sbjct: 254 YSPNGGSVGVGFAIPSDEAKAIVAKLEKNGSIDHGYLGVQIQPVTKDVADAVGLDKTGGA 313

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+ AV  ++PA  AG+K GD++  + G  +K+ +D    +A  SP  +  + + ++G   
Sbjct: 314 LVAAVSADTPAAAAGLKPGDIVTSVGGEAVKTPKDLSRLVADLSPGTRESLGVWRDGKTI 373

Query: 369 SVAVVLGS-------SPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVAL 414
            + V +G+       +     D   +   +  LG+ L D+    ++ +         V  
Sbjct: 374 ELNVTVGANAGGQKQAAAENPDRQGQASGQPSLGISLADLTPDVRQQLDLPRSVSGAVVA 433

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           +   ++   A GIQ G  IVSVN   V   +DV+  I +A +  R SVLL I+ D     
Sbjct: 434 SVKPDKSAAAAGIQSGDVIVSVNDRPVHNARDVKAAIAEAGKAGRKSVLLLIERD----- 488

Query: 475 GNDNMSRFVSLK 486
                  FV++ 
Sbjct: 489 ---GQKTFVAVP 497


>gi|218781544|ref|YP_002432862.1| protease Do [Desulfatibacillum alkenivorans AK-01]
 gi|218762928|gb|ACL05394.1| protease Do [Desulfatibacillum alkenivorans AK-01]
          Length = 474

 Score =  209 bits (532), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 145/498 (29%), Positives = 229/498 (45%), Gaps = 39/498 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPP----SSVDLPPVIARVSPSIVSVMVEP 58
            + I +  S    A    +F   +       P            ++ + SPS+V++ V  
Sbjct: 1   MKSITTFSSKTGAAALATLFVFVFFASLTPSPAWSRGLPKSFSDLVEKASPSVVNISVMK 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
             K                 D P  ++F K F +   G              G+GF I  
Sbjct: 61  VVK--------GKQLMPFGPDDPFHDFFEKYFGEKMPGN-------RRLGGLGTGFIIDK 105

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DGYILT+NH+V+D     V L++D E  AK+VG D   DLA++K++ D   +P+   D+ 
Sbjct: 106 DGYILTNNHVVDDADEIKVKLTNDKEYDAKIVGKDPKTDLALIKIEPDEAIVPLPLGDSE 165

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR-PGTFTQIDAPINQGNSGGPCFNA 237
            ++VG+ V  IGNP+ L  TV+AGI SA  R I       F Q DA IN GNSGGP  N 
Sbjct: 166 ALKVGDWVMAIGNPYGLGNTVTAGICSAKYRRIGAGAYDNFIQTDASINPGNSGGPLLNM 225

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+G+N  I +     +G+G  IP ++ K  +P L   G+V  GW G++ Q +T EL 
Sbjct: 226 DGEVVGINTAIFSRSGGSVGIGFAIPSNMAKDLLPQL-KDGKVIRGWLGVLVQGITPELK 284

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
             L L  TKG+L+++V    PA+KAGM+ GDV+   DG  IK   D  + +AS    + V
Sbjct: 285 DALDLEDTKGALVSSVTPGGPAEKAGMERGDVVVTFDGTPIKEMGDLPYVVASTPVGKNV 344

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHL--EVGDKELLGMVLQDINDGNK------KLV 409
           ++ + ++G K ++ V +      +  +    E      +G+ LQ++           K  
Sbjct: 345 EVEIIRKGKKKTIEVKIAQLQEDEKSLMASQEDAQGPDIGLALQEVTPEIASSLGLSKST 404

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +V              ++ G  IV ++  EV  + D  +++ K K+   D+VL  I+  
Sbjct: 405 GVVISRVTPYSAAAEADLRSGDLIVELDGKEVETVSDANKILSKFKKG--DTVLFLIER- 461

Query: 470 PDMQSGNDNMSRFVSLKI 487
                     + F ++K+
Sbjct: 462 -------QGSTHFATVKV 472


>gi|307945909|ref|ZP_07661245.1| protease Do [Roseibium sp. TrichSKD4]
 gi|307771782|gb|EFO31007.1| protease Do [Roseibium sp. TrichSKD4]
          Length = 496

 Score =  209 bits (532), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 150/507 (29%), Positives = 239/507 (47%), Gaps = 35/507 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
            F+R+  SV S+   A+   +        +       V +  +   +  ++V++    K 
Sbjct: 5   FFRRRFKSVVSLTAAAMIGGLV--VLNPAQPSFAQGPVSVADLAEELGDAVVNISTSQKV 62

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DD 119
           +              +PE  P + +F + F++   G+E            GSGF I  ++
Sbjct: 63  EGRRS-----VPMPQVPEGSPFQEFFEEFFNRQNRGDEDRQP--RRVQSLGSGFVIDGEE 115

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           G I+T+NH++E     +   +D T+L A+L+GTD   D+AVLKV+ +     V+F D++ 
Sbjct: 116 GIIITNNHVIEGADEITANFNDGTKLKAELIGTDEKTDIAVLKVEPETPLKAVDFGDSDA 175

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           IRVG+ V  IGNPF L GTV+ GIVSA +RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 176 IRVGDWVMAIGNPFGLGGTVTVGIVSAQNRDINSGPYDNFIQTDASINRGNSGGPLFDME 235

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G+VIG+N  I++     +G+G  IP     + I  L   G    GW G+  Q +T E+A 
Sbjct: 236 GNVIGINTAIISPSGGSIGIGFAIPAKTATRVISQLREFGETRRGWLGVRIQEVTDEIAE 295

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LG+    G+L+  V  + PA  A ++ GDVI   DG+ I S ++    +A  +  ++V 
Sbjct: 296 SLGMDEAMGALVAGVSDDGPAAGADIQPGDVIVEFDGKPIDSMRELPRIVAETAIGKEVA 355

Query: 359 ISLCKEGSKHSVAVVLGSSP----------TAKNDMHLEVGDKELLGMVLQDINDGNKKL 408
           + + ++  + +V V LG                 D        E+LGM+L +++D  ++ 
Sbjct: 356 VVVFRKAERVTVPVTLGRLEEADARTDEGEDDSVDPLPADEPSEILGMMLVELDDALREE 415

Query: 409 V-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
                    ++          E K +Q G  I  V    V+  +DV+  + K KE  R S
Sbjct: 416 FNIEADVDGVLVKEVIPGSSAEEKRVQAGDVIKEVAQEPVNTPEDVKAEVKKLKEADRRS 475

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKID 488
            LL         S      RFV ++I+
Sbjct: 476 ALLL-------LSNQTGELRFVPVRIE 495


>gi|167579989|ref|ZP_02372863.1| serine protease [Burkholderia thailandensis TXDOH]
          Length = 483

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 137/495 (27%), Positives = 229/495 (46%), Gaps = 35/495 (7%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSS--------------VDLPPVIARVSPSIVSVMVEP 58
              AL+    + T       + P+                D   ++    P++V++  + 
Sbjct: 3   VAAALSAGYVAGTRHAEPQIITPAVAALMPAEAAAKTGIPDFSGLVETYGPAVVNISAKH 62

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVERLMFGSGFFI 116
             +   ++   A     +  + P   +FR  + +     G      D       GSGF I
Sbjct: 63  VVQRVAQR--RAAPQLPIDPEDPFYQFFRHFYGQVPGMGGGRQPQPDDQPSTSLGSGFII 120

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           + DGYILT+ H+++     +V L+D  E  AK+VGTD   D+AVLK+ +      V+  D
Sbjct: 121 SADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGTDKQSDVAVLKIDASGL-PTVKIGD 179

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCF 235
               +VG+ V  IG+P+    TV++GI+SA  R +PD   T F Q D P+N GNSGGP F
Sbjct: 180 PAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPFIQTDVPVNPGNSGGPLF 239

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N+MI +      G+   IP++   K    L+  G V  G  G+  Q L Q 
Sbjct: 240 NLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKTGHVSRGRLGVAVQGLNQT 299

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA   GL+   G+L+++V  + PA KAG++ GDVI  +DG  ++       QIAS  P  
Sbjct: 300 LASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVDGVPVQDSTTLPAQIASMKPGT 359

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKELLGMVLQDINDGNKKLVRIVAL 414
           +  + + ++ SK +V+V L S    +      E  ++  LG+ ++ ++   +    +   
Sbjct: 360 KADLQIWRDKSKKTVSVTLASLADDQAKAGADEPVEQGRLGVAVRPLSPRERNGTSLTHG 419

Query: 415 NPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
              ++      + GIQ G  I++VN   V+  + +   + +A     +S+ L I+ D   
Sbjct: 420 LVVQQSTGPAASAGIQPGDVILAVNGRPVTSAEQLRDAVKRA----GNSLALLIQRD--- 472

Query: 473 QSGNDNMSRFVSLKI 487
                +   FV + +
Sbjct: 473 -----DAQIFVPVDL 482


>gi|153873476|ref|ZP_02002048.1| periplasmic serine protease, DO/DeqQ family [Beggiatoa sp. PS]
 gi|152070060|gb|EDN67954.1| periplasmic serine protease, DO/DeqQ family [Beggiatoa sp. PS]
          Length = 513

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 148/513 (28%), Positives = 249/513 (48%), Gaps = 39/513 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPS------SVDLPPVIARVSPSIVSVM 55
            KRQ  S        ++ +  S  +    A +P +            ++ +V PS+V   
Sbjct: 12  LKRQAWSQGVFMFALISALSISPFFNNAYAIVPLNVSVQMVPASFADLVEKVRPSVV--- 68

Query: 56  VEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKD----------FHKFFSGEEPILSDTV 105
                       +  +      +D P +++FRKD          F K          +  
Sbjct: 69  -SISTTKKSSSFWQEFRRQPGQKDLPFEDFFRKDSPFEDFFRRFFEKESFQLNQDKPEEH 127

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           +    GSGF I  DG I+T++H++E        L+D ++  AK++G DA  DLA+LK+++
Sbjct: 128 KASGLGSGFLIHADGLIVTNHHVIEGADEIKATLNDGSKYSAKVLGHDAKTDLALLKIEA 187

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAP 224
           D+    V F D++  RVG+ V  +GNPF   GT + GI+SA  RDI   P   F QIDA 
Sbjct: 188 DKPLPYVSFGDSDKARVGDWVIAVGNPFGFGGTFTVGIISARGRDIQSGPYDDFIQIDAS 247

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           IN+GNSGGP  N  G VIG+N  I +    ++G+G  +P S+    I  L   G V+ GW
Sbjct: 248 INKGNSGGPLLNMDGEVIGINTAIYSPTGGNVGIGFAVPTSMAVPIIEQLQEHGSVERGW 307

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            G+  Q++  E+A  LG+   KG+L+  V+ E+PA+K+G+  GDVI  ++G+   S ++ 
Sbjct: 308 LGVQIQSVDDEIAESLGMSEAKGALVVKVLPETPAEKSGILAGDVIFEVNGKSANSAKEL 367

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND---MHLEVGDKELLGMVLQDI 401
              +A+    +  K+++ + GS  +V+V+LG     +        +    ++LG+ L +I
Sbjct: 368 SLIVANTEIGKPAKLNILRHGSLKTVSVILGRMSGEETVTLGADGKEETSDILGLKLAEI 427

Query: 402 NDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
            +  ++          I+ L+   +   +  G+Q+G  I+ VN  +VS  ++V   I +A
Sbjct: 428 TERTRQQYKLSEEVDGILILDIKADSPADKAGLQQGDVIMMVNQKQVSSPEEVVSRIEQA 487

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            + +R  VLL I              RF+++K+
Sbjct: 488 IKAERKMVLLLINR--------QGSPRFMTVKV 512


>gi|86356933|ref|YP_468825.1| serine protease DO-like protein [Rhizobium etli CFN 42]
 gi|86281035|gb|ABC90098.1| serine protease DO-like protein [Rhizobium etli CFN 42]
          Length = 529

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 178/520 (34%), Positives = 265/520 (50%), Gaps = 51/520 (9%)

Query: 8   SVKSICTVALTCVIFSS---TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           +V  I    L   +      +Y        P+      V+  VSP++VSV VE +     
Sbjct: 19  TVAGIAAAVLATGVPLEITRSYAEAVKVQAPAVPSFANVVDAVSPAVVSVRVENRVNPVA 78

Query: 65  EQM------FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------------- 105
           +        FN  GF +LP+DHPLK +FR+        +                     
Sbjct: 79  DNNDGFSFDFNGRGFDDLPDDHPLKRFFRQFGQDPNDQQGHQRRFGQNGPGGPNGPGKGR 138

Query: 106 -ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
              +  GSGFFI++DGYI+T+NH+V DG +F  +++D TEL AKL+G D   DLAVLKV 
Sbjct: 139 LRPVAQGSGFFISEDGYIVTNNHVVADGQAFVAVMNDGTELDAKLIGKDPRTDLAVLKVD 198

Query: 165 SD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQID 222
              +KF  V + D NN+RVG+ V  +GNPF L GTV+AGI+SA  RDI   P   + Q+D
Sbjct: 199 GKGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGTVTAGIISARGRDIGSGPYDDYLQVD 258

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
           A +N+GNSGGP FN  G V+G+N  I +     +G+   IP S  K  +  L+  G+V  
Sbjct: 259 AAVNRGNSGGPTFNLNGEVVGINTAIFSPSGGSVGIAFAIPASTAKDVVADLMKDGQVSR 318

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           GW G+  Q +T+++A  +GL    G+L+ A    SP DKAGMK GDV+  L+G  IK  +
Sbjct: 319 GWLGVQIQPVTKDIAESIGLSEPSGALVVAPQPGSPGDKAGMKAGDVVTALNGETIKDAR 378

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL--------- 393
           D   +I +  P  + ++S+ + G   S+ V LG+ P  + D + +  + +          
Sbjct: 379 DLSRRIGAMQPGSKAELSVWRAGKAQSLTVELGTLPADQKDANADDNNNQPQQPEAPASE 438

Query: 394 -----LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
                LG+ +   +DG      +     + + +   KGI++G  I SVN  EVS   DV 
Sbjct: 439 KALADLGLTVGPSDDGK----GLAITGIDPDSDAADKGIKEGEKITSVNNQEVSTPADVV 494

Query: 449 RLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           +++ +AK+  R   L QI+        +   SRFV+L I+
Sbjct: 495 KVLNQAKKDGRTRALFQIQ--------SSEGSRFVALPIN 526


>gi|327194300|gb|EGE61161.1| serine protease Do protein [Rhizobium etli CNPAF512]
          Length = 501

 Score =  209 bits (530), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 151/492 (30%), Positives = 242/492 (49%), Gaps = 39/492 (7%)

Query: 16  ALTCVIFSSTYLVLEA---KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
            L   I SST L   +    +  +S     ++    P++V++    K             
Sbjct: 24  CLPFAINSSTALAAPSDTGGILAASGSFAAIVDADKPAVVTITTTVKATDVSAGQ----- 78

Query: 73  FGNLPEDHPLKNYFRKDFHKFF---SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                +D P+   FR+ F         + P    +   +  GSGF I+ DG I+T+NH++
Sbjct: 79  -----QDSPMDEQFRQFFEDQGIPLPRQAPQQKPSQHAMALGSGFIISPDGVIVTNNHVI 133

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           ++     V L D TELPAKL+GTD   D+AVLK+ + +    + + D++ +++G+ +  I
Sbjct: 134 DNALDIKVTLDDGTELPAKLIGTDPKSDVAVLKIAAGKPLQTIAWGDSDRLKLGDQILAI 193

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G V+G+N  I
Sbjct: 194 GNPFGIGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDREGKVVGINTAI 253

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     +GVG  IP    K+ +  L   G +DHG+ G+  Q +T+++A  +GL  T G+
Sbjct: 254 YSPNGGSVGVGFAIPSDEAKEIVAKLEKNGSIDHGYLGVQIQPVTKDVADAVGLDKTGGA 313

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+ AV  ++PA  AG+K GD++  + G  +K+ +D    +A  SP  +  + L ++G   
Sbjct: 314 LVAAVSADTPAAAAGLKPGDIVTSVGGEAVKTPKDLSRLVADLSPGTRESLGLWRDGKTI 373

Query: 369 SVAVVLGS-------SPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVAL 414
            + V +G+       +     D   +   +  LG+ L D+    ++ +         V  
Sbjct: 374 ELNVTVGANAGGQKQAAAENPDRQGQASGQPSLGIGLADLTPDVRQQLDLPRSVSGAVVA 433

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           +   ++   A GIQ G  IVSVN   V   +DV+  I +A +  R SVLL I+ D     
Sbjct: 434 SVKPDKSAAAAGIQSGDVIVSVNDRPVHNARDVKAAIAEAGKAGRKSVLLLIERD----- 488

Query: 475 GNDNMSRFVSLK 486
                  FV++ 
Sbjct: 489 ---GQKTFVAVP 497


>gi|310815312|ref|YP_003963276.1| possible serine protease [Ketogulonicigenium vulgare Y25]
 gi|308754047|gb|ADO41976.1| possible serine protease [Ketogulonicigenium vulgare Y25]
          Length = 473

 Score =  209 bits (530), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 130/482 (26%), Positives = 211/482 (43%), Gaps = 33/482 (6%)

Query: 19  CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
            V         ++ +    +    +  +VSP++V++                 G  N  E
Sbjct: 13  VVTPVQALTPEQSPVEMRPLSFADLAEQVSPAVVNITTSMLVAA--------PGGNNPAE 64

Query: 79  DHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
             P +++FR+             + T      GSGF I+ DGYI+T+NH++ D     + 
Sbjct: 65  GTPFEDFFRQF-----GPRSGEQAPTQRANALGSGFVISADGYIVTNNHVIADADQIQIE 119

Query: 139 LSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI-RVGEAVFTIGNPFRLRG 197
                 LPA +VGTD   D+A+LKV++         + +    RVG+ V  +GNP     
Sbjct: 120 FFSGDSLPATVVGTDPNTDIALLKVEASDLPYVEFGDSSETAARVGDWVMAMGNPLGQGF 179

Query: 198 TVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           +VSAGI+SA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     +G
Sbjct: 180 SVSAGIISARNRALSGTYDDYIQTDAAINRGNSGGPLFNMEGQVIGVNTAILSPNGGSIG 239

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +G  +   ++   +  L   G    GW G   Q +TQ++   L         + + V E 
Sbjct: 240 IGFAMSSEVVSGVVGQLREFGETRRGWLGARVQAVTQDMVGALPGLENARGALISDVPEG 299

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           PA +AG++ GDV+   DG  +   + FV  I +    + V + + ++G    +AV LG  
Sbjct: 300 PAREAGLQAGDVVLTFDGATVTDSRGFVQMIGAAGADQTVTLGVLRDGETFDLAVTLGRR 359

Query: 378 PTAKNDMHL-----EVGDKELLGMVLQDINDGNKKLV------RIVALNPNREREVEAKG 426
             A+  +       E    E LG+ L  I     +         +V    +   E  A+G
Sbjct: 360 EEAEGQLTPQGLPTEQSQYEGLGLTLSQITPQIAQQFNLGTDTGLVITEIDPASEAAARG 419

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +  G  +  V    V+    VE ++  A+E  R SV+L ++   D         RFV+L 
Sbjct: 420 LAVGDVVSDVANTPVATPAQVEEIVTAARESGRTSVMLLVRRGGD--------PRFVALP 471

Query: 487 ID 488
           ++
Sbjct: 472 LE 473


>gi|238028502|ref|YP_002912733.1| protease Do [Burkholderia glumae BGR1]
 gi|237877696|gb|ACR30029.1| Protease Do [Burkholderia glumae BGR1]
          Length = 496

 Score =  209 bits (530), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 129/454 (28%), Positives = 215/454 (47%), Gaps = 18/454 (3%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K S  +         +    P   +F+  + +   G 
Sbjct: 56  PDFSGLVETYGPAVVNISAKHVVKASARRGGGGPQQLPIDPSDPFYQFFKHFYGQV-PGM 114

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
               +D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK++G+D   D
Sbjct: 115 GGGQTDDQPSTSLGSGFIVSPDGYILTNAHVIDGANVITVKLTDKREYRAKVIGSDKQSD 174

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+        V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 175 VAVLKI-DATGLPVVKIGDPQQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 233

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 234 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 293

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL    G+L+++V  + PA KAG++ GDVI  ++G 
Sbjct: 294 TGHVSRGRLGVAVQGLDQTLASSFGLPKPDGALVSSVDPKGPAAKAGLQPGDVILAVNGV 353

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS-PTAKNDMHLEVGDKELLG 395
            ++       QIAS  P  + ++ + ++ SK  V+V L S   + +   +    ++  LG
Sbjct: 354 PVQDSTMLPGQIASLKPGTKAELQIWRDKSKKDVSVTLASLADSQQTASNDGPAEQGRLG 413

Query: 396 MVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ +    +    +    +           GIQ G  I++VN   V+  + +   +  
Sbjct: 414 VAVRQLTPQERAGTSLTHGLVVQQATGPAANAGIQPGDVILAVNGRPVTSAEQLRDAVKS 473

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 474 A----GNSLALLIQRD--------NAQIFVPVDL 495


>gi|91775212|ref|YP_544968.1| peptidase S1C, Do [Methylobacillus flagellatus KT]
 gi|91775356|ref|YP_545112.1| peptidase S1C, Do [Methylobacillus flagellatus KT]
 gi|91709199|gb|ABE49127.1| Peptidase S1C, Do [Methylobacillus flagellatus KT]
 gi|91709343|gb|ABE49271.1| Peptidase S1C, Do [Methylobacillus flagellatus KT]
          Length = 477

 Score =  209 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 139/501 (27%), Positives = 234/501 (46%), Gaps = 36/501 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MFK+          +A++ +            L     D   +  +   ++V++ V    
Sbjct: 1   MFKK---------LIAMSAICLFVGMAGATPVLAKELPDFTELAEKQGAAVVNISVTQVV 51

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS----GEEPILSDTVERLMFGSGFFI 116
           +           F   PED  L  +FR+     F     G+        +    GSGF I
Sbjct: 52  Q----SGIGGSPFPGFPEDEALNEFFRRFGIPGFPGVPRGQGGPQQPEFKSQSLGSGFII 107

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           + DGYILT+ H+V +     V L+D  E  AK+VG D   D+A+LK+        V   +
Sbjct: 108 SSDGYILTNAHVVREADEVIVKLNDKREFQAKIVGVDRRTDVALLKI-DATGLPKVTIGN 166

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCF 235
              ++VGE V  IG+PF L  T++AG+VSA  R +P      F Q D  IN GNSGGP F
Sbjct: 167 PEQLKVGEWVVAIGSPFGLESTLTAGVVSAKGRALPQENFVPFIQTDVAINPGNSGGPLF 226

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G V+G+N+ I +    +MG+   IP+ +       L   GRV  GW GI  Q +T+E
Sbjct: 227 NLKGEVVGINSQIYSRTGGYMGLSFAIPIDVAMDVANQLKISGRVARGWLGIGIQEMTKE 286

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA   G++ TKG+L+  V K SPA+K G++ GDV+   DG+ +    D    + S  P +
Sbjct: 287 LAESFGMKNTKGALVAGVEKGSPAEKGGLEPGDVVIKFDGKDVNVSSDLPRIVGSTKPGK 346

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-----EVGDKELLGMVLQDINDGNKKLVR 410
           +V++ + + G+  ++ + LG  P  K+++          +   LG+ L+++    ++ + 
Sbjct: 347 KVQVEVLRRGASKTLNITLGEMPADKDEVVPTAQPDAKPESNRLGLTLRELTPQQRRSLN 406

Query: 411 I--VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
                +  + +      GI++G  I+++N  EV  ++   + +      K  +V L ++ 
Sbjct: 407 GRNALVVVDAQGAAAQAGIRRGDLILALNNTEVQSLEQFTKQVNAVPAGK--TVALLVQR 464

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
                   +N + +V +K+ K
Sbjct: 465 --------ENNTLYVPVKVGK 477


>gi|146342413|ref|YP_001207461.1| putative Serine protease do-like [Bradyrhizobium sp. ORS278]
 gi|146195219|emb|CAL79244.1| Putative Serine protease do-like precursor [Bradyrhizobium sp.
           ORS278]
          Length = 499

 Score =  209 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 142/506 (28%), Positives = 243/506 (48%), Gaps = 32/506 (6%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F+R+   ++ I T A+    ++       A+ P     +  V  +V  ++V++      +
Sbjct: 7   FRRR---LRPILTAAVLAAGWALVPAPASARGPEG---IADVAEKVIDAVVNISTSQTVE 60

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL--SDTVERLMFGSGFFITDD 119
                         +P   P + +F   F             +        GSGF + D 
Sbjct: 61  AKGGGGEGRGANPQVPPGSPFEEFFDDFFKNRRGPGGRGGADNSPRRTNSLGSGFIVDDS 120

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           G ++T+NH++ D    +VI++D T++ A+LVG D   DLAVLK +  R+   V+F D++ 
Sbjct: 121 GIVVTNNHVIADADEINVIMNDGTKIKAELVGVDKKTDLAVLKFKPPRQLTVVKFGDSDK 180

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNAL 238
           +R+G+ V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP FN  
Sbjct: 181 LRLGDWVVAIGNPFSLGGTVTAGIVSAKNRDISSGPYDSYIQTDAAINRGNSGGPLFNLD 240

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIGVN +I++     +G+G  +P   +   +  L   G +  GW G+  Q +T E+A 
Sbjct: 241 GEVIGVNTLIISPSGGSIGIGFAVPSKTVAGVVDQLRQFGELRRGWLGVRIQGVTDEIAE 300

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            L ++  +G+L+  V  + PA  AG++ GDV+   DG  IK  +D    +A  +  ++V 
Sbjct: 301 SLNIKPARGALVAGVDDKGPAKPAGIEPGDVVVKFDGHDIKEPKDLSRIVADTAVGKEVD 360

Query: 359 ISLCKEGSKHSVAVVLGSSPTA---------KNDMHLEVGDKELLGMVLQDINDGNKKLV 409
           + + ++G + ++ V LG              K++   +   ++ LG+ L  ++   +   
Sbjct: 361 VVVIRKGQEQTLKVKLGRLEDNEKVQQAAIKKDEPAEKPVTQKALGLDLAALSKDLRTRY 420

Query: 410 -------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
                   +V    ++  +   K +  G  IV V    V+   D+++ + + K+  + SV
Sbjct: 421 KIKDSVKGVVVTGVDQASDAAEKRLSPGDVIVEVAQEAVTSGADIKKRVDQLKKDGKKSV 480

Query: 463 LLQIKYDPDMQSGNDNMSRFVSLKID 488
           LL +       S  D   RFV+L + 
Sbjct: 481 LLLV-------SNADGELRFVALSLQ 499


>gi|27377702|ref|NP_769231.1| DO-like serine protease [Bradyrhizobium japonicum USDA 110]
 gi|27350847|dbj|BAC47856.1| serine protease DO-like protease [Bradyrhizobium japonicum USDA
           110]
          Length = 528

 Score =  209 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 157/479 (32%), Positives = 237/479 (49%), Gaps = 20/479 (4%)

Query: 19  CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
             + S       A+   +      ++ARV P+++SV V   +      M       +  E
Sbjct: 59  LGVTSFIAPAQAAESAATPPGFGDLVARVKPAVISVRVRIDQDNDKSAMLQQNRMDS-DE 117

Query: 79  DHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV 137
           D P   + R+   +   G               GSGFFI+ DGY +T+NH+V+   S  V
Sbjct: 118 DAPFDQFSRQFGFRLPGGMNGMPRQRHQMVTGEGSGFFISADGYAVTNNHVVDHAESVQV 177

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRG 197
            + D T   AK+VGTD   DLA++KV   + F  V+       R+G+ V  +GNPF L G
Sbjct: 178 TMDDGTSYTAKVVGTDPKTDLALIKVDGKKDFPFVK-FSDQKPRIGDWVVAVGNPFGLGG 236

Query: 198 TVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHM 256
           TV+AGIVSA  RDI + P   F QIDAPIN+GNSGGP F+  G+VIGVN  I +     +
Sbjct: 237 TVTAGIVSASGRDIGNGPYDDFIQIDAPINKGNSGGPAFDMSGNVIGVNTAIFSPSGGSV 296

Query: 257 GVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKE 316
           G+G  IP +  K  +  L  KG V  GW G+  Q +T E+A  LGL+  +G+++      
Sbjct: 297 GIGFDIPATTAKLVVAQLKDKGAVTRGWLGVQVQPVTSEIADSLGLKEARGAIVDNPQDN 356

Query: 317 SPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           SPA KAG++ GDVI  ++G  IK  +D    +A+ +P   VK+ +  +G+  +V + LG 
Sbjct: 357 SPAAKAGIEAGDVITAVNGTAIKDSRDLARTVATLAPGTSVKLDVFHKGASKTVTLALGE 416

Query: 377 SPTAKNDMHLEVGDK-------ELLGMVLQDIND-GNKKLVRIVALNPNREREVEAKGIQ 428
            P  +         K         LG+ L    D        +V    + +     +GIQ
Sbjct: 417 LPNERQAQGKADEGKAQPGNGTPRLGLSLAPAGDVQGAGQKGVVVTEVDPQGPAAQRGIQ 476

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            G  I++V    V+ + DV   + +AK   ++SVLLQI+        + + +RFV++ +
Sbjct: 477 TGDVILNVGGKPVANVGDVRAELAQAKSSGKNSVLLQIR--------SADATRFVAVPL 527


>gi|239832272|ref|ZP_04680601.1| protease Do [Ochrobactrum intermedium LMG 3301]
 gi|239824539|gb|EEQ96107.1| protease Do [Ochrobactrum intermedium LMG 3301]
          Length = 520

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 141/526 (26%), Positives = 237/526 (45%), Gaps = 53/526 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  + +   +   T   + A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMTVGGTLSMGTPPAIAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +   A     +PE  P + YF+  F      +     ++ +    GSGF I  + G
Sbjct: 66  -GDGEGDGAVPMPQVPEGSPFQEYFKDFFGDNGGAQG---DESRKVQSLGSGFVIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           +I+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V+F ++  
Sbjct: 122 FIVTNNHVIADADEIEVNFNDGSKLKAELVGKDIKTDLAILKVDPSKHKLKAVQFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDME 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T ++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAVGVIDQLKEFGEVRRGWLGVRIQPVTDDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+  KG+L+  +++ S  D   ++ GDV+   +G+ + + +D    +A     ++V+
Sbjct: 302 SLGLKEAKGALVAGLIENSGVDNKAIEAGDVVIRYEGKPVNTARDLPRLVAETPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLGSS-----------------------------PTAKNDMHLEVG 389
           I + ++G + +V V LG                               P           
Sbjct: 362 IVVVRQGEEKTVKVKLGRLVEDDKSTEAATEDQAPLPEGEGGDEGKQMPDTPKKDQKSDA 421

Query: 390 DKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
              +LGM L +++D  +           +  L  +       K I+ G  IV +    V 
Sbjct: 422 APSVLGMKLSELSDEVRGEFGIAEDVEGVAVLYVSPGSAAGEKRIETGDVIVDIGQVTVK 481

Query: 443 CIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
              DV++ I   + + R + LL       M +      RFV+++I+
Sbjct: 482 TPDDVKKRIDALRREGRKNALL-------MLASRSGELRFVTVRIN 520


>gi|167737361|ref|ZP_02410135.1| serine protease [Burkholderia pseudomallei 14]
          Length = 482

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 135/493 (27%), Positives = 227/493 (46%), Gaps = 35/493 (7%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSS--------------VDLPPVIARVSPSIVSVMVEP 58
              AL+    + T       + P+                D   ++    P++V++  + 
Sbjct: 3   VAAALSAGYVAGTRRAEPQIITPAVAALMPAEAAAKTGIPDFSGLVETYGPAVVNISAKH 62

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVERLMFGSGFFI 116
             + + ++   A     +  D P   +FR  + +     G      D       GSGF I
Sbjct: 63  VVQRAAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMGGGRQPQPDDQPSTSLGSGFII 120

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           + DGYILT+ H+++     +V L+D  E  AK+VG D   D+AVLK+ +      V+  D
Sbjct: 121 SADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQSDVAVLKIDASGL-PIVKIGD 179

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCF 235
               +VG+ V  IG+P+    TV++GI+SA  R +PD   T F Q D P+N GNSGGP F
Sbjct: 180 PAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPFIQTDVPVNPGNSGGPLF 239

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N+MI +      G+   IP++   K    L+  G V  G  G+  Q L Q 
Sbjct: 240 NLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKTGHVSRGRLGVAVQGLNQT 299

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA   GL+   G+L+++V  + PA KAG++ GDVI  +DG  ++       QIA   P  
Sbjct: 300 LASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVDGVPVQDSSTLPAQIAGMKPGT 359

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKELLGMVLQDINDGNKKLVRIVAL 414
           +  + + ++ S+ +V+V L S    +      E  ++  LG+ ++ ++   +    +   
Sbjct: 360 KADLQIWRDKSRKTVSVTLASLADDQAKAGADEPVEQGRLGVAVRPLSPRERNGSSLTHG 419

Query: 415 NPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
              ++      + GIQ G  I++VN   V+  + +   + +A     +S+ L I+ D   
Sbjct: 420 LVVQQSAGPAASAGIQPGDVILAVNGRPVTSAEQLRDAVKRA----GNSLALLIQRD--- 472

Query: 473 QSGNDNMSRFVSL 485
                +   FV +
Sbjct: 473 -----DAQIFVPV 480


>gi|53804465|ref|YP_113924.1| serine protease MucD [Methylococcus capsulatus str. Bath]
 gi|53758226|gb|AAU92517.1| serine protease, MucD [Methylococcus capsulatus str. Bath]
          Length = 473

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 128/497 (25%), Positives = 236/497 (47%), Gaps = 39/497 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MF R     + +  +    V+  S     +        D   ++ + + ++V++    K 
Sbjct: 1   MFDRY----RFVGAICAALVLAVSPPARAQ------LPDFTQLVEQNNAAVVNISTTQKV 50

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
             + +QM        +PE  P  ++FR  F +    +        E    GSGF ++ DG
Sbjct: 51  AANEQQMPEGL---EIPEGTPFDDFFRHYFGEGGGSDGQPS----EAKSLGSGFIMSADG 103

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YI+T++H+V+      V L D  EL AK+VG+D   D+A+LK+++ +    V+   +  +
Sbjct: 104 YIITNHHVVKGADEIVVRLQDRRELVAKIVGSDKRSDVALLKIEASQL-PTVKLGSSEKL 162

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALG 239
           +VGE V  IG+PF    + +AGIVSA  R +P      F Q D  IN GNSGGP FN  G
Sbjct: 163 KVGEWVLAIGSPFGFDHSATAGIVSAKGRSLPSDNYVPFIQTDVAINPGNSGGPLFNLNG 222

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+GVN+ I +     MG+   IP+ +  + +  L + GRV  GW G+  Q++T+ELA  
Sbjct: 223 EVVGVNSQIYSRTGGFMGLSFAIPIEVAMQVVDQLKASGRVSRGWLGVQIQDVTRELAES 282

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
             ++  +G+L++ V+ +SPA+ AG+++GD++   +G+ + +       +      E  KI
Sbjct: 283 FDMKKPQGALVSKVLSKSPAEAAGVQIGDIVLEFNGQAVDTSAALPPMVGMTKVGEVAKI 342

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMH----LEVGDKELLGMVLQDINDGNKKLV-----R 410
            L + G+   +++ +G+ P  +         +    + +G  + D+    ++        
Sbjct: 343 KLLRNGAIKELSIKIGALPDEEEPAMGTAEPDAVPLKRMGASVADLTPELREQFEVPRGG 402

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
           ++    N        G+++G  I+ +   E++ +K +  L       K  +VL+Q     
Sbjct: 403 VLVYGVNPG-PAYEAGLRRGDVILRIQDKEINGVKQLVELEKTLPAGKSLAVLVQ----- 456

Query: 471 DMQSGNDNMSRFVSLKI 487
                  + S F+++K+
Sbjct: 457 -----RRDGSIFLAMKL 468


>gi|221200187|ref|ZP_03573230.1| serine protease, DO/DeqQ family [Burkholderia multivorans CGD2M]
 gi|221206660|ref|ZP_03579672.1| serine protease, DO/DeqQ family [Burkholderia multivorans CGD2]
 gi|221173315|gb|EEE05750.1| serine protease, DO/DeqQ family [Burkholderia multivorans CGD2]
 gi|221180426|gb|EEE12830.1| serine protease, DO/DeqQ family [Burkholderia multivorans CGD2M]
          Length = 494

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 130/456 (28%), Positives = 212/456 (46%), Gaps = 23/456 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F++ + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVARRVPQPQL--PIDPSDPFYQFFKRFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIISPDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+        V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKI-DATGLPTVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL    G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLAKPDGALVSSVDPNGPAAKAGLQPGDVILSVNGT 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ +K SV V LG+   AK         ++  LG
Sbjct: 352 PVVDSTTLPSQIANLKPGSKADLQIWRDKAKQSVTVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKK----LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           + ++ +    +        ++           + GIQ G  I++VN   V+  + +   +
Sbjct: 412 VAVRPLTPQERSADNLSHGLIV--QQAGGPAASAGIQPGDVILAVNGRPVTSPEQLREAV 469

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             A     +S+ L I+ D        N   FV + +
Sbjct: 470 KSA----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|161523862|ref|YP_001578874.1| protease Do [Burkholderia multivorans ATCC 17616]
 gi|189351377|ref|YP_001947005.1| serine protease [Burkholderia multivorans ATCC 17616]
 gi|221211366|ref|ZP_03584345.1| serine protease [Burkholderia multivorans CGD1]
 gi|160341291|gb|ABX14377.1| protease Do [Burkholderia multivorans ATCC 17616]
 gi|189335399|dbj|BAG44469.1| serine protease [Burkholderia multivorans ATCC 17616]
 gi|221168727|gb|EEE01195.1| serine protease [Burkholderia multivorans CGD1]
          Length = 494

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 130/456 (28%), Positives = 212/456 (46%), Gaps = 23/456 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F++ + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVARRVPQPQL--PIDPSDPFYQFFKRFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIISPDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+        V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKI-DATGLPTVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL    G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLAKPDGALVSSVDPNGPAAKAGLQPGDVILSVNGT 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ +K SV V LG+   AK         ++  LG
Sbjct: 352 PVVDSTTLPSQIANLKPGSKADLQIWRDKAKQSVTVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKK----LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           + ++ +    +        ++           + GIQ G  I++VN   V+  + +   +
Sbjct: 412 VAVRPLTPQERSADNLSHGLIV--QQAGGPAASAGIQPGDVILAVNGRPVTSPEQLREAV 469

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             A     +S+ L I+ D        N   FV + +
Sbjct: 470 KSA----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|313500342|gb|ADR61708.1| AlgY [Pseudomonas putida BIRD-1]
          Length = 467

 Score =  208 bits (529), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 134/484 (27%), Positives = 222/484 (45%), Gaps = 30/484 (6%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
              V+     L  +A+   +  D   ++ + SP++V++  + K                L
Sbjct: 3   FAAVLMLGQVLTAQAE--EALPDFTTLVEQASPAVVNISTKQKLPDRRIAANQMPDLEGL 60

Query: 77  PEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           P        FR+ F +    +   P      E    GSGF I+ DGY+LT+NH+V D   
Sbjct: 61  PP------MFREFFERNMPQQPRSPRGDRQREAQSLGSGFIISSDGYVLTNNHVVADADE 114

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V LSD +EL AKLVGTD   D+A+LKV+       V+  D+  ++VGE V  IG+PF 
Sbjct: 115 IIVRLSDRSELQAKLVGTDPRTDVALLKVEGKNL-PTVKLGDSEKLKVGEWVLAIGSPFG 173

Query: 195 LRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
              +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  G V+G+N+ I T   
Sbjct: 174 FDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQIFTRSG 233

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+  V
Sbjct: 234 GFMGLSFAIPIDVAIDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFGLDKPAGALVAQV 293

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
           ++  PA K G++VGDVI  ++G+ I    D    +      E+ K+ + + G + ++ + 
Sbjct: 294 LENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGGLKDGEKAKLEIIRNGKRQNLDIS 353

Query: 374 LGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---RIVALNPNREREVEAK 425
           +G+ P    D+              LG+ + D+    KK +     V +   ++      
Sbjct: 354 VGALPDDDVDIGAGTEGSAERSSNRLGVSVADLTAEQKKSLELKGGVVIKEVQDGPAAMI 413

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           G++ G  I  +N   +   K+   +  +  + +  S+ +               + F++ 
Sbjct: 414 GLRPGDVISHLNNQAIGSAKEFTEIAKELPKNRSVSMRVL----------RQGRASFITF 463

Query: 486 KIDK 489
           K+ +
Sbjct: 464 KLAE 467


>gi|254187558|ref|ZP_04894070.1| serine protease [Burkholderia pseudomallei Pasteur 52237]
 gi|157935238|gb|EDO90908.1| serine protease [Burkholderia pseudomallei Pasteur 52237]
          Length = 495

 Score =  208 bits (529), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 131/456 (28%), Positives = 220/456 (48%), Gaps = 21/456 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFS 95
            D   ++    P++V++  +   + + ++   A     +  D P   +FR  + +     
Sbjct: 54  PDFSGLVETYGPAVVNISAKHVVQRAAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMG 111

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
           G      D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG D  
Sbjct: 112 GGRQPQPDDQPSTSLGSGFIISADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQ 171

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD  
Sbjct: 172 SDVAVLKIDASGL-PIVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDEN 230

Query: 216 GT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
            T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L
Sbjct: 231 YTPFIQTDVPVNPGNSGGPLFNLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDEL 290

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           +  G V  G  G+  Q L Q LA   GL+   G+L+++V  + PA KAG++ GDVI  +D
Sbjct: 291 VKTGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVD 350

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM-HLEVGDKEL 393
           G  ++       QIA   P  +  + + ++ S+ +V+V L S    +      E  ++  
Sbjct: 351 GVPVQDSSTLPAQIAGMKPGTKADLQIWRDKSRKTVSVTLASLADDQAKAGTDEPVEQGR 410

Query: 394 LGMVLQDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           LG+ ++ ++   +    +      ++      + GIQ G  I++VN   V+  + +   +
Sbjct: 411 LGVAVRPLSPRERNGSSLTHGLVVQQSAGPAASAGIQPGDVILAVNGRPVTSAEQLRDAV 470

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            +A     +S+ L I+ D        +   FV + +
Sbjct: 471 KRA----GNSLALLIQRD--------DAQIFVPVDL 494


>gi|85860823|ref|YP_463025.1| endopeptidase [Syntrophus aciditrophicus SB]
 gi|85723914|gb|ABC78857.1| endopeptidase [Syntrophus aciditrophicus SB]
          Length = 494

 Score =  208 bits (529), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 144/502 (28%), Positives = 241/502 (48%), Gaps = 37/502 (7%)

Query: 1   MFKRQILSVKSICTV--ALTCVIFSSTYLVLEAKL-----PPSSVDLPPVIARVSPSIVS 53
           MF    L    + +V   L          V  A       P +      ++ R+ P++V+
Sbjct: 13  MFLLAFLVAFFVVSVIEVLRSSFAPVAPDVQVASAISPIDPRTPGSFADLVDRLKPAVVN 72

Query: 54  VMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYF--RKDFHKFFSGEEPILSDTVERLMFG 111
           +      +       + +      E  P + YF   + F +FF     +     ++   G
Sbjct: 73  ISTTKTIRSGSNPFSSPFSG----EGSPFERYFWGDEFFDRFFGD---VPKREFKKKSLG 125

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGF I+ DGYI T+NH+VE      V LSD  E  A+++G DA  D+A++K++       
Sbjct: 126 SGFIISHDGYIFTNNHVVEQADKILVKLSDGKEFEARVIGKDAKTDIALIKIKPTVSLPV 185

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNS 230
           VE  D++ +RVGE V  IGNPF L  TV+AGIVSA  R I   P   F Q DA IN GNS
Sbjct: 186 VEIGDSDKLRVGEWVLAIGNPFGLEQTVTAGIVSAKGRVIGAGPYDNFIQTDASINPGNS 245

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP F+  G VIG+N  IV       G+G  IP+++ K  +P L +KG+V  GW G+  Q
Sbjct: 246 GGPLFSMDGQVIGINTAIVAQ---GQGIGFAIPVNMAKNILPDLKTKGKVSRGWLGVSVQ 302

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
           ++T+++A  +  +  +G+L+  V K  PA  AG+K GD+I  ++G+ + +  + +  IA+
Sbjct: 303 DITEDIAKSMKQKDRQGALVAEVFKGDPASNAGIKPGDIITEINGKTVINSHELLLMIAN 362

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKK--- 407
               +++ I+L +     +V V++    T + +       ++  GMV+ DI     +   
Sbjct: 363 FHVGDRINITLLRGNRPMNVNVLVAER-TDRGEYAARKTSRDDYGMVVHDITPEIAQYLG 421

Query: 408 ---LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
                 ++  +       +  GIQ    I+ VN  +++  KD  + +   +++ + ++LL
Sbjct: 422 LSSRTGVIVTDVREGSPADDVGIQPQDVILQVNRAKIASKKDYLKELS--RKEAKQNLLL 479

Query: 465 QIKYDPDMQSGNDNMSRFVSLK 486
            +K              FV+L+
Sbjct: 480 LVKRGQSTF--------FVALQ 493


>gi|53725066|ref|YP_102134.1| serine protease [Burkholderia mallei ATCC 23344]
 gi|76809376|ref|YP_332425.1| serine protease [Burkholderia pseudomallei 1710b]
 gi|126441871|ref|YP_001057899.1| serine protease [Burkholderia pseudomallei 668]
 gi|126453300|ref|YP_001065134.1| serine protease [Burkholderia pseudomallei 1106a]
 gi|134279636|ref|ZP_01766348.1| serine protease [Burkholderia pseudomallei 305]
 gi|167718317|ref|ZP_02401553.1| serine protease [Burkholderia pseudomallei DM98]
 gi|167822952|ref|ZP_02454423.1| serine protease [Burkholderia pseudomallei 9]
 gi|167844520|ref|ZP_02470028.1| serine protease [Burkholderia pseudomallei B7210]
 gi|217419835|ref|ZP_03451341.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei 576]
 gi|226199431|ref|ZP_03794989.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei Pakistan 9]
 gi|237811049|ref|YP_002895500.1| serine protease [Burkholderia pseudomallei MSHR346]
 gi|242316263|ref|ZP_04815279.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei 1106b]
 gi|254258688|ref|ZP_04949742.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei 1710a]
 gi|254296319|ref|ZP_04963776.1| serine protease [Burkholderia pseudomallei 406e]
 gi|52428489|gb|AAU49082.1| serine protease [Burkholderia mallei ATCC 23344]
 gi|76578829|gb|ABA48304.1| serine protease [Burkholderia pseudomallei 1710b]
 gi|126221364|gb|ABN84870.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei 668]
 gi|126226942|gb|ABN90482.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei 1106a]
 gi|134248836|gb|EBA48918.1| serine protease [Burkholderia pseudomallei 305]
 gi|157805678|gb|EDO82848.1| serine protease [Burkholderia pseudomallei 406e]
 gi|217397139|gb|EEC37155.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei 576]
 gi|225928507|gb|EEH24536.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei Pakistan 9]
 gi|237505290|gb|ACQ97608.1| serine protease [Burkholderia pseudomallei MSHR346]
 gi|242139502|gb|EES25904.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei 1106b]
 gi|254217377|gb|EET06761.1| periplasmic serine protease, Do/DeqQ family [Burkholderia
           pseudomallei 1710a]
          Length = 495

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 131/456 (28%), Positives = 220/456 (48%), Gaps = 21/456 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFS 95
            D   ++    P++V++  +   + + ++   A     +  D P   +FR  + +     
Sbjct: 54  PDFSGLVETYGPAVVNISAKHVVQRAAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMG 111

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
           G      D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG D  
Sbjct: 112 GGRQPQPDDQPSTSLGSGFIISADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQ 171

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD  
Sbjct: 172 SDVAVLKIDASGL-PIVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDEN 230

Query: 216 GT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
            T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L
Sbjct: 231 YTPFIQTDVPVNPGNSGGPLFNLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDEL 290

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           +  G V  G  G+  Q L Q LA   GL+   G+L+++V  + PA KAG++ GDVI  +D
Sbjct: 291 VKTGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVD 350

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKEL 393
           G  ++       QIA   P  +  + + ++ S+ +V+V L S    +      E  ++  
Sbjct: 351 GVPVQDSSTLPAQIAGMKPGTKADLQIWRDKSRKTVSVTLASLADDQAKAGADEPVEQGR 410

Query: 394 LGMVLQDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           LG+ ++ ++   +    +      ++      + GIQ G  I++VN   V+  + +   +
Sbjct: 411 LGVAVRPLSPRERNGSSLTHGLVVQQSAGPAASAGIQPGDVILAVNGRPVTSAEQLRDAV 470

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            +A     +S+ L I+ D        +   FV + +
Sbjct: 471 KRA----GNSLALLIQRD--------DAQIFVPVDL 494


>gi|254181600|ref|ZP_04888197.1| serine protease [Burkholderia pseudomallei 1655]
 gi|254203814|ref|ZP_04910174.1| serine protease [Burkholderia mallei FMH]
 gi|254360155|ref|ZP_04976425.1| serine protease [Burkholderia mallei 2002721280]
 gi|147745326|gb|EDK52406.1| serine protease [Burkholderia mallei FMH]
 gi|148029395|gb|EDK87300.1| serine protease [Burkholderia mallei 2002721280]
 gi|184212138|gb|EDU09181.1| serine protease [Burkholderia pseudomallei 1655]
          Length = 472

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 131/456 (28%), Positives = 220/456 (48%), Gaps = 21/456 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFS 95
            D   ++    P++V++  +   + + ++   A     +  D P   +FR  + +     
Sbjct: 31  PDFSGLVETYGPAVVNISAKHVVQRAAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMG 88

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
           G      D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG D  
Sbjct: 89  GGRQPQPDDQPSTSLGSGFIISADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQ 148

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD  
Sbjct: 149 SDVAVLKIDASGL-PIVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDEN 207

Query: 216 GT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
            T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L
Sbjct: 208 YTPFIQTDVPVNPGNSGGPLFNLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDEL 267

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           +  G V  G  G+  Q L Q LA   GL+   G+L+++V  + PA KAG++ GDVI  +D
Sbjct: 268 VKTGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVD 327

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKEL 393
           G  ++       QIA   P  +  + + ++ S+ +V+V L S    +      E  ++  
Sbjct: 328 GVPVQDSSTLPAQIAGMKPGTKADLQIWRDKSRKTVSVTLASLADDQAKAGADEPVEQGR 387

Query: 394 LGMVLQDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           LG+ ++ ++   +    +      ++      + GIQ G  I++VN   V+  + +   +
Sbjct: 388 LGVAVRPLSPRERNGSSLTHGLVVQQSAGPAASAGIQPGDVILAVNGRPVTSAEQLRDAV 447

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            +A     +S+ L I+ D        +   FV + +
Sbjct: 448 KRA----GNSLALLIQRD--------DAQIFVPVDL 471


>gi|53718447|ref|YP_107433.1| peptidase [Burkholderia pseudomallei K96243]
 gi|52208861|emb|CAH34800.1| subfamily S1C unassigned peptidase [Burkholderia pseudomallei
           K96243]
          Length = 472

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 131/456 (28%), Positives = 221/456 (48%), Gaps = 21/456 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFS 95
            D   ++    P++V++  +   + + ++   A     +  D P   +FR  + +     
Sbjct: 31  PDFSGLVETYGPAVVNISAKHVVQRAAQR--RAAPQLPIDPDDPFYQFFRHFYGQIPGMG 88

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
           G      D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG D  
Sbjct: 89  GGRQPQPDDQPSTSLGSGFIISADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQ 148

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD  
Sbjct: 149 SDVAVLKIDASGL-PIVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDEN 207

Query: 216 GT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
            T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L
Sbjct: 208 YTPFIQTDVPVNPGNSGGPLFNLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDEL 267

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           +  G V  G  G+  Q L Q LA   GL+   G+L+++V  + PA KAG++ GDVI  +D
Sbjct: 268 VKTGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVD 327

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKEL 393
           G  ++       QIA   P  +  + + ++ S+ +V+V L S    +    + E  ++  
Sbjct: 328 GVPVQDSSTLPAQIAGMKPGTKADLQIWRDKSRKTVSVTLASLADDQAKAGVDEPVEQGR 387

Query: 394 LGMVLQDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           LG+ ++ ++   +    +      ++      + GIQ G  I++VN   V+  + +   +
Sbjct: 388 LGVAVRPLSPRERNGSSLTHGLVVQQSAGPAASAGIQPGDVILAVNGRPVTSAEQLRDAV 447

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            +A     +S+ L I+ D        +   FV + +
Sbjct: 448 KRA----GNSLALLIQRD--------DAQIFVPVDL 471


>gi|222148025|ref|YP_002548982.1| serine protease DO-like protease [Agrobacterium vitis S4]
 gi|221735013|gb|ACM35976.1| serine protease DO-like protease [Agrobacterium vitis S4]
          Length = 491

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 167/502 (33%), Positives = 257/502 (51%), Gaps = 39/502 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           +    V  +           P       +++ VSP++VS+ V+   + + E   N    G
Sbjct: 1   MLAGAVTVTPALAAPVEVQAPQVPSFADLVSAVSPAVVSIRVKSDVQQASEDGSNFSFNG 60

Query: 75  NLPED--HPLKNYFRKDFHKFFSGEEPI----------LSDTVERLMFGSGFFITDDGYI 122
              +    PLK +F++       G                  +  +  GSGFFI++DGY+
Sbjct: 61  RDFDQLPDPLKRFFKEWGMPGPGGPGGPGGPKGGPHAERHGKLRPIAQGSGFFISEDGYV 120

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANNIR 181
           +T+NH+V DG +++V+++D TE  AKLVG D   DLAVLKV    +KF  VE+     IR
Sbjct: 121 VTNNHVVSDGQAYTVVMNDGTEYDAKLVGKDPRTDLAVLKVDQPTKKFTYVEWAQDEKIR 180

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGH 240
           VG+ V  +GNPF L GTV++GIVSA  RDI   P   + QIDAP+N+GNSGGP FN  G 
Sbjct: 181 VGDWVVAVGNPFGLGGTVTSGIVSAFGRDIGSGPYDDYIQIDAPVNRGNSGGPDFNLSGK 240

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           V+G+N  I +     +G+   IP +  K  +  LI  G V  GW G+  Q +T+++A  L
Sbjct: 241 VVGINTAIFSPSGGSVGIAFAIPAATAKDVVAELIKHGSVQRGWLGVQIQPVTKDIAESL 300

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL   KG+L+      SP +KAG+K GDVI  ++G  +K  +D   +IA+  P  +V IS
Sbjct: 301 GLADAKGALVAEPQTGSPGEKAGIKQGDVITAVNGDPVKDPRDLAKRIAAFPPNTKVDIS 360

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL-------------LGMVLQDINDGNKK 407
           + + G   +V V LG+ P  K+    +                   LG+ +Q  +DG   
Sbjct: 361 IWRNGKPTAVKVDLGTLPAEKDTASSDEDQGAPEQNAPATEQALANLGVTVQRADDGK-- 418

Query: 408 LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              +   N + + +   KG++ G  I SVN  +VS   +V++++ +AK+  R   L Q++
Sbjct: 419 --GLTITNVDPDSDAADKGLKTGQKITSVNNQQVSSAAEVKKILDQAKKDGRTKALFQVE 476

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
                    DN SRF++L I++
Sbjct: 477 --------TDNGSRFIALPINQ 490


>gi|190891004|ref|YP_001977546.1| serine protease Do protein [Rhizobium etli CIAT 652]
 gi|190696283|gb|ACE90368.1| serine protease Do protein [Rhizobium etli CIAT 652]
          Length = 532

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 178/523 (34%), Positives = 264/523 (50%), Gaps = 54/523 (10%)

Query: 8   SVKSICTVALTCVIFSS---TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           +V  I    L   +      +Y        P+      V+  VSP++VSV VE +     
Sbjct: 19  TVAGIAAAVLATGVPLEITRSYAEAVKVQAPAVPSFANVVDAVSPAVVSVRVENRVNPVA 78

Query: 65  EQM------FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------------- 105
           +        FN  GF +LP+DHPLK +FR+        +                     
Sbjct: 79  DNNDGFAFDFNGRGFDDLPDDHPLKRFFRQFGQDPNDQQGHQRRFGQNGPGGPGGPNAPG 138

Query: 106 -----ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                  +  GSGFFI++DGYI+T+NH+V DG +F  +++D TEL AKL+G D   DLAV
Sbjct: 139 GKGRLRPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAVMNDGTELDAKLIGKDPRTDLAV 198

Query: 161 LKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-F 218
           LKV    +KF  V + D NN+RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   +
Sbjct: 199 LKVDGKGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDY 258

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            Q+DA +N+GNSGGP FN  G V+G+N  I +     +G+   IP S  K  +  L+  G
Sbjct: 259 LQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSVGIAFAIPASTAKDVVADLMKDG 318

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
           +V  GW G+  Q +T+++A  +GL    G+L+ A    SP DKAGMK GDV+  L+G  I
Sbjct: 319 QVSRGWLGVQIQPVTKDIAESIGLSEPSGALVVAPQAGSPGDKAGMKAGDVVTALNGETI 378

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----- 393
           K  +D   +I +  P  + ++S+ + G   S+ V LG+ P  + + + +   +       
Sbjct: 379 KDARDLSRRIGAMQPGSKAELSVWRAGKAQSLTVELGTLPADQKEANADDNSQPQQPEAP 438

Query: 394 --------LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
                   LG+ +   +DG      +     + + +   KGI++G  I SVN  EVS   
Sbjct: 439 ASEKALADLGLTVGPSDDGK----GLAITGIDPDSDAADKGIKEGEKITSVNNQEVSTPA 494

Query: 446 DVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           DV +++ +AK+  R   L QI+        +   SRFV+L I+
Sbjct: 495 DVVKVLNQAKKDGRTRALFQIQ--------SSEGSRFVALPIN 529


>gi|327193946|gb|EGE60821.1| serine protease Do protein [Rhizobium etli CNPAF512]
          Length = 549

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 178/523 (34%), Positives = 264/523 (50%), Gaps = 54/523 (10%)

Query: 8   SVKSICTVALTCVIFSS---TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           +V  I    L   +      +Y        P+      V+  VSP++VSV VE +     
Sbjct: 36  TVAGIAAAVLATGVPLEITRSYAEAVKVQAPAVPSFANVVDAVSPAVVSVRVENRVNPVA 95

Query: 65  EQM------FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------------- 105
           +        FN  GF +LP+DHPLK +FR+        +                     
Sbjct: 96  DNNDGFAFDFNGRGFDDLPDDHPLKRFFRQFGQDPNDQQGHQRRFGQNGPGGPGGPNGPG 155

Query: 106 -----ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                  +  GSGFFI++DGYI+T+NH+V DG +F  +++D TEL AKL+G D   DLAV
Sbjct: 156 GKGRLRPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAVMNDGTELDAKLIGKDPRTDLAV 215

Query: 161 LKVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-F 218
           LKV    +KF  V + D NN+RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   +
Sbjct: 216 LKVDGKGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDY 275

Query: 219 TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKG 278
            Q+DA +N+GNSGGP FN  G V+G+N  I +     +G+   IP S  K  +  L+  G
Sbjct: 276 LQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSVGIAFAIPASTAKDVVADLMKDG 335

Query: 279 RVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII 338
           +V  GW G+  Q +T+++A  +GL    G+L+ A    SP DKAGMK GDV+  L+G  I
Sbjct: 336 QVSRGWLGVQIQPVTKDIAESIGLSEPSGALVVAPQAGSPGDKAGMKAGDVVTALNGETI 395

Query: 339 KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----- 393
           K  +D   +I +  P  + ++S+ + G   S+ V LG+ P  + + + +   +       
Sbjct: 396 KDARDLSRRIGAMQPGSKAELSVWRAGKAQSLTVELGTLPADQKEANADDNSQPQQPEAP 455

Query: 394 --------LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
                   LG+ +   +DG      +     + + +   KGI++G  I SVN  EVS   
Sbjct: 456 ASEKALADLGLTVGPSDDGK----GLAITGIDPDSDAADKGIKEGEKITSVNNQEVSTPA 511

Query: 446 DVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           DV +++ +AK+  R   L QI+        +   SRFV+L I+
Sbjct: 512 DVVKVLNQAKKDGRTRALFQIQ--------SSEGSRFVALPIN 546


>gi|192293411|ref|YP_001994016.1| protease Do [Rhodopseudomonas palustris TIE-1]
 gi|192287160|gb|ACF03541.1| protease Do [Rhodopseudomonas palustris TIE-1]
          Length = 520

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 159/512 (31%), Positives = 245/512 (47%), Gaps = 36/512 (7%)

Query: 4   RQILSVKSICTVA----LTCVIFSSTYLVLEAKLP-------------PSSVDLPPVIAR 46
           R++L  + +  +A    L+ V+       L  ++P             P+      ++ +
Sbjct: 18  RKVLRPRRLSLLASAAGLSMVVALGGAGFLTREMPSLTSPAYAAENGKPAPAGFGDLVDK 77

Query: 47  VSPSIVSVMVEPKKKVSVEQMFNAYGFG---NLPEDHPLKNYFRKDFHKFFSGEEPILSD 103
           V P+++SV V+         +    G G     P        F + F   F G E +   
Sbjct: 78  VKPAVISVRVKIDDDRQTTPLVRDDGDGDQMQTPRGLAPFQQFERQFG--FRGPEGMPKR 135

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
                  GSGFFIT DGY +T+NH+V+   S  V   D T   AK+VGTD   DLA++KV
Sbjct: 136 HQMITGEGSGFFITADGYAVTNNHVVDHAKSVQVTTDDGTIYTAKVVGTDDKTDLALIKV 195

Query: 164 QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQID 222
                F  V        RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + QID
Sbjct: 196 DGKTDFPHV-NFADAPARVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYVQID 254

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
           APIN+GNSGGP F+  G+VIGVN  I +     +G+G  IP +  K  +  L  KG V  
Sbjct: 255 APINKGNSGGPAFDTNGNVIGVNTAIYSPSGGSVGIGFDIPAATAKLVVSQLKDKGYVTR 314

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           GW G+  Q +T E+A  LG++  +G+L+ +    SPA KAG+K GDVI  +DG+ +K  +
Sbjct: 315 GWLGVQVQPVTAEIADSLGMKQARGALVDSPQDGSPAAKAGIKAGDVITAVDGKEVKDSR 374

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----ELLGMVL 398
                I++ +P   VK+ +   G   ++ + L   P     +    GD+      LG+ +
Sbjct: 375 ALARTISTLAPGSSVKLDVLHNGQSKTMDLTLAEMPGDHQKVADSSGDRDATRPYLGLRV 434

Query: 399 QDIND-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK 457
              ++        +V    + +     KG++ G  I+ V    V+   DV   + +A + 
Sbjct: 435 APASEVDGAGKNGVVVTGVDPDGPAADKGLRTGDVILDVGGKAVTNTGDVRNALTQAGKD 494

Query: 458 KRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            + +VL+++K         D+ +RFV++ I K
Sbjct: 495 GKKTVLMRVK-------TADSAARFVAVPIAK 519


>gi|153009127|ref|YP_001370342.1| protease Do [Ochrobactrum anthropi ATCC 49188]
 gi|151561015|gb|ABS14513.1| protease Do [Ochrobactrum anthropi ATCC 49188]
          Length = 520

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 143/526 (27%), Positives = 237/526 (45%), Gaps = 53/526 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  + +   +   T   + A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMTVAGTLSVGTPPAIAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +   A     +PE  P + YF+  F      +     ++ +    GSGF I  + G
Sbjct: 66  EDG-EGDGAVPMPQVPEGSPFQEYFKDFFGDKGGAQG---DESRKVQSLGSGFVIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           +I+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   VEF ++  
Sbjct: 122 FIVTNNHVIADADEIEVNFNDGSKLKAELVGKDIKTDLAILKVDPSKHKLKAVEFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAVGVIDQLKEFGEVRRGWLGVRIQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+  KG+LI  +++ S  D   ++ GDV+   +G+ + + +D    +A     + V+
Sbjct: 302 SLGLKEAKGALIAGLIENSGVDNKAIEAGDVVIRYEGKPVDTARDLPRLVAETPVGKDVE 361

Query: 359 ISLCKEGSKHSVAVVLGSS-----------------------------PTAKNDMHLEVG 389
           I + ++G + +V V LG                               P           
Sbjct: 362 IVVVRQGEEKTVKVKLGRLVEDDKSTEAATEDQAPLPEGEGGDEGAETPDTSKKEQKSDA 421

Query: 390 DKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVS 442
              +LGM L ++ND  +           +  L          K I+ G  IV +    V 
Sbjct: 422 APSVLGMKLSELNDDVRGEFGIAEDVEGVAVLYVAPGSAAGEKRIETGDVIVDIGQVNVK 481

Query: 443 CIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             +DV++ I   + + R + L+       M +      RFV+++I+
Sbjct: 482 TPEDVKKRIDALRREGRKNALM-------MLASRSGELRFVTVRIN 520


>gi|241203611|ref|YP_002974707.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857501|gb|ACS55168.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 500

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 144/492 (29%), Positives = 243/492 (49%), Gaps = 40/492 (8%)

Query: 16  ALTCVIFSSTYLVLEA---KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
            L   + +S  +   +    +   +     ++    P++V++    K             
Sbjct: 24  CLPLALNASNAVAAPSDNGGILAPNGSFASIVEADKPAVVTITTTMKATDVSAD------ 77

Query: 73  FGNLPEDHPLKNYFRKDFHKFF---SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                ++ P+   FR+ F         + P    + + +  GSGF I+ DG I+T+NH++
Sbjct: 78  -----QESPMDEQFRQFFEDQGIPLPRQAPQKRPSQQAMALGSGFIISRDGVIVTNNHVI 132

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           ++     V L D TELPAKL+GTD   D+AVLK+++ +    + + D++ +++G+ +  I
Sbjct: 133 DNAVDIKVTLDDGTELPAKLIGTDPKSDVAVLKIEAGKPLQTIAWGDSDRLKLGDQILAI 192

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G+V+G+N  I
Sbjct: 193 GNPFGIGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDRSGNVVGINTAI 252

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     +GVG  IP    K  +  L   G +DHG+ G+  Q +T+++A  +GL  T G+
Sbjct: 253 YSPNGGSVGVGFAIPSDEAKAIVAKLQKDGSIDHGYLGVQIQPVTKDVADAVGLDKTGGA 312

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+ AV  ++PA  AG+K GD++  + G  +K+ +D    +A  SP  +  +S+ ++G   
Sbjct: 313 LVAAVTADTPAAHAGLKPGDIVTSVGGESVKTPKDLSRLVADLSPGAKKSLSVWRDGKTI 372

Query: 369 SVAVVLGSSPTAK-------NDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVAL 414
            + V +G++   +        D   +   +  LG+ L D+    ++ +         V  
Sbjct: 373 DLNVTVGTNEEGQKQAAAESPDAQDQSSGQPSLGIGLADLTPDVRQQLNLPRSINGAVVA 432

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
               ++   A GIQ G  IVSVN   V   +DV+  I  A +  R SVLL ++ D +   
Sbjct: 433 KVAPDKSAAAAGIQSGDVIVSVNDRPVHNARDVKTAIADAGKAGRKSVLLLVERDGNKT- 491

Query: 475 GNDNMSRFVSLK 486
                  FV++ 
Sbjct: 492 -------FVAVP 496


>gi|167585591|ref|ZP_02377979.1| protease Do [Burkholderia ubonensis Bu]
          Length = 494

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 133/454 (29%), Positives = 215/454 (47%), Gaps = 19/454 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K +  +M        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQTARRMQQPQL--PIDPSDPFYQFFKHFYGQMPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIISADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDAGGL-PIVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLKGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL    G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLPKPDGALVSSVDPSGPAAKAGLQPGDVILAVNGM 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH-LEVGDKELLG 395
            +        QIAS  P  +  + + ++ +K +V+V LGS    K   +     ++  LG
Sbjct: 352 PVADSTTLPSQIASFKPGSKADLQIWRDKAKKTVSVTLGSMADTKVASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ ++   +   R+    L         + GIQ G  I++VN   V+  + +   +  
Sbjct: 412 VAVRPLSPQERGATRLSHGLLVQQAGGPAASAGIQPGDVILAVNGRPVTSPEQLRDAVKG 471

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 472 A----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|116251018|ref|YP_766856.1| serine protease [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255666|emb|CAK06747.1| putative serine protease [Rhizobium leguminosarum bv. viciae 3841]
          Length = 501

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 146/492 (29%), Positives = 245/492 (49%), Gaps = 39/492 (7%)

Query: 16  ALTCVIFSSTYLVLEA---KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
            L   I++S  +   +    +   S     ++    P++V++    K             
Sbjct: 24  CLPFAIYASNAVAAPSDTGGILAPSGSFASIVDADKPAVVTITTTMKATDVSAGE----- 78

Query: 73  FGNLPEDHPLKNYFRKDFHKFF---SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
                ++ P+   FR+ F         + P    + + +  GSGF I+ DG I+T+NH++
Sbjct: 79  -----QESPMDEQFRQFFEDQGIPLPRQAPKSRPSQQAMALGSGFIISPDGVIVTNNHVI 133

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           ++     V L D TELPAKL+GTD   D+AVLK+++ +    + + D++ +++G+ +  I
Sbjct: 134 DNAVDIKVTLDDGTELPAKLIGTDPKSDVAVLKIEAGKPLQTIAWGDSDRLKLGDQILAI 193

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G+V+G+N  I
Sbjct: 194 GNPFGIGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDRSGNVVGINTAI 253

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     +GVG  IP    K  +  L   G +DHG+ G+  Q +T+++A  +GL  T G+
Sbjct: 254 YSPNGGSVGVGFAIPSDEAKAIVAKLQKDGSIDHGYLGVQIQPVTKDVADAVGLDKTGGA 313

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+ AV  ++PA  AG+K GD++  + G  +K+ +D    +A  SP  +  +S+ ++G   
Sbjct: 314 LVAAVTADTPAAHAGLKPGDIVTSVGGEAVKTPKDLSRLVADLSPGAKKSLSVWRDGKTI 373

Query: 369 SVAVVLGSSPTAK-------NDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVAL 414
            + V +G++  ++        D   +   +  LG+ L D+    ++ +         V  
Sbjct: 374 DLNVTVGTNEESQKQAAAENPDAQGQSTGQPSLGIGLADLTPDVRQELNLPRSISGAVVA 433

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
               ++   A GIQ G  IVSVN   V   +DV+  I  A +  R SVLL ++ D +   
Sbjct: 434 KVAPDKSAAAAGIQSGDVIVSVNDRPVHNARDVKTAIADAGKAGRKSVLLLVERDGNKT- 492

Query: 475 GNDNMSRFVSLK 486
                  FV++ 
Sbjct: 493 -------FVAVP 497


>gi|15965874|ref|NP_386227.1| putative protease precursor signal peptide protein [Sinorhizobium
           meliloti 1021]
 gi|307309631|ref|ZP_07589284.1| protease Do [Sinorhizobium meliloti BL225C]
 gi|307321770|ref|ZP_07601158.1| protease Do [Sinorhizobium meliloti AK83]
 gi|15075143|emb|CAC46700.1| Probable serine protease [Sinorhizobium meliloti 1021]
 gi|306892592|gb|EFN23390.1| protease Do [Sinorhizobium meliloti AK83]
 gi|306899966|gb|EFN30588.1| protease Do [Sinorhizobium meliloti BL225C]
          Length = 503

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 134/519 (25%), Positives = 233/519 (44%), Gaps = 47/519 (9%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEA--KLPPSSVDLPPVIARVSPSIVSVMVEP 58
           M KR     + +   A T +IF++  L   A  + P     +  +   +  ++V++ +  
Sbjct: 1   MSKRPEF-FRGLVLAAATALIFTNATLAQTATSRPPAGPPSVADLAEGLLDAVVNISISQ 59

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
             K       +      +PE  P + +F + F     G+             GSGF I  
Sbjct: 60  NVK----SDDDNAPMPQVPEGSPHQEFFDEFFR----GQGGEGGRPRTVNSLGSGFIIDP 111

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
            GYI+T+NH+++D     +  SD ++L AKLVG D   DLA+LKV+  +    V F D+ 
Sbjct: 112 AGYIVTNNHVIQDADDIEINFSDGSKLKAKLVGMDTKTDLALLKVEPKKPLKAVSFGDSR 171

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNA 237
            IR+G+ V  +GNPF L  +VS G+VSA  R+I   P   F Q DA IN+GNSGGP FN 
Sbjct: 172 KIRIGDWVMVVGNPFGLGVSVSVGVVSARGRNINAGPYDSFIQTDAAINRGNSGGPLFNM 231

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G V+G+N  I++     +G+G  +P  +    +  L   G    GW G+  Q +T ++A
Sbjct: 232 QGEVVGINTAILSQTGMSVGIGFAVPAELAVNVVNQLKEFGETRRGWLGVRIQPVTDDIA 291

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
             L +   +G+L++ +++  P  K  +K GD+I   DG  I   +D +  +      + V
Sbjct: 292 ESLKMELPRGALVSGIIEGGPITKGEIKPGDIIIRFDGTDIAEIRDLMRTVGESPVGKAV 351

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK---------------------ELLGM 396
            + + ++G + +V V LG     +   + + G+                       +LGM
Sbjct: 352 DVVIIRDGKEQTVRVTLGRLEDGEQLANAKPGEVLPNGGEAKPGEPPAAQLPASDTVLGM 411

Query: 397 VLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
            L +++  +++          +V            + ++ G  IV +    +   +DV  
Sbjct: 412 KLAELDADSRQSFGIAESVKGVVITEVQPNSPAAERRVEPGEVIVELGQEAMETPEDVTS 471

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            + + K   R + LL I       +      RFV+++++
Sbjct: 472 RVTELKADGRRNALLMI-------ANKSGELRFVTVRME 503


>gi|323139002|ref|ZP_08074062.1| protease Do [Methylocystis sp. ATCC 49242]
 gi|322395756|gb|EFX98297.1| protease Do [Methylocystis sp. ATCC 49242]
          Length = 498

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 134/498 (26%), Positives = 228/498 (45%), Gaps = 30/498 (6%)

Query: 14  TVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV-SVEQMFNAYG 72
                    S+ +L            L  + A+VS ++V++      +    +       
Sbjct: 8   AARFALATASALWLAAAPASAKGPDSLSELSAQVSDAVVNISATQTVETKRGKGGDMPGL 67

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
              +    P  + F + F +     +  P +    +    GSGF I   G ++T+NH++ 
Sbjct: 68  PPGMGPGGPFDDLFEEFFKRRQGQGQGMPDMPRQRKSSSLGSGFVIDPSGIVITNNHVIA 127

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIG 190
           D    +VI +D  +L A+++G D   D+AVLKV+ ++    V+F D++  +VG+ V  +G
Sbjct: 128 DANEVTVIFNDGQKLKAEVLGKDQKVDVAVLKVKPEKPLKAVKFGDSDKAKVGDWVLAVG 187

Query: 191 NPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           NPF L G+V+AGIVSA +R+I   P   + Q DA IN+GNSGGP FN  G VIG+N  I+
Sbjct: 188 NPFGLGGSVTAGIVSARNRNIDSGPYDNYIQTDASINKGNSGGPLFNMDGEVIGINTAIL 247

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +     +G+G   P + ++  I  L   G    GW G+  QN+   +A  L L  T+G+L
Sbjct: 248 SPSGGSVGIGFATPANTVQPVIEQLQQFGETRRGWLGVRIQNVDDAIAETLNLGATRGAL 307

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +  V  + P+  AG+K GDVI   DG+ IK  +D    +A+    + V++ + + G + S
Sbjct: 308 VAGVDDKGPSKPAGLKAGDVIIKFDGKPIKESRDLPKLVAATPVGKDVELVIVRGGKEQS 367

Query: 370 VAVVLGSSPTAKNDMHLEVGDKEL-----------LGMVLQDINDGNKKLV--------R 410
             V LG     +     + GDK+            LG+ L  + D  +            
Sbjct: 368 KTVKLGRLEDGEKVASRDAGDKDKPDTSGPSSQTTLGLELSRLTDELRARFQIKDTVKSG 427

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
           ++    +   +   K +Q G  ++ VN   V+   D  + I   K+  + + LL +    
Sbjct: 428 VLITAVDPRSDAAEKRLQAGEILLEVNQEAVNDPADAVKKIKALKDAGKKTALLIVANG- 486

Query: 471 DMQSGNDNMSRFVSLKID 488
                    + FV+L ++
Sbjct: 487 ------QGDAHFVALPVE 498


>gi|328952747|ref|YP_004370081.1| protease Do [Desulfobacca acetoxidans DSM 11109]
 gi|328453071|gb|AEB08900.1| protease Do [Desulfobacca acetoxidans DSM 11109]
          Length = 483

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 143/504 (28%), Positives = 237/504 (47%), Gaps = 37/504 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPP--SSVDLPPVIARVSPSIVSVMVEP 58
           M  RQ+ ++  I  +A    I + T L + A      +      +  ++SP++V++  E 
Sbjct: 1   MLTRQLHAIL-ILILAFGGFIATPTLLAVPAAAQGTLAPDSFAVLAKQISPAVVNISTEK 59

Query: 59  KKKVSV--EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI 116
             K S    +M    G      D P K++F K F          +    +    G+GF +
Sbjct: 60  VMKRSTPTRRMPGMPGPSPFGPDDPFKDFFEKFFGD--------MPKEFKSRSLGTGFIL 111

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF-IPVEFE 175
             +G+I+T+NH+VE      V L D  E  A + G DA+ D+A++K++S       +   
Sbjct: 112 DREGFIITNNHVVEGADKIKVKLVDGREFKANIKGRDAMTDMALIKIESPTHDLPVLVMG 171

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPC 234
           D++ ++VG+ V  +GNPF L  TV+ GI+SA  R I   P   F Q DA IN GNSGGP 
Sbjct: 172 DSDPVQVGDWVLAVGNPFGLSHTVTQGIISAKGRVIGAGPYDDFLQTDASINPGNSGGPL 231

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
            N  G VIG+N  IV S     G+G  IP S+ K  I  L  KG V  G  G+  Q +T 
Sbjct: 232 VNLKGEVIGINTAIVAS---GQGIGFAIPSSMAKGIIAQLKQKGSVTRGILGVQIQTVTP 288

Query: 295 ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK 354
           ELA   GL+   G+L+  V   +PA KAG++ GDVI   +G +IK   +    +A  +P 
Sbjct: 289 ELAKSFGLKEPVGALVAEVNPNTPAAKAGIQRGDVIIEYNGHVIKEMHELPRLVAHTAPG 348

Query: 355 EQVKISLCKEGSKHSVAVVLGSSPT---AKNDMHLEVGDKELLGMVLQDINDGNKKLV-- 409
            +V + + ++G + +  + +        A++ M     +K  LG+++Q++     +    
Sbjct: 349 TKVNLKVLRQGKEKNFGLTIAEMKPEHLARSGMVEPETEKSSLGLLVQELTPQMAQRFQI 408

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                ++ +   +       GI+ G  I  +N+  +  +KD    I + K    D+V + 
Sbjct: 409 KETSGVIVVQVEQGSPASDSGIRPGDLIEEINSVAIQSLKDYHASISQLKAG--DAVRIL 466

Query: 466 IKYDPDMQSGNDNMSRFVSLKIDK 489
           IK            + +V +++ +
Sbjct: 467 IKRRGK--------TMYVVVEVPE 482


>gi|325275447|ref|ZP_08141378.1| protease Do [Pseudomonas sp. TJI-51]
 gi|324099423|gb|EGB97338.1| protease Do [Pseudomonas sp. TJI-51]
          Length = 467

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 134/484 (27%), Positives = 221/484 (45%), Gaps = 28/484 (5%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           +           L A+   +  D   ++ + SP++V++  + K                L
Sbjct: 1   MMVATVLMLGQALTAQADEALPDFTTLVEQASPAVVNISTKQKLPDRRVAQGQMPDLEGL 60

Query: 77  PEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
           P        FR+ F +    +   P      E +  GSGF I+ DGY+LT+NH+V D   
Sbjct: 61  PP------MFREFFERNMPQQPRSPRGDRQREAMSLGSGFIISSDGYVLTNNHVVADADE 114

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
             V LSD +EL AKL+GTD   D+A+LKV        V+  D+  ++VGE V  IG+PF 
Sbjct: 115 IIVRLSDRSELQAKLIGTDPRTDVALLKVDGKNL-PTVKLGDSEKLKVGEWVLAIGSPFG 173

Query: 195 LRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQ 253
              +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  G V+G+N+ I T   
Sbjct: 174 FDHSVTKGIVSAKGRTLPNDTYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQIFTRSG 233

Query: 254 FHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAV 313
             MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+  V
Sbjct: 234 GFMGLSFAIPIDVALDVSNQLKKDGKVSRGWLGVVIQEVNKDLAESFGLDKPAGALVAQV 293

Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373
           ++  PA K G++VGDVI  ++G+ I    D    + S    E+ K+ + + G + ++ V 
Sbjct: 294 LENGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGSLKDGEKAKLEIIRNGKRQTLDVA 353

Query: 374 LGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---RIVALNPNREREVEAK 425
           +G+ P    D+              LG+ + D+    KK +     V +   ++      
Sbjct: 354 VGAMPDDDADITAGADGSTERSSNRLGVAVADLTAEQKKSLELKGGVVIKEVQDGPAALI 413

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           G++ G  I  +N   +   K+   +  +  + +  S+ +               + F++ 
Sbjct: 414 GLRPGDVISHLNNQAIGSAKEFTEIAKELPKNRSVSMRVL----------RQGRASFITF 463

Query: 486 KIDK 489
           K+ +
Sbjct: 464 KLAE 467


>gi|13474189|ref|NP_105757.1| serine protease [Mesorhizobium loti MAFF303099]
 gi|14024941|dbj|BAB51543.1| serine protease, HtrA/DegQ/DegS family [Mesorhizobium loti
           MAFF303099]
          Length = 513

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 150/517 (29%), Positives = 243/517 (47%), Gaps = 46/517 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLE--------------AKLPPSSVDLPPVIARV 47
            +R  ++      + ++ V+ S                     A +   +    P++A  
Sbjct: 7   LRRHRVAALLGAALIISPVVVSFAQSANSTGVSKIVATTQTPVAGITAPNGSFAPIVAAD 66

Query: 48  SPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVE 106
            P++V+V    K + + +      G      + P   YFR+ F        +        
Sbjct: 67  KPAVVTVTSIMKGQPASDDDGMPLG------NSPFDQYFRQFFGDQGMPAPQTPPQQAQR 120

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGF +T DG ++T+NH+V+  +S  V L D TELPAKLVG DA  DLAVLK++SD
Sbjct: 121 AEALGSGFIVTADGTVVTNNHVVDGASSIKVTLDDGTELPAKLVGRDAKNDLAVLKIKSD 180

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPI 225
           +    V++ D++ +  G+ V  IGNPF +  TV+AGIVSA  RD+   P   F QIDAPI
Sbjct: 181 KPLPTVKWGDSDRLMTGDQVLAIGNPFGIGTTVTAGIVSARGRDLHSGPFDDFIQIDAPI 240

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N GNSGGP  +  G+V+G+N  I +     +GVG  IP    +K +  L+  G + +G+ 
Sbjct: 241 NHGNSGGPLVDVNGNVVGINTAIYSPNGGSVGVGFAIPSDQAQKVVAKLMKDGSIQYGYL 300

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q +T ++A  +GL    G+L++ V   SPA  AG++ GDVI    G+ +K  +D  
Sbjct: 301 GVEIQEVTPDVASAIGLDHAGGALVSKVNDSSPAASAGVEAGDVITGFAGQDVKDPKDLS 360

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL---------EVGDKELLGM 396
             +A  +P  +  + + ++G    ++V +G +                  +      +G+
Sbjct: 361 RAVADVAPGAKETLDVWRKGKAMQISVEVGQNSDDVKTASAGESGAPSAEQGSRAPAIGL 420

Query: 397 VLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
            L DI    ++ +         V    N ++   A GIQ G  IV+VN   V   + V +
Sbjct: 421 GLMDITPDIRQEMNLAGNEHGAVVARVNPDKAAAAAGIQPGDIIVAVNQAPVKSARQVTQ 480

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            I +A +  R SVLL ++ D            +V++ 
Sbjct: 481 AIAQASKSGRKSVLLLVERDGGQ--------LYVAVP 509


>gi|241203811|ref|YP_002974907.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857701|gb|ACS55368.1| protease Do [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 527

 Score =  207 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 177/518 (34%), Positives = 262/518 (50%), Gaps = 49/518 (9%)

Query: 8   SVKSICTVALTCVIFSS---TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           +V  I    L   +      +Y        P+      V+  VSP++VSV VE +     
Sbjct: 19  TVAGIAAAVLATGVPLEITRSYAEAVKVQAPAVPSFANVVDAVSPAVVSVRVENRVNPVS 78

Query: 65  EQM-------FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------------ 105
           +         FN  GF +LP+DHPLK +F++        +                    
Sbjct: 79  DNNNDGFSFDFNGRGFDDLPDDHPLKRFFKQFGQDPNDQQGHSRRFGQNGPNGPGGKGRL 138

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
             +  GSGFFI++DGYI+T+NH+V DG +F  ++ D TEL AKL+G D   DLAVLKV  
Sbjct: 139 RPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAVMKDGTELDAKLIGKDPRTDLAVLKVDG 198

Query: 166 D-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDA 223
             +KF  V + D NN+RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + Q+DA
Sbjct: 199 KGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYLQVDA 258

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N+GNSGGP FN  G V+G+N  I +     +G+   IP S  K  +  L+  G+V  G
Sbjct: 259 AVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSVGIAFAIPASTAKDVVADLMKDGQVSRG 318

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           W G+  Q +T+++A  +GL    G+L+ A    SP DKAGMK GDV+  L+G  IK  +D
Sbjct: 319 WLGVQIQPVTKDIAESIGLSEPSGALVVAPQAGSPGDKAGMKAGDVVTALNGETIKDARD 378

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---------- 393
              +I +  P  +V++S+ + G    + V LG+ P  + D   +   +            
Sbjct: 379 LSRRIGAMQPGSKVELSVWRAGKAQPLTVELGTLPIDQKDASADDNSQPQQPEAPASEKA 438

Query: 394 ---LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
              LG+ +   +DG      +   + +   +   KGI++G  I SVN  EVS   D+ ++
Sbjct: 439 LADLGLTVGPSDDGK----GLAITDIDPNSDAADKGIKEGEKITSVNNQEVSSADDIVKV 494

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           + +AK+  R   L QI+        +   SRFV+L I+
Sbjct: 495 LNQAKKDGRTRALFQIQ--------SSEGSRFVALPIN 524


>gi|162146706|ref|YP_001601165.1| serine protease do-like [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543304|ref|YP_002275533.1| protease Do [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785281|emb|CAP54827.1| putative serine protease do-like precursor [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530981|gb|ACI50918.1| protease Do [Gluconacetobacter diazotrophicus PAl 5]
          Length = 535

 Score =  207 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 145/482 (30%), Positives = 226/482 (46%), Gaps = 37/482 (7%)

Query: 30  EAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA--------YGFGNLPEDHP 81
            A    +      + AR+ P++V+V      K   +   +             N PE  P
Sbjct: 61  PAPGRGAPDSFADLAARLLPAVVNVSTTETVKPGDQDGDSDGDGGGEDTPQVPNFPEGSP 120

Query: 82  LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSD 141
            + +F    ++    E        +    GSGF I   G ++T+NH+V      +V L D
Sbjct: 121 FEKFFHDFMNRQTGPEAAP----RKMQALGSGFIIDPSGIVVTNNHVVRHADQITVTLQD 176

Query: 142 DTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSA 201
           +T L A L+G D   DLAVLKV +      V F D+++ RVG+ V  IGNPF L GTV+A
Sbjct: 177 NTVLKAHLLGHDDRTDLAVLKVDAPHPLPAVPFGDSDHARVGDWVLAIGNPFGLSGTVTA 236

Query: 202 GIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGL 260
           GI+S+  R+I   P   F Q DAPIN+GNSGGP F+  G VIG+N  I +     +G+G 
Sbjct: 237 GIISSRGRNIEQGPYDDFIQTDAPINKGNSGGPLFDMQGQVIGINTAIYSPSGGSIGIGF 296

Query: 261 IIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPAD 320
            IP +  +  I  L   G+V  GW G+  Q++TQ++A  LGL+  +G+LI  +  + PA 
Sbjct: 297 SIPSAEARGIIDQLRRTGKVSRGWIGVRIQDVTQDIADGLGLKVARGALIAGIEPKGPAA 356

Query: 321 KAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA 380
            A ++ GDVI  LDG+ I   +     +A  SP   V + + + G   +V V +G+ P  
Sbjct: 357 AAKLQTGDVIQTLDGKEI-DGRALPRLMADESPGRVVSLGVWRHGHVLTVPVTVGALPEE 415

Query: 381 KNDMHLEVGDK--------ELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAK 425
             +                + +G  +  I+D  ++          +V      +     +
Sbjct: 416 AAEAPAPKPAATAQGNVQLQGMGFTVGAIDDVARQKYSLAEGQKGVVVTAVAADGPAADR 475

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           G++ G  I  V   EV+   D+ RL+  A+ + R SVL  ++        N +  R+V L
Sbjct: 476 GLRPGDVITEVQQSEVASPADLRRLVEAARAQHRRSVLFLVQ--------NGDGLRWVPL 527

Query: 486 KI 487
            +
Sbjct: 528 PL 529


>gi|299069916|emb|CBJ41200.1| periplasmic protease; contains two PDZ domain [Ralstonia
           solanacearum CMR15]
          Length = 490

 Score =  207 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 139/511 (27%), Positives = 224/511 (43%), Gaps = 47/511 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYL-------VLEAK--------------LPPSSVDL 40
             RQ ++  ++   A+  V     YL        + A                    +D 
Sbjct: 1   MTRQTMARSAVGLAAVLAVAGGYAYLQKDVMTRAVAAPLEAPATAQASAAPMAVAVPMDF 60

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
             ++ R  P++V++      + +  Q         +  D P   +FR+        + P 
Sbjct: 61  SAIVERYGPAVVNISTTAHAQRTSLQGLP----PGVSPDDPFAEFFRRFM-----PQTPQ 111

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF ++ DG ILT+ H+V+     SV L+D  E  AK++G D   D+AV
Sbjct: 112 QQGDQVVKGLGSGFIVSPDGLILTNAHVVDGAQEVSVKLTDRREFKAKVLGVDKQSDVAV 171

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFT 219
           L++ +      V+       +VGE V  IG+P+    TV+AGIVSA  R +PD     F 
Sbjct: 172 LRIAAGNL-PTVQIGSPAGTKVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYVPFI 230

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   +P+ +  K    L++ G+
Sbjct: 231 QTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAVPIDVAMKVEQQLVATGK 290

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  G  GI  Q + Q LA    L   +G+L+ AV K+ PA KAG++ GDVI  +    I 
Sbjct: 291 VTRGRLGISVQEVDQSLADSFNLPKPEGALVNAVEKDGPAAKAGLQPGDVILQIGDVHIG 350

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-DKELLGMVL 398
              D   Q+A   P   V + + + G   +++V +G +  AK   +     DK  LG+ +
Sbjct: 351 HSGDLPEQVAEIKPGSTVPLQIIRHGKPTALSVTVGEAKDAKVAANTSAAPDKGRLGLAV 410

Query: 399 QDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           + +    K+   +       +        GIQ G  I+S+N   VS  +++  L+ +A  
Sbjct: 411 RPLQPEEKRQSGLPGGLVVMDSSGPAAKAGIQPGDVILSLNGTPVSSAQELRALVDRA-- 468

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
                V L ++ D        +   FV L +
Sbjct: 469 --GKHVALLVQRD--------DAKIFVPLDL 489


>gi|304393599|ref|ZP_07375527.1| serine protease [Ahrensia sp. R2A130]
 gi|303294606|gb|EFL88978.1| serine protease [Ahrensia sp. R2A130]
          Length = 493

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 175/505 (34%), Positives = 257/505 (50%), Gaps = 35/505 (6%)

Query: 3   KRQILSVKSICTVALTCVIFS--------STYLVLEAKLPPSSVDLPPVIARVSPSIVSV 54
           ++  L    +  VALT    +          +        P +     V+  VSP++VSV
Sbjct: 5   RKTFL--GGVAAVALTGAFVAGGNVSLIQPVFAEAVKVEAPQAPSFADVVEAVSPAVVSV 62

Query: 55  MVEPKKKVSVE---QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFG 111
            V+   K +     Q     GFGNLPE HPL+ +F     +  +      S        G
Sbjct: 63  RVKASVKPASNDGNQRGFREGFGNLPEGHPLRRFFED--QQRANPRRDRRSPRNFGTSQG 120

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGFF++DDGY++T+NH+V +G  F+++++D  EL AK++GTD   DLAVLKV+   KF  
Sbjct: 121 SGFFVSDDGYVVTNNHVVANGDEFTIVMNDGVELDAKMIGTDPKTDLAVLKVERAEKFTY 180

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNS 230
           V+F      RVGE V  +GNPF L GTV+AGIVSA  RDI   P   F QIDA +N+GNS
Sbjct: 181 VDFAQ-GKSRVGEWVVAVGNPFGLGGTVTAGIVSAAGRDIGSGPYDDFLQIDAAVNKGNS 239

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP FN  G VIGVN  I +    ++G+   I     K+ +  LI +G V  GW G+  Q
Sbjct: 240 GGPAFNLRGEVIGVNTAIFSPSGGNVGIAFAISAKTSKEVVGDLIREGSVTRGWLGVAIQ 299

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            +++++A  LGL    G++++     SPADKAGM   DVI  +DG+ +K  +     IA+
Sbjct: 300 PVSEDIADSLGLDSATGAIVSEASPGSPADKAGMLSRDVIVAVDGKNVKDAKALSRMIAA 359

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM------HLEVGDKELLGMVLQDINDG 404
             P E VKI + + G K  + V LG+    K           E    EL    +  I D 
Sbjct: 360 YEPDEIVKIEVVRNGEKRVIDVTLGTLDQPKEAAAGSNSQPDEKSAIELSDFGMSIIPDE 419

Query: 405 NKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
           +     +   +  +      KG++ G  IVSVN  E   + DV + + +A E  R +VL 
Sbjct: 420 D----GVRVSSVEQNGAAAEKGLRVGDLIVSVNGKETRSVTDVGQAVAQAMEDDRKAVLF 475

Query: 465 QIKYDPDMQSGNDNMSRFVSLKIDK 489
           Q++        N+  +RF++L +++
Sbjct: 476 QLR--------NNERNRFIALPVNQ 492


>gi|206559394|ref|YP_002230155.1| serine protease MucD 2 [Burkholderia cenocepacia J2315]
 gi|206561204|ref|YP_002231969.1| serine protease MucD 1 [Burkholderia cenocepacia J2315]
 gi|198035432|emb|CAR51308.1| serine protease MucD 2 [Burkholderia cenocepacia J2315]
 gi|198037246|emb|CAR53168.1| serine protease MucD 1 [Burkholderia cenocepacia J2315]
          Length = 494

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 124/488 (25%), Positives = 218/488 (44%), Gaps = 41/488 (8%)

Query: 22  FSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHP 81
                 V       S  D   ++ +V P++V++        S  +     GF N      
Sbjct: 21  LVPQTAVAVTPPAASLPDFADLVEKVGPAVVNIRTTANVPTSGPRGMLPPGFDNGD---- 76

Query: 82  LKNYFRKDFHKFFSGEEP------------ILSDTVERLMFGSGFFITDDGYILTSNHIV 129
           +  +FR+ F                        DT +    GSGF ++ DGY++T+ H+V
Sbjct: 77  MSEFFRRFFGIPLPQAPGNGSNPKNAPAPDNPPDTEQNRGVGSGFIVSADGYVMTNAHVV 136

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           +D  +  V L+D  E  AKL+G D   D+AV+K+Q+      V   D+N +RVGE V  I
Sbjct: 137 DDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQASNL-PVVAIGDSNKVRVGEWVVAI 195

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           G+PF L  TV+AGIVS+  R+  D    F Q D  +N GNSGGP  N  G VIG+N+ I 
Sbjct: 196 GSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIY 254

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +     MG+   IP+    +    L + G+V  G   +    +T+++A  +GL   +G+L
Sbjct: 255 SRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRIAVAIGEVTKDVADSIGLPKAEGAL 314

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +++V    PADKAG++ GD+I   +GR + +  D    +    P  +  +S+ ++G    
Sbjct: 315 VSSVEPGGPADKAGIQPGDIILKFNGRPVDAASDLPRMVGDTKPGTKATVSVWRKGQARD 374

Query: 370 VAVVLGSSPTAKN-------DMHLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNR 418
           + + +  +P           +   +      LG+ + D+     K +     +       
Sbjct: 375 LPITIAETPAESTAKAEQRKNAPQKPRQTNSLGLTVSDLTAEQMKTLKLKNGVQIDGV-- 432

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
           +      G+Q+G  ++ V   +++  K    +  +   +K  +VL++            +
Sbjct: 433 DGPAARAGLQRGDIVLRVGDTDITSAKQFADVTAQLDPQKAVAVLVR----------RGD 482

Query: 479 MSRFVSLK 486
            ++FV ++
Sbjct: 483 NTQFVPVR 490


>gi|167618059|ref|ZP_02386690.1| serine protease [Burkholderia thailandensis Bt4]
 gi|257140103|ref|ZP_05588365.1| serine protease [Burkholderia thailandensis E264]
          Length = 483

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 137/495 (27%), Positives = 228/495 (46%), Gaps = 35/495 (7%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSS--------------VDLPPVIARVSPSIVSVMVEP 58
              AL+    + T       + P+                D   ++    P++V++  + 
Sbjct: 3   VAAALSAGYVAGTRHAEPQIITPAVAALMPAEAAAKTGIPDFSGLVETYGPAVVNISAKH 62

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVERLMFGSGFFI 116
             +   ++   A     +  + P   +FR  + +     G      D       GSGF I
Sbjct: 63  VVQRVAQR--RAAPQLPIDPEDPFYQFFRHFYGQVPGMGGGRQPQPDDQPSTSLGSGFII 120

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           + DGYILT+ H+++     +V L+D  E  AK+VGTD   D+AVLK+ +      V+  D
Sbjct: 121 SADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGTDKQSDVAVLKIDASGL-PTVKIGD 179

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCF 235
               +VG+ V  IG+P+    TV++GI+SA  R +PD   T F Q D P+N GNSGGP F
Sbjct: 180 PAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPFIQTDVPVNPGNSGGPLF 239

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N+MI +      G+   IP++   K    L+  G V  G  G+  Q L Q 
Sbjct: 240 NLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKTGHVSRGRLGVAVQGLNQT 299

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA   GL+   G+L+++V  + PA KAG++ GDVI  +DG  ++       QIAS  P  
Sbjct: 300 LASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVDGVPVQDSTTLPAQIASMKPGT 359

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKELLGMVLQDINDGNKKLVRIVAL 414
           +  + + ++ SK +V+V L S    +      E  ++  LG+ ++ +    +    +   
Sbjct: 360 KADLQIWRDKSKKTVSVTLASLADDQAKAGADEPVEQGRLGVAVRPLLPRERNGTSLTHG 419

Query: 415 NPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
              ++      + GIQ G  I++VN   V+  + +   + +A     +S+ L I+ D   
Sbjct: 420 LVVQQSTGPAASAGIQPGDVILAVNGRPVTSAEQLRDAVKRA----GNSLALLIQRD--- 472

Query: 473 QSGNDNMSRFVSLKI 487
                +   FV + +
Sbjct: 473 -----DAQIFVPVDL 482


>gi|134095258|ref|YP_001100333.1| putative serine protease [Herminiimonas arsenicoxydans]
 gi|133739161|emb|CAL62210.1| Peptidase S1 [Herminiimonas arsenicoxydans]
          Length = 491

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 126/503 (25%), Positives = 224/503 (44%), Gaps = 40/503 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           K+  + +  + +  L  V        + A       D   ++ +   ++V++    K KV
Sbjct: 6   KKLSVILLGVASAFLVPVTTGLAPSAMAAPSVAGLPDFTDLVEKTGAAVVNIRTTEKAKV 65

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-----------RLMFG 111
           +     +        ED  ++ +FR+ F       +   +                   G
Sbjct: 66  NQGNSTS--------EDEEMQEFFRRFFGVPIPPRQQQPAPRGRNKPDAEAEEEVPRGVG 117

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGF I+ DGY++T+ H+V+      V L+D  E  AK++G D   D+A++K+        
Sbjct: 118 SGFIISADGYVMTNAHVVDGADEVYVTLTDKREFKAKIIGADKRTDVALVKIDGSNL-PR 176

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSG 231
           +   D+N IRVGE V  IG+PF L  TV+AGIVSA  RD  +      Q D  +N GNSG
Sbjct: 177 LTVGDSNKIRVGEWVIAIGSPFGLDNTVTAGIVSAKARDTGEYLP-LIQTDVAVNPGNSG 235

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP  N  G VIG+N+ I +    +MG+   +P+    +    L + G+V  G  G+    
Sbjct: 236 GPLINMRGEVIGINSQIYSRSGGYMGISFAVPMDEAMRVSDQLRTSGKVTRGRIGVQIGE 295

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +T+++A  LGL   +G+L+  V    PA+KAG++ GDVI   +G  ++   D    + S 
Sbjct: 296 VTKDVAESLGLTRAQGALVQRVEAGGPAEKAGVEAGDVILKFNGVAVERSSDLPRVVGST 355

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL-----LGMVLQDINDGNK 406
            P  +  +++ ++G+   + V++      K         K       LG+V+ D+     
Sbjct: 356 KPGTRSTLTVWRKGAMRDLNVMITELEPEKAAKPEVKKAKPEQVANTLGLVVSDLTPAQV 415

Query: 407 KLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
           K ++I   V +           G++ G  ++ +N  ++   +    L+ K     + + L
Sbjct: 416 KELKIDGGVLVESAENSSA-RAGLRAGDILLRLNNTDIKDARQFNALVAKL--DPKKTAL 472

Query: 464 LQIKYDPDMQSGNDNMSRFVSLK 486
           L ++          + S+FV++K
Sbjct: 473 LLVRRG--------DSSQFVTIK 487


>gi|326539124|gb|ADZ87339.1| protease Do [Brucella melitensis M5-90]
          Length = 538

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 240/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 23  FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 79

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 80  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 135

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 136 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 195

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 196 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 255

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 256 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPMTEDIAQ 315

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 316 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 375

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 376 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 435

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 436 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 495

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 496 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 538


>gi|225852876|ref|YP_002733109.1| protease Do [Brucella melitensis ATCC 23457]
 gi|256263641|ref|ZP_05466173.1| protease [Brucella melitensis bv. 2 str. 63/9]
 gi|225641241|gb|ACO01155.1| protease Do [Brucella melitensis ATCC 23457]
 gi|263093694|gb|EEZ17699.1| protease [Brucella melitensis bv. 2 str. 63/9]
 gi|326409417|gb|ADZ66482.1| protease Do [Brucella melitensis M28]
          Length = 524

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 240/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 66  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPMTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 362 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 481

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 482 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|323700586|ref|ZP_08112498.1| protease Do [Desulfovibrio sp. ND132]
 gi|323460518|gb|EGB16383.1| protease Do [Desulfovibrio desulfuricans ND132]
          Length = 473

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 147/479 (30%), Positives = 237/479 (49%), Gaps = 38/479 (7%)

Query: 24  STYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLK 83
           S  ++ +A+  P       + A+   ++V +  E   +    + F       +PE HP  
Sbjct: 17  SVPVIAQARDLPV---FTELAAKAGKAVVFISTEKTAQAPSMEQFRQ----QVPEGHPFH 69

Query: 84  NYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT 143
            +F++ F +FF    P      + L  GSGF I+ DG I+T+NH++      +V   DD 
Sbjct: 70  EFFKR-FDQFFG---PQGQQPRKMLGQGSGFVISPDGLIVTNNHVINGADKVTVRFQDDK 125

Query: 144 E-LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
           +  PA++VG D   DLAV+K+++D     ++F D++ ++VGE V  IGNPF L  TV+AG
Sbjct: 126 KEYPAEVVGADQETDLAVIKIKADHTLSTLKFGDSDKLQVGEWVLAIGNPFGLDNTVTAG 185

Query: 203 IVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLI 261
           I+SA  R I   P   F Q DA IN GNSGGP  +  G VIG+N  I         +G  
Sbjct: 186 IISAKHRIIGAGPFDNFLQTDASINPGNSGGPLLDMDGEVIGINTAINA---AAENIGFA 242

Query: 262 IPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADK 321
           IP +   K I  L        GW G+  Q +++  A  LGL    G+L+ +V K +PADK
Sbjct: 243 IPSTQAAKVIALLKEGKAPQRGWLGVTIQQVSETQAKALGLAEPVGALVASVGKGAPADK 302

Query: 322 AGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT-- 379
            G+K GDVI  ++G+ I+ + D + +IA  +P E+  + L + G K +  V LG      
Sbjct: 303 GGVKQGDVILEVNGQKIEDNNDLLKKIAGLAPGEKADLVLWRNGEKVTRTVTLGQRNEKA 362

Query: 380 ----AKNDMHLEVGDKELLGMVLQDINDGNKKLVRI------VALNPNREREVEAKGIQK 429
               A N          +LGM L+ + D   + + +      + +N +       +GI++
Sbjct: 363 LAAMAPNQQDQGPAAATVLGMALKPLTDQEAQALGLDKTQGLLVVNVDPNTPAGEEGIRQ 422

Query: 430 GMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           G  I+  N  +V+ + D+  +I  A+++   +V+L +K            + FV+L +D
Sbjct: 423 GDVILQANQKDVNSVADLNDVIKSAEKRG--AVMLLVKR--------QGRNSFVALPLD 471


>gi|53804357|ref|YP_114049.1| serine protease MucD [Methylococcus capsulatus str. Bath]
 gi|53758118|gb|AAU92409.1| putative serine protease, MucD [Methylococcus capsulatus str. Bath]
          Length = 504

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 129/463 (27%), Positives = 212/463 (45%), Gaps = 29/463 (6%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
             A+  PS  D   ++ R  P++V++ V    +V      N         + P   +FR+
Sbjct: 66  AAARATPSLPDFAAIVRRNGPAVVNISVTGTSRV------NLPEMPQFDPNDPFGEFFRR 119

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAK 148
                    +    +       GSGF I  +G ILT+ H+V      +V L+D  E  A+
Sbjct: 120 F------QPQIPRGEDAPAHGLGSGFIIRPNGLILTNAHVVNGAQEVTVKLNDRREFKAR 173

Query: 149 LVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALD 208
           ++G D   D+A+LK+++D     V   D      G+ V  IG+PF    +V+AGI+SA  
Sbjct: 174 IIGIDKPTDVALLKIEADGL-PVVPLGDPARSGPGDWVVAIGSPFGFENSVTAGIISAKS 232

Query: 209 RDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSII 267
           R +P+     F Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   IP+ + 
Sbjct: 233 RSLPEETYVPFIQTDVAVNPGNSGGPLFNLSGEVIGINSQIYSRTGGYQGLSFAIPIDVA 292

Query: 268 KKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVG 327
            K    L++ G+V  G  G+  Q L Q LA   GL    G+L+ +V  + PA KAG+K G
Sbjct: 293 LKVEKQLLADGKVSRGRLGVGIQELNQSLAESFGLDRPTGALVDSVPNDGPAAKAGIKPG 352

Query: 328 DVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE 387
           DVI  L+G+ I++       +A   P  + K+ + + G +  + V +G  P  +      
Sbjct: 353 DVILSLNGQPIENSGQLPPLVADIKPGSEAKVGIWRNGKREEITVQVGEMPDTQQAAATG 412

Query: 388 VG-DKELLGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
            G  K  LG+ ++ ++   ++   +    L        E  GI+ G  I+++N H V+  
Sbjct: 413 NGLAKGRLGLAVRPLSPEEQRAADVDGGVLVEASAGPAERAGIRPGDVILALNGHAVANP 472

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            ++  L  +A +     V L ++              FV L +
Sbjct: 473 GELRELADRADKH----VALLVQRGGT--------RIFVPLDL 503


>gi|254719428|ref|ZP_05181239.1| protease Do [Brucella sp. 83/13]
 gi|265984432|ref|ZP_06097167.1| protease Do [Brucella sp. 83/13]
 gi|306839204|ref|ZP_07472021.1| protease Do [Brucella sp. NF 2653]
 gi|306844292|ref|ZP_07476884.1| protease Do [Brucella sp. BO1]
 gi|264663024|gb|EEZ33285.1| protease Do [Brucella sp. 83/13]
 gi|306275364|gb|EFM57105.1| protease Do [Brucella sp. BO1]
 gi|306405751|gb|EFM62013.1| protease Do [Brucella sp. NF 2653]
          Length = 524

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 240/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 66  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 362 IVVIRQGAEKTLKVKLGRLVEDDKSTDPAVEDQVPAPDDGEQPGARQETPDKSDQPKKEH 421

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 422 KSDAAPSVLGMKLSTLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 481

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 482 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|298530958|ref|ZP_07018359.1| protease Do [Desulfonatronospira thiodismutans ASO3-1]
 gi|298508981|gb|EFI32886.1| protease Do [Desulfonatronospira thiodismutans ASO3-1]
          Length = 472

 Score =  206 bits (524), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 137/489 (28%), Positives = 221/489 (45%), Gaps = 36/489 (7%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           I T  L  + F  +  +  A LP        +  +  P++V++    K +         +
Sbjct: 5   IKTFLLLTLFFIWSGSIAGASLPE----FSDLAEKAGPAVVNISTVKKVE---RPEMGDF 57

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
             G     HP + +F + F +FF   E       E+   GSGF I+ DGY++T+NH+VE 
Sbjct: 58  FRGFQDRGHPFEEFFDQ-FERFFGERERQP---REQRSLGSGFIISQDGYVVTNNHVVEG 113

Query: 132 GASFSVIL---SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
                       ++    A+++GTD   DLA++K+ +D +   +EF ++ +++VG+ V  
Sbjct: 114 AEEIKATFRLEDEEKTFEAEIIGTDPETDLALIKINTDMELPTLEFGNSEDMKVGQWVVA 173

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP  N  G VIG+N  
Sbjct: 174 IGNPFGLNHTVTAGIISAKGRVIGAGPYDNFIQTDASINPGNSGGPLLNMQGEVIGINTA 233

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           IV       G+G  IP ++ +  I  L +  +V  GW G+  QN+ Q++A  LGL   +G
Sbjct: 234 IVA---AGQGIGFAIPSTMAEDIISQLKTDQKVSRGWLGVTIQNVDQDIADALGLEEARG 290

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+  V    PA++AGM+ GDVI  L+G  ++   D   +I   +P  +  +   ++G K
Sbjct: 291 ALVAGVTPGDPAEEAGMEAGDVIVSLNGDSVEDSSDLTRKIGQLAPGSEATVGFYRDGEK 350

Query: 368 HSVAVVLGSSP---TAKNDMHLEVGDKELLGMVLQDINDGNKKLV------RIVALNPNR 418
             V V LG       A+        +K  LGM  +  +    + +       ++      
Sbjct: 351 KDVTVTLGERDLEGLAERPEPEPESEKADLGMSFRSPSQEEAEQLGLSEPQGLLVTEVEP 410

Query: 419 EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDN 478
                   I  G  I+  N   V    D   ++ +  + K   VL+              
Sbjct: 411 RSPAHRADIAPGDLILQANGQRVDSTNDFFTILEE--DAKPKQVLML-------LVNRQG 461

Query: 479 MSRFVSLKI 487
            + F ++ +
Sbjct: 462 QNIFRTIPL 470


>gi|254251538|ref|ZP_04944856.1| PDZ/DHR/GLGF [Burkholderia dolosa AUO158]
 gi|124894147|gb|EAY68027.1| PDZ/DHR/GLGF [Burkholderia dolosa AUO158]
          Length = 494

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 130/455 (28%), Positives = 213/455 (46%), Gaps = 21/455 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVARRVPQPQL--PIDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIISSDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+        V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKI-DATGLPTVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+LI++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALISSVDPNGPAAKAGLQPGDVILSVNGS 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ +K S+ V LG+   AK         ++  LG
Sbjct: 352 PVADSTSLPAQIANLKPGSKADLVVWRDKAKKSITVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
           + ++ +    +    +   + +         + GIQ G  I++VN   V+  + +   + 
Sbjct: 412 VAVRPLTPQERSADNVSHGLIVQQAAG-PAASAGIQPGDVILAVNGRPVTSAEQLREAVK 470

Query: 453 KAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            A     +S+ L I+ D        N   FV + +
Sbjct: 471 AA----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|330991050|ref|ZP_08315004.1| putative periplasmic serine protease DO-like protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329761871|gb|EGG78361.1| putative periplasmic serine protease DO-like protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 526

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 151/532 (28%), Positives = 236/532 (44%), Gaps = 56/532 (10%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPS------------------SVDLPP 42
           M  R     +S   V L  V+        +    P+                        
Sbjct: 4   MSLRAAAFSRSCLAVGLATVLGGHAARAADPAPAPAPAPASATPLHLPGEGRNMPDSFAD 63

Query: 43  VIARVSPSIVSVMVEPKKKV------SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG 96
           + AR+ P++V+V      +         +   +     N PE  P + +F    ++  S 
Sbjct: 64  LAARLLPAVVNVSTTEMVRPGEDDGDDGDDGDSTPQVPNFPEGSPFEKFFHDFMNRQDSP 123

Query: 97  EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
             P      +    GSGF I   G I+T+NH+V      ++ L D+T L A+L+G D   
Sbjct: 124 NAPP----RKMQALGSGFIIDPSGVIVTNNHVVRHADQITITLQDNTVLKARLLGHDDRT 179

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG 216
           DLAVLKV S R    V F D++N RVG+ V  IGNPF L GTV+AGIVS+  R+I   P 
Sbjct: 180 DLAVLKVDSPRPLPAVPFGDSDNARVGDWVLAIGNPFGLSGTVTAGIVSSRGRNIEQGPY 239

Query: 217 T-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q DAPIN+GNSGGP FN  G VIG+N  I +     +G+G  IP +  +  I  L 
Sbjct: 240 DDFIQTDAPINKGNSGGPLFNLHGEVIGINTAIFSPSGGSIGIGFSIPSAEAQGIIAQLR 299

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
             GRV  GW G+  Q++TQE+A  LGL+   G+LI  V  + PA  A ++ GDVI  L+G
Sbjct: 300 QHGRVTRGWIGVRIQDVTQEIADGLGLKSAHGALIAGVEPKGPAANAHLQTGDVIQSLNG 359

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE-------- 387
           + I   +     +A  +      + + + G + +V + +G+ P  K D            
Sbjct: 360 KDI-DGRALPRLVAELAGGSVAHLGIWRRGQQMNVNITIGALPEEKTDRADSAHPAARNS 418

Query: 388 ---VGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVN 437
                  E +G  + +I+D  ++          ++      +     +G++ G  +  V 
Sbjct: 419 ALGSMAVEGMGFTVGEIDDIARQKYNMADGQKGVLVTGVTDDSPAAERGLRPGDVVTEVQ 478

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
              V+   D+ R +  A+ + R +VL  ++        N +  R+V   + +
Sbjct: 479 QSAVNTPADLRRQLDAARSQHRKTVLFLVQ--------NADGLRWVPFPLPE 522


>gi|225627846|ref|ZP_03785883.1| protease Do [Brucella ceti str. Cudo]
 gi|225617851|gb|EEH14896.1| protease Do [Brucella ceti str. Cudo]
          Length = 538

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 240/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 23  FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 79

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 80  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 135

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 136 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 195

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 196 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 255

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 256 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 315

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 316 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 375

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 376 IVVIRQGAEKTLKVKLGRLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 435

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 436 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 495

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 496 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 538


>gi|23502265|ref|NP_698392.1| serine protease Do [Brucella suis 1330]
 gi|161619341|ref|YP_001593228.1| protease Do [Brucella canis ATCC 23365]
 gi|163843649|ref|YP_001628053.1| protease Do [Brucella suis ATCC 23445]
 gi|254702116|ref|ZP_05163944.1| protease Do [Brucella suis bv. 5 str. 513]
 gi|254704653|ref|ZP_05166481.1| protease Do [Brucella suis bv. 3 str. 686]
 gi|254708068|ref|ZP_05169896.1| protease Do [Brucella pinnipedialis M163/99/10]
 gi|254710438|ref|ZP_05172249.1| protease Do [Brucella pinnipedialis B2/94]
 gi|254714431|ref|ZP_05176242.1| protease Do [Brucella ceti M644/93/1]
 gi|254717328|ref|ZP_05179139.1| protease Do [Brucella ceti M13/05/1]
 gi|256031932|ref|ZP_05445546.1| protease Do [Brucella pinnipedialis M292/94/1]
 gi|256061453|ref|ZP_05451597.1| protease Do [Brucella neotomae 5K33]
 gi|256160130|ref|ZP_05457824.1| protease Do [Brucella ceti M490/95/1]
 gi|256255336|ref|ZP_05460872.1| protease Do [Brucella ceti B1/94]
 gi|256369810|ref|YP_003107321.1| serine protease Do, putative [Brucella microti CCM 4915]
 gi|260169068|ref|ZP_05755879.1| serine protease Do, putative [Brucella sp. F5/99]
 gi|260566101|ref|ZP_05836571.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261219157|ref|ZP_05933438.1| protease Do [Brucella ceti M13/05/1]
 gi|261222537|ref|ZP_05936818.1| protease [Brucella ceti B1/94]
 gi|261315569|ref|ZP_05954766.1| protease Do [Brucella pinnipedialis M163/99/10]
 gi|261318008|ref|ZP_05957205.1| protease Do [Brucella pinnipedialis B2/94]
 gi|261322219|ref|ZP_05961416.1| protease Do [Brucella ceti M644/93/1]
 gi|261325459|ref|ZP_05964656.1| protease [Brucella neotomae 5K33]
 gi|261752686|ref|ZP_05996395.1| serine endoprotease [Brucella suis bv. 5 str. 513]
 gi|261755346|ref|ZP_05999055.1| serine endoprotease [Brucella suis bv. 3 str. 686]
 gi|261758572|ref|ZP_06002281.1| serine endoprotease [Brucella sp. F5/99]
 gi|265989038|ref|ZP_06101595.1| protease [Brucella pinnipedialis M292/94/1]
 gi|265998502|ref|ZP_06111059.1| protease [Brucella ceti M490/95/1]
 gi|23348238|gb|AAN30307.1| serine protease Do, putative [Brucella suis 1330]
 gi|161336152|gb|ABX62457.1| protease Do [Brucella canis ATCC 23365]
 gi|163674372|gb|ABY38483.1| protease Do [Brucella suis ATCC 23445]
 gi|255999973|gb|ACU48372.1| serine protease Do, putative [Brucella microti CCM 4915]
 gi|260155619|gb|EEW90699.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260921121|gb|EEX87774.1| protease [Brucella ceti B1/94]
 gi|260924246|gb|EEX90814.1| protease Do [Brucella ceti M13/05/1]
 gi|261294909|gb|EEX98405.1| protease Do [Brucella ceti M644/93/1]
 gi|261297231|gb|EEY00728.1| protease Do [Brucella pinnipedialis B2/94]
 gi|261301439|gb|EEY04936.1| protease [Brucella neotomae 5K33]
 gi|261304595|gb|EEY08092.1| protease Do [Brucella pinnipedialis M163/99/10]
 gi|261738556|gb|EEY26552.1| serine endoprotease [Brucella sp. F5/99]
 gi|261742439|gb|EEY30365.1| serine endoprotease [Brucella suis bv. 5 str. 513]
 gi|261745099|gb|EEY33025.1| serine endoprotease [Brucella suis bv. 3 str. 686]
 gi|262553126|gb|EEZ08960.1| protease [Brucella ceti M490/95/1]
 gi|264661235|gb|EEZ31496.1| protease [Brucella pinnipedialis M292/94/1]
          Length = 524

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 240/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 66  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 362 IVVIRQGAEKTLKVKLGRLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 481

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 482 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|255263637|ref|ZP_05342979.1| protease do [Thalassiobium sp. R2A62]
 gi|255105972|gb|EET48646.1| protease do [Thalassiobium sp. R2A62]
          Length = 486

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 133/477 (27%), Positives = 226/477 (47%), Gaps = 37/477 (7%)

Query: 26  YLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNY 85
                A+       L  +  ++SPS+V++                   G +PE  P +++
Sbjct: 31  AQTFAAQAQDRPASLADLAEQISPSVVNITTTTTVAGRTGPQ------GVVPEGSPFEDF 84

Query: 86  FRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTEL 145
           F +   +  +               GSGF I++DGYI+T+NH++E      +   +  EL
Sbjct: 85  FNELPDRKGAP--------RRSSALGSGFVISEDGYIVTNNHVIEGADEILIEFFEGFEL 136

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
           PA+LVGTD   D+A+LKV++D     V F D++  RVG+ V  +GNP     +VSAGIVS
Sbjct: 137 PAELVGTDPNTDIALLKVEADEALKFVPFGDSDISRVGDWVIAMGNPLGQGFSVSAGIVS 196

Query: 206 ALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLS 265
           A +R +      + Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G  +  +
Sbjct: 197 ARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGEVIGVNTAILSPNGGSIGIGFSMASN 256

Query: 266 IIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMK 325
           ++ + +  L   G    GW G+  Q++T ++   +    +    +   V   PA++AG  
Sbjct: 257 VVTRVVDQLQEFGETRRGWLGVRIQDITPDMMDAIAGLESVNGALITDVPPGPAEEAGFL 316

Query: 326 VGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP------- 378
            GDVI   DG  +   +  V  + +      V++ + ++G+  ++ V LG          
Sbjct: 317 AGDVILSFDGTDVDDTRGLVRTVGNTQVGAAVRVVVLRDGATETILVTLGRRETAEAAVP 376

Query: 379 -TAKNDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKG 430
             A      E  + E+LGM L +I+D  +  +        ++  N + E E   KG+++G
Sbjct: 377 AVAPAPEPEEPTEIEVLGMTLVEISDEMRAEIDGISDLKGLLVANVDEETEAFEKGLRQG 436

Query: 431 MTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             I      ++  I D++  + +A+E  R S+LL ++ D D         RFV++ +
Sbjct: 437 DVITEAGQQKIESIGDLQDRLAEAEEAGRKSILLLVRRDGD--------PRFVAISL 485


>gi|319408249|emb|CBI81902.1| serine protease [Bartonella schoenbuchensis R1]
          Length = 502

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 175/509 (34%), Positives = 278/509 (54%), Gaps = 34/509 (6%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSV------DLPPVIARVSPSIVSVM 55
           F+    ++     +A T  +  S + + EA   P  V          ++++V P++VSV 
Sbjct: 6   FRMISPAIGLSTVLASTMFLSGSNFWMTEAHADPVFVPSVQQQGFANIVSQVKPAVVSVQ 65

Query: 56  VEPKKKVSV---EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI-LSDTVERLMFG 111
           V+   K      +  F+A G   LP+ HP K +F++ + + +   +    S     + FG
Sbjct: 66  VKSNAKKEEWFFDGFFSAPGIDQLPDQHPFKKFFKEFYDRGWPNNKHSHRSHKPRPIAFG 125

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGFFI+ DGYI+T++H++ DG S+SV+L D TEL AKL+GTD+  DLAVLKV   R F  
Sbjct: 126 SGFFISPDGYIVTNDHVISDGTSYSVVLDDGTELNAKLIGTDSRTDLAVLKVDDKRTFPY 185

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNS 230
           V+F D + + VG+ V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNS
Sbjct: 186 VDFADDSKLYVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGIYDDFIQIDAAVNRGNS 245

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP FN  G V+G+N  I +    ++G+   IP +  K+ +  LI KG V  GW G+  Q
Sbjct: 246 GGPTFNLNGQVVGINTAIFSPSGGNVGIAFAIPATTAKQVVKQLIEKGSVQRGWLGVQIQ 305

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            +T+E++  +GL+ TKG+L+T  +K  PA+KAG+K GDVI  ++G  +   +D   +IA 
Sbjct: 306 PVTKEISDSVGLKETKGALVTDPLK-GPAEKAGIKTGDVIIAVNGEKVTDARDLARRIAH 364

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----------ELLGMVLQD 400
             P E   +++ + G +  + V L + P ++N                   E  G+++  
Sbjct: 365 IRPGETAVLNVWRSGKEEKIKVKLDAMPESENKKEASRSSSSKQQSSNETLEDYGLIVSP 424

Query: 401 INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
            +D       +V  + + + E   KGI+ G  IV+VN   V  + D+   I  A++  R+
Sbjct: 425 SDDS----TGMVVNDVDSDSEAAEKGIRPGDVIVTVNNKPVKKVSDITDAIKNAQKLGRN 480

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++LLQ++         ++ +RF++L+I K
Sbjct: 481 AILLQVR--------TNDQNRFIALQIVK 501


>gi|75676531|ref|YP_318952.1| peptidase S1C, Do [Nitrobacter winogradskyi Nb-255]
 gi|74421401|gb|ABA05600.1| peptidase S1C, Do [Nitrobacter winogradskyi Nb-255]
          Length = 496

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 139/505 (27%), Positives = 235/505 (46%), Gaps = 29/505 (5%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD-LPPVIARVSPSIVSVMVEPKK 60
             R + ++       L+         V+ A       D +  V  +V  ++V++    K 
Sbjct: 1   MTRAMQALSLRRRFLLSAFCLGVASAVVSAPALARGPDGIADVAEKVIDAVVNISTTQKV 60

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           +    +         LP   P + +F   F     G+   L    +    GSGF +   G
Sbjct: 61  EAKSGEGRRM--IPQLPPGSPFEEFFDDFFKNRRGGKSDGLQTH-KTNSLGSGFIVDAAG 117

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
            ++T+NH++ D    +VIL+D T++ A+ VG D   DLAVLK +     + V+F D++ +
Sbjct: 118 IVVTNNHVIADSDEINVILNDGTKVKAETVGVDKKTDLAVLKFKPPHPLMAVKFGDSDKL 177

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
           R+GE V  IGNPF L G+VSAGIVSA +RDI + P   + Q DA IN+GNSGGP FN  G
Sbjct: 178 RLGEWVIAIGNPFSLGGSVSAGIVSARNRDINNGPYDSYIQTDAAINRGNSGGPLFNLEG 237

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+GVN +I++     +G+G  +P   +   +  L   G +  GW G+  Q +T E+A  
Sbjct: 238 EVVGVNTLIISPSGGSIGIGFAVPSKTVAGVVDQLRKFGELRRGWLGVRIQQVTDEIADS 297

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           L ++  +G+L+  V  + PA  AG++ GDV+   DG+ IK  +D    +A  +  + V +
Sbjct: 298 LNIKPARGALVAGVEDKGPAKPAGIEPGDVVIAFDGKDIKEPKDLSRMVADTAVGKTVSV 357

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----------LGMVLQDINDGNKKLV 409
            + ++G + +  V LG    +   + + +  K            LG+ L  ++   +   
Sbjct: 358 VVIRKGKEETKKVTLGRLDDSDKAIPVSIKTKPEDDDKPVTQKALGLDLATLSKDLRARY 417

Query: 410 -------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
                   ++      + +   K +  G  IV V    V+   D+ + I + K+  + +V
Sbjct: 418 KIKDSVKGVIITEVEADSDAAEKRLSAGDVIVEVAQEAVNSASDIRKRIDQLKKDGKKAV 477

Query: 463 LLQIKYDPDMQSGNDNMSRFVSLKI 487
           LL +              RFV+L +
Sbjct: 478 LLMVSNG-------AGELRFVALSL 495


>gi|116251206|ref|YP_767044.1| serine protease [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255854|emb|CAK06935.1| putative serine protease [Rhizobium leguminosarum bv. viciae 3841]
          Length = 531

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 176/522 (33%), Positives = 265/522 (50%), Gaps = 53/522 (10%)

Query: 8   SVKSICTVALTCVIFSS---TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           +V  I    L   +      +Y        P+      V+  VSP++VSV VE +     
Sbjct: 19  TVAGIAAAVLATGVPLEITRSYAEAVKVQAPAVPSFANVVDAVSPAVVSVRVENRVNPVS 78

Query: 65  EQM-------FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------------ 105
           +         FN  GF +LP+DHPLK +F++        +                    
Sbjct: 79  DNNNDGFSFDFNGRGFDDLPDDHPLKRFFKQFGQDPNDQQGHSRRFGQNGPNGGPNGPGG 138

Query: 106 ----ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
                 +  GSGFFI++DGYI+T+NH+V DG +F  +++D TEL AKL+G D   DLAVL
Sbjct: 139 KGRLRPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAVMNDGTELDAKLIGKDPRTDLAVL 198

Query: 162 KVQSD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FT 219
           KV    +KF  V + D NN+RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + 
Sbjct: 199 KVDGKGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYL 258

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q+DA +N+GNSGGP FN  G V+G+N  I +     +G+   IP S  +  +  L+  G+
Sbjct: 259 QVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSVGIAFAIPASTARDVVADLMKDGQ 318

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  GW G+  Q +T+++A  +GL    G+L+ A    SP DKAGMK GDV+  L+G  IK
Sbjct: 319 VSRGWLGVQIQPVTKDIAESIGLSEPSGALVVAPQAGSPGDKAGMKAGDVVTALNGETIK 378

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL------ 393
             +D   +I +  P  +V++S+ + G    + V LG+ P  + D   +   +        
Sbjct: 379 DARDLSRRIGAMQPGSKVELSVWRAGKAQPLTVELGTLPIDQKDASADDNSQPQQPEAPA 438

Query: 394 -------LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
                  LG+ +   +DG      +     + + +   KGI++G  I SVN  EV+  +D
Sbjct: 439 SEKALADLGLTVGPSDDGK----GLAITGIDPDSDAADKGIKEGEKITSVNNQEVASPED 494

Query: 447 VERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           V +++ +AK+  R   L QI+        ++  SRFV+L I+
Sbjct: 495 VVKVLNQAKKDGRTRALFQIQ--------SNEGSRFVALPIN 528


>gi|17549771|ref|NP_523111.1| protease signal peptide protein [Ralstonia solanacearum GMI1000]
 gi|17432026|emb|CAD18703.1| probable protease signal peptide protein [Ralstonia solanacearum
           GMI1000]
          Length = 490

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 138/511 (27%), Positives = 223/511 (43%), Gaps = 47/511 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYL---------------------VLEAKLPPSSVDL 40
             RQ ++  ++   A+  V     YL                               +D 
Sbjct: 1   MTRQTMARSAVGLAAVLAVAGGYAYLQKDVMTRAVAAPLAASATAQTSAAPMAVAVPMDF 60

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
             ++ R  P++V++    + + +  Q         +  D P   +FR+        + P 
Sbjct: 61  SAIVERYGPAVVNISTTARAQRTSIQGLP----PGVSPDDPFAEFFRRFM-----PQAPQ 111

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF ++ DG ILT+ H+V+     SV L+D  E  AK++G D   D+AV
Sbjct: 112 QQGDQVVKGLGSGFIVSPDGLILTNAHVVDGAQEVSVKLTDRREFKAKVLGVDKQSDVAV 171

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFT 219
           L++ +      V+       +VGE V  IG+P+    TV+AGIVSA  R +PD     F 
Sbjct: 172 LRIAASNL-PTVQIGSPAGTKVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYVPFI 230

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   +P+ +  K    L++ G+
Sbjct: 231 QTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAVPIDVAMKVEQQLVATGK 290

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  G  GI  Q + Q LA    L   +G+L+ AV K+ PA KAG++ GDVI  +    I 
Sbjct: 291 VTRGRLGISVQEVDQSLADSFNLPKPEGALVNAVEKDGPAAKAGLQPGDVILQIGDVHIG 350

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-DKELLGMVL 398
              D   Q+A   P   V + + + G   +++V +G +  AK   +     DK  LG+ +
Sbjct: 351 HSGDLPEQVAEIKPGSTVPLQIIRHGKPTALSVTVGEAKDAKVAANTSAAPDKGRLGLAV 410

Query: 399 QDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           + +    K+   +       +        GIQ G  I+S+N   VS  +++  L+ +A  
Sbjct: 411 RPLQAEEKRQSGLPGGLVVMDSSGPAAKAGIQPGDVILSLNGTPVSSAQELRALVDRA-- 468

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
                V L ++ D        +   FV L +
Sbjct: 469 --GKHVALLVQRD--------DAKIFVPLDL 489


>gi|17986896|ref|NP_539530.1| protease DO [Brucella melitensis bv. 1 str. 16M]
 gi|256045026|ref|ZP_05447927.1| protease DO [Brucella melitensis bv. 1 str. Rev.1]
 gi|265991453|ref|ZP_06104010.1| protease [Brucella melitensis bv. 1 str. Rev.1]
 gi|17982537|gb|AAL51794.1| protease do [Brucella melitensis bv. 1 str. 16M]
 gi|263002237|gb|EEZ14812.1| protease [Brucella melitensis bv. 1 str. Rev.1]
          Length = 524

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 147/530 (27%), Positives = 241/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 66  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A R   ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAERPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 362 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 481

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 482 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|170700237|ref|ZP_02891253.1| protease Do [Burkholderia ambifaria IOP40-10]
 gi|170134870|gb|EDT03182.1| protease Do [Burkholderia ambifaria IOP40-10]
          Length = 499

 Score =  206 bits (523), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 128/511 (25%), Positives = 225/511 (44%), Gaps = 44/511 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             +  L       V   C+ F S           S  D   ++ +V P++V++       
Sbjct: 1   MTKLTLRNVFATAVLCACLPFISHTAAAATPPAASLPDFADLVEKVGPAVVNIRTTANVP 60

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS---------------GEEPILSDTVE 106
           +   +     GF N      +  +FR+ F                           DT +
Sbjct: 61  IPGPRGVLPPGFDNGD----MSEFFRRFFGIPLPQAPGNGGGNGNPKNAPAPDNPPDTEQ 116

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+Q+ 
Sbjct: 117 NRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQAS 176

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPIN 226
                V   D+N +RVGE V  IG+PF L  TV+AGIVS+  R+  D    F Q D  +N
Sbjct: 177 NL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAVN 234

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G   
Sbjct: 235 PGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRIA 294

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +    +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D   
Sbjct: 295 VAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGIQPGDIILKFNGRPVETASDLPR 354

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE-------LLGMVLQ 399
            +    P  +  +S+ ++G    + + +  +P        +  +          LG+ + 
Sbjct: 355 MVGDTKPGTKATVSVWRKGQARDLPITIAETPAETTAKAEQRKNTPQKPRQANSLGLTVS 414

Query: 400 DINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
           DI     K +     +       +      G+Q+G  ++ V   +++  K    +  +  
Sbjct: 415 DIPADQMKSLKLKNGVQIDAV--DGPAARAGLQRGDIVLRVGDTDITSAKQFAEVTAQLD 472

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            +K  +VL++            + ++FV ++
Sbjct: 473 SQKAVAVLVR----------RGDNTQFVPVR 493


>gi|148560219|ref|YP_001259289.1| putative serine protease Do [Brucella ovis ATCC 25840]
 gi|148371476|gb|ABQ61455.1| putative serine protease Do [Brucella ovis ATCC 25840]
          Length = 524

 Score =  206 bits (522), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 241/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 66  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 362 IVVIRQGAEKTLKVKLGRLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 481

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V  ++DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 482 VTVKTLEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|304392185|ref|ZP_07374127.1| serine protease [Ahrensia sp. R2A130]
 gi|303296414|gb|EFL90772.1| serine protease [Ahrensia sp. R2A130]
          Length = 502

 Score =  206 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 136/510 (26%), Positives = 226/510 (44%), Gaps = 30/510 (5%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYL-VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPK 59
           M K+  ++  +   +  T  + SS+   ++        V +  +   +  ++V++     
Sbjct: 1   MIKKLFITAAAAAAMFTTPALVSSSAPGLVPLAHAAGPVSVADLADELIGAVVNISTSQN 60

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP---ILSDTVERLMFGSGFFI 116
              +  +  +      +P+  P +++F + F     G        +   +    GSGF I
Sbjct: 61  V-GNNNEGTSRAPRPKVPDGSPFQDFFDEFFRNQEEGNSGPPSRRNQPRKVSSLGSGFVI 119

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
              G I+T+NH++ D     +  +D T L A+++GTD   D+AVL+V  ++    V F  
Sbjct: 120 DPAGIIITNNHVIADADEIEIDFTDGTSLKAEVIGTDPKTDIAVLRVTPEKPLQAVAFGK 179

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCF 235
           +   RVG+ V  IGNPF    +V+ GIVSA  RDI   P   F Q DA IN+GNSGGP F
Sbjct: 180 SAGARVGDWVMAIGNPFGQGSSVTLGIVSATKRDIRSGPYDSFIQTDAAINRGNSGGPLF 239

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N  I++     +G+G  IP  +    I  L   G    GW G+  Q +T +
Sbjct: 240 NMDGEVIGINTAIISPSGGSIGLGFSIPSDLAINVIQQLRDFGETRRGWLGVSIQPVTDD 299

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           +A  L +   +G+L+  V  + PA  AG++VGDVI   DG+ I+  +D    +A     +
Sbjct: 300 IAESLSMAEARGALVAGVTNKGPAKIAGIQVGDVILDFDGKRIEQMRDLPRIVAETPVGK 359

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHL----------EVGDKELLGMVLQDINDGN 405
            V + + ++G + +V V LG     +               E      LGM   ++ D  
Sbjct: 360 AVDVVVLRKGEEETVPVTLGRLEDGEKAAAEESAEAKEETDEPKPVVALGMTFGELTDER 419

Query: 406 KKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           +   +I       +    +     + KGI+ G  I  +    V    DVE+ +   K+  
Sbjct: 420 RAEFKIADDVKGALITEVSDGSAAQDKGIKPGSVISEIGQEAVDTPADVEKRLAALKKDG 479

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           R   LL +       +  D    FV L ++
Sbjct: 480 RKKALLLV-------AAPDGDLGFVVLSLN 502


>gi|237815795|ref|ZP_04594792.1| protease Do [Brucella abortus str. 2308 A]
 gi|237789093|gb|EEP63304.1| protease Do [Brucella abortus str. 2308 A]
          Length = 538

 Score =  206 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 240/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 23  FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 79

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 80  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 135

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 136 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 195

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 196 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 255

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 256 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 315

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 316 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 375

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 376 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 435

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 436 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 495

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 496 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 538


>gi|62290288|ref|YP_222081.1| serine protease Do [Brucella abortus bv. 1 str. 9-941]
 gi|82700211|ref|YP_414785.1| serine protease family protein [Brucella melitensis biovar Abortus
           2308]
 gi|189024521|ref|YP_001935289.1| serine protease Do, hypothetical [Brucella abortus S19]
 gi|254689590|ref|ZP_05152844.1| serine protease Do, hypothetical [Brucella abortus bv. 6 str. 870]
 gi|254697732|ref|ZP_05159560.1| serine protease Do, hypothetical [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730621|ref|ZP_05189199.1| serine protease Do, hypothetical [Brucella abortus bv. 4 str. 292]
 gi|256113943|ref|ZP_05454731.1| serine protease Do, hypothetical [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257839|ref|ZP_05463375.1| serine protease Do, hypothetical [Brucella abortus bv. 9 str. C68]
 gi|260546830|ref|ZP_05822569.1| protease [Brucella abortus NCTC 8038]
 gi|260755117|ref|ZP_05867465.1| serine protease [Brucella abortus bv. 6 str. 870]
 gi|260758336|ref|ZP_05870684.1| serine protease [Brucella abortus bv. 4 str. 292]
 gi|260762162|ref|ZP_05874505.1| serine protease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884129|ref|ZP_05895743.1| protease [Brucella abortus bv. 9 str. C68]
 gi|265995290|ref|ZP_06107847.1| protease [Brucella melitensis bv. 3 str. Ether]
 gi|297248676|ref|ZP_06932394.1| serine protease Do [Brucella abortus bv. 5 str. B3196]
 gi|62196420|gb|AAX74720.1| serine protease Do, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82616312|emb|CAJ11369.1| Serine proteases, V8 family:Serine protease, trypsin
           family:PDZ/DHR/GLGF domain:HtrA/DegQ
           protease:Glucose/ribitol dehydrogenase [Brucella
           melitensis biovar Abortus 2308]
 gi|189020093|gb|ACD72815.1| serine protease Do, hypothetical [Brucella abortus S19]
 gi|260095880|gb|EEW79757.1| protease [Brucella abortus NCTC 8038]
 gi|260668654|gb|EEX55594.1| serine protease [Brucella abortus bv. 4 str. 292]
 gi|260672594|gb|EEX59415.1| serine protease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675225|gb|EEX62046.1| serine protease [Brucella abortus bv. 6 str. 870]
 gi|260873657|gb|EEX80726.1| protease [Brucella abortus bv. 9 str. C68]
 gi|262766403|gb|EEZ12192.1| protease [Brucella melitensis bv. 3 str. Ether]
 gi|297175845|gb|EFH35192.1| serine protease Do [Brucella abortus bv. 5 str. B3196]
          Length = 524

 Score =  206 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 240/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 66  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 362 IVVIRQGAEKTLKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 481

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 482 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|134295160|ref|YP_001118895.1| protease Do [Burkholderia vietnamiensis G4]
 gi|134138317|gb|ABO54060.1| protease Do [Burkholderia vietnamiensis G4]
          Length = 497

 Score =  206 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 126/489 (25%), Positives = 219/489 (44%), Gaps = 42/489 (8%)

Query: 22  FSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHP 81
           F           P S  D   ++ +V P++V++       V   +     GF N      
Sbjct: 21  FVPQTASAVTPPPGSLPDFADLVEKVGPAVVNIRTTANVPVPGPRGSLPPGFDNGD---- 76

Query: 82  LKNYFRKDFH------KFFSGEEP-------ILSDTVERLMFGSGFFITDDGYILTSNHI 128
           +  +FR+ F           G  P          DT +    GSGF ++ DGY++T+ H+
Sbjct: 77  MSEFFRRFFGIPLPQAPGNGGGSPKGAPTPDNPPDTEQNRGVGSGFIVSADGYVMTNAHV 136

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           V+D  +  V L+D  E  AKL+G D   D+AV+K+Q+      V   D+  +RVGE V  
Sbjct: 137 VDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQAANL-PVVAIGDSTKVRVGEWVVA 195

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           IG+PF L  TV+AGIVS+  R+  D    F Q D  +N GNSGGP  N  G VIG+N+ I
Sbjct: 196 IGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQI 254

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     MG+   IP+    +    L + G+V  G   +    +T+++A  +GL   +G+
Sbjct: 255 YSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRIAVAIGEVTKDVADSIGLPKAEGA 314

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+++V    PADKAG++ GD+I   +GR + +  D    +    P  +  +++ ++G   
Sbjct: 315 LVSSVEPGGPADKAGIQPGDIILKFNGRSVDAASDLPRMVGDTKPGAKATVTVWRKGQAR 374

Query: 369 SVAVVLGSSPTAKND-------MHLEVGDKELLGMVLQDINDGNKKLV----RIVALNPN 417
            + + +  +P               +      LG+ + DI     K +     +      
Sbjct: 375 ELPITIAETPAETTAKAEQRKTAPQKPRQANSLGLTVSDIPAEQMKSLKLKNGVQIDGV- 433

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
            +      G+Q+G  ++ V   +++  K    +  +   +K  +VL++            
Sbjct: 434 -DGPAARAGLQRGDIVLRVGDTDITSAKQFADVTAQLDPQKAVAVLVR----------RG 482

Query: 478 NMSRFVSLK 486
           + ++FV ++
Sbjct: 483 DNTQFVPVR 491


>gi|254694080|ref|ZP_05155908.1| serine protease Do, hypothetical [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214378|ref|ZP_05928659.1| serine protease [Brucella abortus bv. 3 str. Tulya]
 gi|260915985|gb|EEX82846.1| serine protease [Brucella abortus bv. 3 str. Tulya]
          Length = 524

 Score =  206 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 146/530 (27%), Positives = 240/530 (45%), Gaps = 57/530 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           F R + +  ++  +++   +   T   L A+ P     +  +   +  ++V++      K
Sbjct: 9   FARTLFATVALGAMSVAGTVSMGTPPALAAQGP---ASVADLAEGLLDAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
               +         +PE  P + +F+  F+     +     D+ +    GSGF I  + G
Sbjct: 66  DDG-EGDGPVPMPQVPEGSPFQEFFKDFFNDKDGAQG---DDSRKVQSLGSGFIIDAEKG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANN 179
           YI+T+NH++ D     V  +D ++L A+LVG D   DLA+LKV     K   V F ++  
Sbjct: 122 YIVTNNHVIADADEIEVNFNDGSKLKAELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEK 181

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
            R+G+ V  IGNPF L GTV+AGI+SA  RDI   P   F Q DA IN+GNSGGP F+  
Sbjct: 182 ARIGDWVLAIGNPFGLGGTVTAGIISARKRDINSGPYDDFIQTDAAINRGNSGGPLFDMD 241

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    I  L   G V  GW G+  Q +T+++A 
Sbjct: 242 GKVIGINTAIISPSGGSIGIGFAIPAEMAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQ 301

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LGL+ TKG+LI  +++ S  D   ++ GDV+   DG+ + + +D    +A     ++V+
Sbjct: 302 SLGLKETKGALIAGLIENSGVDNKAIEAGDVVIRFDGKPVDTARDLPRLVAESPVGKEVE 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD---------------------------- 390
           I + ++G++ ++ V LG            V D                            
Sbjct: 362 IVVIRQGAEKALKVKLGCLVEDDKSTEPAVEDQVPAPDDGEQPGARQETPDKSDKPKKEH 421

Query: 391 -----KELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNT 438
                  +LGM L  ++D  +           +  L          K I+ G  IV +  
Sbjct: 422 KSDAAPSVLGMKLSKLDDDIRGEFGIAEDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQ 481

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
             V   +DV++ I   + + R + LL       M +      RFV+++ID
Sbjct: 482 VTVKTPEDVKKRIDALRREGRKNALL-------MLASRSGELRFVTIRID 524


>gi|303326815|ref|ZP_07357257.1| S1C (protease Do) subfamily peptidase MucD [Desulfovibrio sp.
           3_1_syn3]
 gi|302862803|gb|EFL85735.1| S1C (protease Do) subfamily peptidase MucD [Desulfovibrio sp.
           3_1_syn3]
          Length = 476

 Score =  206 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 142/498 (28%), Positives = 247/498 (49%), Gaps = 37/498 (7%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           + VK      LT    +S  L   A LP    D   + A+  P++V++  E K      +
Sbjct: 1   MIVKKYLAALLTVAFLASAQLSQAADLP----DFSELAAKSGPAVVNIGTERKASGGGPE 56

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSN 126
            F    F N+P        F K F +F            ++   GSGF ++ DGYI+T+N
Sbjct: 57  DFFGEMFRNMPPG------FEKFFDQFGGKGRGGKRPQQKQKSLGSGFLVSADGYIVTNN 110

Query: 127 HIVEDGASFSVILSDDT----ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           H+V D     V L +D      L A L+G+D   DLA+LKV + +    + F D++ ++V
Sbjct: 111 HVVADADVIHVTLDEDNGKSETLKATLIGSDEETDLALLKVDAKKPLPFLTFGDSDALKV 170

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHV 241
           GE +  IGNPF L  TV+AGI+SA  R+I   P   F Q DA IN GNSGGP  N  G V
Sbjct: 171 GEWLLAIGNPFGLDHTVTAGILSAKGRNIRSGPFDNFLQTDASINPGNSGGPLLNMAGQV 230

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I+ S     G+G  IP ++  K I  + S  ++  GW G+  Q++ +  A  LG
Sbjct: 231 VGINTAIIAS---GQGIGFAIPSNMAAKIINQIKSGKKISRGWIGVSIQDMDENTAKALG 287

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           ++   G+L+ +V++  PA K G++ GDVI  +D + ++     +  IA ++P     +++
Sbjct: 288 MKEPSGALVGSVMENEPAAKGGVQDGDVIIAVDKKDVEDAAALLRAIADKAPGSTAVLTV 347

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVG----DKELLGMVLQDINDGNKKLV------RI 411
            ++G    + V LG   + +ND    +G    D+ LLG+ ++ + +  ++ +       +
Sbjct: 348 WRDGKNFDLKVTLGERKSGQNDGRPGMGQKQQDEGLLGLSVRPLKEEERREMKLSKDEGL 407

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           + ++ + ++      ++ G  I+  N   V+  + + +++ +    KR +++LQI+   D
Sbjct: 408 LIVDVDPDKPAAEADLRPGDVILKANLKPVNSGEALSKIVKEV-GVKRGAIMLQIERRGD 466

Query: 472 MQSGNDNMSRFVSLKIDK 489
           +         F ++ + K
Sbjct: 467 VY--------FRTIPLGK 476


>gi|170750918|ref|YP_001757178.1| protease Do [Methylobacterium radiotolerans JCM 2831]
 gi|170657440|gb|ACB26495.1| protease Do [Methylobacterium radiotolerans JCM 2831]
          Length = 516

 Score =  206 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 146/509 (28%), Positives = 232/509 (45%), Gaps = 35/509 (6%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           + +  ++ +   +  +  +  +   +           L  +  +V+ ++V++      + 
Sbjct: 20  RSRARALMASILIGASVSVSVAAAALPVPAFAKGPASLADLAEQVTDAVVNISASTTVEA 79

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFH-----KFFSGEEPILSDTVERLMFGSGFFIT 117
                        +P   P ++ F + F+         G+        +    GSGF I 
Sbjct: 80  RA-----GRAGPQVPPGTPFEDLFEEFFNRRGGRGGGGGDSDGPRQQRKSNSLGSGFIID 134

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL--KVQSDRKFIPVEFE 175
             G ++T+NH++ D     VIL D T+L A++VG D+  DLAVL  K  +DR    V F 
Sbjct: 135 SAGLVVTNNHVIGDANDIQVILHDGTKLKAEIVGKDSKIDLAVLRVKPPADRTLKAVPFG 194

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPC 234
           D++ +R G+ V  IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP 
Sbjct: 195 DSDKMRPGDWVIAIGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPL 254

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
           FN  G VIG+N  I++     +G+G  +P    K  I  L   G V  GW G+  QN+  
Sbjct: 255 FNMDGEVIGINTAILSPTGGSVGIGFAVPSGTAKPVIDQLRDFGEVRRGWLGVRIQNVDD 314

Query: 295 ELAIPLG-LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
             A  L    G +G+L+  V ++ PA  AG++VGDVI   +G  +K+  D    +AS   
Sbjct: 315 TTAEALNLKGGARGALVAGVDEKGPAKTAGIEVGDVILKFNGAPVKASGDLPRIVASTPV 374

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTAKN-------DMHLEVGDKELLGMVLQDINDGNK 406
            ++V + + ++G + +  V LG    +             E   ++ LG+ L  + D  +
Sbjct: 375 GQKVDVVVMRKGEEVTKPVTLGRLEDSDKPQLANLRQPEPESATRQALGLNLSGMTDELR 434

Query: 407 KLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
           K          +V    +       K IQ G  IV V    VS   +V + I   K+  R
Sbjct: 435 KKYSIKDTVKGVVVTRVDPNSTAADKRIQPGEVIVEVGQEAVSTPAEVTKRIDALKKDGR 494

Query: 460 DSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            SVLL +       +G     RFV++ +D
Sbjct: 495 KSVLLLV-------AGATGDVRFVAVGLD 516


>gi|316936054|ref|YP_004111036.1| protease Do [Rhodopseudomonas palustris DX-1]
 gi|315603768|gb|ADU46303.1| protease Do [Rhodopseudomonas palustris DX-1]
          Length = 518

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 160/504 (31%), Positives = 241/504 (47%), Gaps = 27/504 (5%)

Query: 3   KRQILSVKSI---CTVALTCVIFSS-------TYLVLEAKLPPSSVDLPPVIARVSPSIV 52
           +R  L   +      VAL    F S       +         P+      ++A+V P+++
Sbjct: 24  RRLSLLASAAGLSMVVALGGAGFLSREMPSLTSPAFAAEGGKPAPAGFADLVAKVKPAVI 83

Query: 53  SVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGS 112
           SV V+  +   V  +    G G+          F + F   F G E +          GS
Sbjct: 84  SVRVKIDEDRQVTPLVRDDGDGDQMRLPRGFQQFERQFG--FRGPEGMPKGHQTITGEGS 141

Query: 113 GFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
           GFFIT DGY +T+NH+V+   S  V   D T   AK+VG D   DLA++KV     F  V
Sbjct: 142 GFFITADGYAVTNNHVVDQAKSVQVTTDDGTIYTAKVVGIDPKTDLALIKVDGKSDFPHV 201

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSG 231
            F D+   RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + QIDAPIN+GNSG
Sbjct: 202 NFADS-PARVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYVQIDAPINKGNSG 260

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP F+  G+VIGVN  I +     +G+G  IP +  K  +  L  +G V  GW G+  Q 
Sbjct: 261 GPAFDTNGNVIGVNTAIYSPSGGSVGIGFDIPAATAKLVVSQLKDRGYVSRGWLGVQVQP 320

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +T E+A  LG++  +G+L+ +    SPA KAG+K GDVI  +DG+ +K  +     I++ 
Sbjct: 321 VTAEIADSLGMKQARGALVDSPQDGSPAAKAGIKAGDVITAVDGKEVKDSRALARTISTL 380

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDIND-GN 405
           +P   VK+ +   G   ++ + L   P     +    G      +  LG+ +    +   
Sbjct: 381 TPGSSVKLDVLHNGQSKTIDLTLAEMPGDHQKVADNGGAERGPGRPYLGLRVVPAGEVDG 440

Query: 406 KKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +V    + E     KG++ G  I+ V    V+   DV   +  A +  + +VL++
Sbjct: 441 AGKAGVVVTGVDPEGPAADKGLRTGDVILDVGGKTVANTGDVRSALVAASKDGKKTVLMR 500

Query: 466 IKYDPDMQSGNDNMSRFVSLKIDK 489
           +K         D+ +RFV++ I K
Sbjct: 501 VK-------TADSAARFVAVPIAK 517


>gi|320355419|ref|YP_004196758.1| protease Do [Desulfobulbus propionicus DSM 2032]
 gi|320123921|gb|ADW19467.1| protease Do [Desulfobulbus propionicus DSM 2032]
          Length = 490

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 142/486 (29%), Positives = 230/486 (47%), Gaps = 26/486 (5%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLE--AKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
           + IL+   +C   L     +S     E  A L  S+     V+ +  P++V V VE +  
Sbjct: 10  KTILASCLLCLTLLAGGFHASHAQSEEDLALLDRSAKAFSSVVKKAGPAVVHVGVEKETT 69

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE---RLMFGSGFFITD 118
                     G G  P D     +F + F   F               +   GSGF I  
Sbjct: 70  AR--------GMGQFPSDLFNDPFFERFFGPQFRHPRTNPKQDKRTFKQEAAGSGFIIAS 121

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           DGYILT+NH+VE+ +  +V L+D  E PAK+VGTD   D+A++K+        +   +++
Sbjct: 122 DGYILTNNHVVEEASKITVRLADQREFPAKVVGTDPQSDVAIIKIDGKNL-PVLPLGNSD 180

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIV--SALDRDIPDRPGTFTQIDAPINQGNSGGPCFN 236
            + VGE V  IG+PF L  TV+ G+V     +R        F Q DA IN GNSGGP  N
Sbjct: 181 TLEVGEWVIAIGSPFELNQTVTVGVVSAKGRNRMGITDYENFIQTDAAINPGNSGGPLLN 240

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G  +G+N  I +    +MG+G  IP+++ K     L   G+V  GW GI+ Q++ +E+
Sbjct: 241 IHGEAVGMNTAIFSRSGGYMGIGFAIPINMAKSIEQQLRKSGKVTRGWLGILIQDVNEEM 300

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   G +   G+LI+ V   SPA K G++ GD+I  ++G  +    D   +IA   P  +
Sbjct: 301 AKSFGGKQGGGALISDVTDGSPAHKNGLQQGDIITAINGEPVTDVADLRNKIAMTPPNTE 360

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL--LGMVLQDINDGNKKLVR---- 410
           +++ + ++G +  + V +G  P     +  ++G   L  LG+ LQD+     +       
Sbjct: 361 LRLRILRDGQEKELTVTVGEQPADMASVAKKMGGSTLSELGLSLQDLTKEVAEQFGYSSN 420

Query: 411 --IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
             ++  +  +       G+Q GM I  VN   V  +K++++ + K+    +  VLL+I+ 
Sbjct: 421 QGVLIADVEQGSAAAELGLQAGMLIEEVNRTRVRTLKELQQALKKSSNANQ--VLLRIRS 478

Query: 469 DPDMQS 474
               Q 
Sbjct: 479 GEHSQY 484


>gi|152988178|ref|YP_001350095.1| serine protease MucD precursor [Pseudomonas aeruginosa PA7]
 gi|119632849|gb|ABL84422.1| MucD [Pseudomonas aeruginosa]
 gi|150963336|gb|ABR85361.1| serine protease MucD precursor [Pseudomonas aeruginosa PA7]
          Length = 474

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 135/487 (27%), Positives = 230/487 (47%), Gaps = 29/487 (5%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    K          A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNISTRQKLPDRA----MARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
             ++P+   L   FR    +              E    GSGF I++DGYILT+NH+V D
Sbjct: 59  QLSIPDLEGLPPMFRDFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVAD 118

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V LSD +E  AKL+G D   D+AVLK+++      ++  D+N ++VGE V  IG+
Sbjct: 119 ADEILVRLSDRSEHKAKLIGADPRSDVAVLKIEAKNL-PTLKLGDSNKLKVGEWVLAIGS 177

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T
Sbjct: 178 PFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQIFT 237

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+
Sbjct: 238 RSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALV 297

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + ++
Sbjct: 298 AQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLEVIRNGQRKTL 357

Query: 371 AVVLGSSPTAKND-----MHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREV 422
           ++ +GS P    +               LG+ + D+    +K +     V +   ++   
Sbjct: 358 SMAVGSLPDDDEEIASMGAPGAERSSNRLGVTVADLTAEQRKSLDIQGGVVIKEVQDGPA 417

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
              G++ G  I  ++   V+  K    +     + +  S+ +               + F
Sbjct: 418 AVIGLRPGDVITHLDNKAVTSTKVFADVAKALPKNRSVSMRVL----------RQGRASF 467

Query: 483 VSLKIDK 489
           ++ K+ +
Sbjct: 468 ITFKLAE 474


>gi|15595963|ref|NP_249457.1| serine protease MucD precursor [Pseudomonas aeruginosa PAO1]
 gi|254245021|ref|ZP_04938343.1| serine protease MucD precursor [Pseudomonas aeruginosa 2192]
 gi|9946654|gb|AAG04155.1|AE004511_8 serine protease MucD precursor [Pseudomonas aeruginosa PAO1]
 gi|1184684|gb|AAC43676.1| MucD [Pseudomonas aeruginosa PAO1]
 gi|1220194|gb|AAC43718.1| MucD [Pseudomonas aeruginosa PAO1]
 gi|126198399|gb|EAZ62462.1| serine protease MucD precursor [Pseudomonas aeruginosa 2192]
 gi|157004259|gb|ABV00672.1| MucD [Pseudomonas aeruginosa]
          Length = 474

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 136/487 (27%), Positives = 230/487 (47%), Gaps = 29/487 (5%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    K          A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNISTRQKLPDRA----MARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
             ++P+   L   FR    +              E    GSGF I++DGYILT+NH+V D
Sbjct: 59  QLSIPDLEGLPPMFRDFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVAD 118

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V LSD +E  AKL+G D   D+AVLK+++      ++  D+N ++VGE V  IG+
Sbjct: 119 ADEILVRLSDRSEHKAKLIGADPRSDVAVLKIEAKNL-PTLKLGDSNKLKVGEWVLAIGS 177

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T
Sbjct: 178 PFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQIFT 237

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+
Sbjct: 238 RSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALV 297

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+
Sbjct: 298 AQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSL 357

Query: 371 AVVLGSSPTAKND-----MHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREV 422
           ++ +GS P    +               LG+ + D+    +K +     V +   ++   
Sbjct: 358 SMAVGSLPDDDEEIASMGAPGAERSSNRLGVTVADLTAEQRKSLDIQGGVVIKEVQDGPA 417

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
              G++ G  I  ++   V+  K    +     + +  S+ +               + F
Sbjct: 418 AVIGLRPGDVITHLDNKAVTSTKVFADVAKALPKNRSVSMRVL----------RQGRASF 467

Query: 483 VSLKIDK 489
           ++ K+ +
Sbjct: 468 ITFKLAE 474


>gi|85714706|ref|ZP_01045693.1| peptidase S1C, Do [Nitrobacter sp. Nb-311A]
 gi|85698591|gb|EAQ36461.1| peptidase S1C, Do [Nitrobacter sp. Nb-311A]
          Length = 496

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 142/505 (28%), Positives = 237/505 (46%), Gaps = 29/505 (5%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD-LPPVIARVSPSIVSVMVEPKK 60
             R I ++       LT +  S    ++ A       D +  V  +V  ++V++    K 
Sbjct: 1   MIRAIHALSLRRRSLLTALCLSIASAMISAPALARGPDGIADVAEKVIDAVVNISTTQKV 60

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
            V   +         LP   P + +F   F     G+   L    +    GSGF +   G
Sbjct: 61  DVKNGEGRRL--IPQLPPGSPFEEFFDDFFKNRRGGKNGGLQTH-KTNSLGSGFIVDAAG 117

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
            ++T+NH++ D    +VIL+D T++ A+ +G D   DLAVLK +       V+F D++ +
Sbjct: 118 IVVTNNHVIADSDEINVILNDGTKVKAETIGVDKKTDLAVLKFKPPHPLTAVKFGDSDKL 177

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
           R+GE V  IGNPF L G+V+AGIVSA +RDI + P   + Q DA IN+GNSGGP FN  G
Sbjct: 178 RLGEWVIAIGNPFSLGGSVTAGIVSARNRDINNGPYDSYIQTDASINRGNSGGPLFNLEG 237

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            ++GVN +I++     +G+G  +P   +   +  L   G +  GW G+  Q +T E+A  
Sbjct: 238 EIVGVNTLIISPSGGSIGIGFAVPSKTVAGVVDQLRQFGELRRGWLGVRIQQVTDEIADS 297

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           L ++  +G+L+  V  + PA  AG++ GDVI   DG+ IK  +D    +A  +  + VK+
Sbjct: 298 LNIKPARGALVAGVEDKGPAKPAGIEPGDVIIAFDGKDIKEPKDLSRIVADTAVGKTVKV 357

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE----------LLGMVLQDINDGNKKLV 409
            + ++G + +  V LG    +   + + V  K            LG+ L  ++   +   
Sbjct: 358 VIIRKGKEDTKKVTLGRLDDSDKPLPVSVKTKPGDDDKPVTQKALGLDLAALSKDLRARY 417

Query: 410 -------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
                   ++  +   + +   K +  G  IV V    V    D+ + I + K+  + +V
Sbjct: 418 KIKDSVKGVIITDVEADSDAAEKRLSAGDVIVEVAQEAVGSASDIRKRIDQLKKDGKKAV 477

Query: 463 LLQIKYDPDMQSGNDNMSRFVSLKI 487
           LL +              RFV+L +
Sbjct: 478 LLMVSNG-------AGELRFVALSL 495


>gi|254239129|ref|ZP_04932452.1| serine protease MucD precursor [Pseudomonas aeruginosa C3719]
 gi|126171060|gb|EAZ56571.1| serine protease MucD precursor [Pseudomonas aeruginosa C3719]
          Length = 474

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 137/487 (28%), Positives = 230/487 (47%), Gaps = 29/487 (5%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    K          A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNISTRQKLPDRA----MARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
             ++P+   L   FR    +              E    GSGF I++DGYILT+NH+V D
Sbjct: 59  QLSIPDLEGLPPMFRDFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVAD 118

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V LSD +E  AKLVG D   D+AVLK+++      ++  D+N ++VGE V  IG+
Sbjct: 119 ADEILVRLSDRSEHKAKLVGADPRSDVAVLKIEAKNL-PTLKLGDSNKLKVGEWVLAIGS 177

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T
Sbjct: 178 PFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQIFT 237

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+
Sbjct: 238 RSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALV 297

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+
Sbjct: 298 AQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSL 357

Query: 371 AVVLGSSPTAKND-----MHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREV 422
           ++ +GS P    +               LG+ + D+    +K +     V +   ++   
Sbjct: 358 SMAVGSLPDDDEEIASMGAPGAERSSNRLGVTVADLTAEQRKSLDIQGGVVIKEVQDGPA 417

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
              G++ G  I  ++   V+  K    +     + +  S+ +               + F
Sbjct: 418 AVIGLRPGDVITHLDNKAVTSTKVFADVAKALPKNRSVSMRVL----------RQGRASF 467

Query: 483 VSLKIDK 489
           ++ K+ +
Sbjct: 468 ITFKLAE 474


>gi|172060065|ref|YP_001807717.1| protease Do [Burkholderia ambifaria MC40-6]
 gi|171992582|gb|ACB63501.1| protease Do [Burkholderia ambifaria MC40-6]
          Length = 499

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 126/511 (24%), Positives = 222/511 (43%), Gaps = 44/511 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             +  L       V   C+       V       S  D   ++ +V P++V++       
Sbjct: 1   MTKLTLRNVFAAAVLCACLPLIPHTAVAATPPAASLPDFADLVEKVGPAVVNIRTTANVP 60

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS---------------GEEPILSDTVE 106
           +   +     GF N      +  +FR+ F                           D  +
Sbjct: 61  IPGPRGALPPGFDNGD----MSEFFRRFFGIPLPQAPGNGGGNGNPKNAPAPDNPPDAEQ 116

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+Q+ 
Sbjct: 117 NRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQAS 176

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPIN 226
                V   D+N +RVGE V  IG+PF L  TV+AGIVS+  R+  D    F Q D  +N
Sbjct: 177 NL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAVN 234

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G   
Sbjct: 235 PGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRIA 294

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +    +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D   
Sbjct: 295 VAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGIQPGDIILKFNGRPVETASDLPR 354

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL-------LGMVLQ 399
            +    P  +  +S+ ++G    + + +  +P        +             LG+ + 
Sbjct: 355 MVGDTKPGTKATVSVWRKGQARDLPITIAETPAETTAKAEQRKSTPQKPRQANPLGLTVS 414

Query: 400 DINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
           DI     K +     +       +      G+Q+G  ++ V   +++  K    +  +  
Sbjct: 415 DIPAEQMKSLKLKNGVQIDAV--DGPAARAGLQRGDIVLRVGDTDITSAKQFAEVTAQLD 472

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            +K  +VL++            + ++FV ++
Sbjct: 473 AQKAVAVLVR----------RGDNTQFVPVR 493


>gi|107022206|ref|YP_620533.1| peptidase S1C, Do [Burkholderia cenocepacia AU 1054]
 gi|116689152|ref|YP_834775.1| protease Do [Burkholderia cenocepacia HI2424]
 gi|170732440|ref|YP_001764387.1| protease Do [Burkholderia cenocepacia MC0-3]
 gi|254245915|ref|ZP_04939236.1| Peptidase S1 [Burkholderia cenocepacia PC184]
 gi|105892395|gb|ABF75560.1| Peptidase S1C, Do [Burkholderia cenocepacia AU 1054]
 gi|116647241|gb|ABK07882.1| protease Do [Burkholderia cenocepacia HI2424]
 gi|124870691|gb|EAY62407.1| Peptidase S1 [Burkholderia cenocepacia PC184]
 gi|169815682|gb|ACA90265.1| protease Do [Burkholderia cenocepacia MC0-3]
          Length = 498

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 125/512 (24%), Positives = 222/512 (43%), Gaps = 45/512 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             +  L           C+       V       S  D   ++ +V P++V++       
Sbjct: 1   MTKLTLRKVLAAAALCACLPLVPQTAVAVTPPAASLPDFADLVEKVGPAVVNIRTTANVP 60

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS----------------GEEPILSDTV 105
            S  +     GF N      +  +FR+ F                            DT 
Sbjct: 61  TSGPRGMLPPGFDNGD----MSEFFRRFFGIPLPQAPGNGGGNGSNPKNAPAPDNGPDTE 116

Query: 106 ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+Q+
Sbjct: 117 QNRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQA 176

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPI 225
                 V   D+N +RVGE V  IG+PF L  TV+AGIVS+  R+  D    F Q D  +
Sbjct: 177 SNL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAV 234

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G  
Sbjct: 235 NPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRI 294

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
            +    +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR + +  D  
Sbjct: 295 AVAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGIQPGDIILKFNGRPVDAASDLP 354

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN-------DMHLEVGDKELLGMVL 398
             +    P  +  +++ ++G    + + +  +P           +   +      LG+ +
Sbjct: 355 RMVGDTKPGTKATVNVWRKGQARDLPITIAETPAESTAKAEQRKNAPQKPRQTNSLGLTV 414

Query: 399 QDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
            D+     K +     +       +      G+Q+G  ++ V   +++  K    +  + 
Sbjct: 415 SDLTAEQLKTLKLKNGVQIDGV--DGPAARAGLQRGDIVLRVGDTDITSAKQFADVTAQL 472

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
             +K  +VL++            + ++FV ++
Sbjct: 473 DPQKAVAVLVR----------RGDNTQFVPVR 494


>gi|325528707|gb|EGD05781.1| protease Do [Burkholderia sp. TJI49]
          Length = 494

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 128/454 (28%), Positives = 213/454 (46%), Gaps = 19/454 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVSRRVPQPQL--PMDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIVSSDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDASGL-PTVKIGDPGQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP  N  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLINMQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL    G+L+++V  + PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLSKPDGALVSSVDPDGPAAKAGLQPGDVILAVNGA 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ SK S++V LG+   AK         ++  LG
Sbjct: 352 PVADSTTLPSQIANLKPGSKADLQVWRDKSKKSISVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ +    +    +    +         + GIQ G  I++VN   V+  + +   +  
Sbjct: 412 VAVRPLTPQERSATNLSHGLMVQQAGGPAASAGIQPGDVILAVNGRPVTSPEQLRDAVKG 471

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 472 A----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|229588997|ref|YP_002871116.1| putative exported heat-shock adaptation serine protease
           [Pseudomonas fluorescens SBW25]
 gi|229360863|emb|CAY47722.1| putative exported heat-shock adaptation serine protease
           [Pseudomonas fluorescens SBW25]
          Length = 478

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 134/496 (27%), Positives = 227/496 (45%), Gaps = 30/496 (6%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
            I  +KS  ++  T ++          +LP    D   ++ + SP++V++    K     
Sbjct: 2   SIPRLKSYLSIVATVLVLGQALPAQAVELP----DFTQLVEQASPAVVNISTTQKLPDRK 57

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
                      LP    L+ +F +   +  +          E    GSGF I+ DGYILT
Sbjct: 58  VSNQQMPDLEGLPPM--LREFFERGMPQQRAPRGGGGQ--REAQSLGSGFIISPDGYILT 113

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH++ D     V L+D +EL AKLVGTD   D+A+LK++       ++   + +++ G+
Sbjct: 114 NNHVIADADEILVRLADRSELKAKLVGTDPRSDVALLKIEGKDL-PVLKLGKSQDLKAGQ 172

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IG+PF    TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN  G V+G
Sbjct: 173 WVVAIGSPFGFDHTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAGEVVG 232

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I T     MGV   IP+ +       L S G+V  GW G++ Q + ++LA   GL 
Sbjct: 233 INSQIYTRSGGFMGVSFAIPIDVAMDVSNQLKSGGKVSRGWLGVVIQEVNKDLAESFGLD 292

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+  +  + PA K G++VGDVI  ++G+ I    D    + +     + K+ + +
Sbjct: 293 KPAGALVAQIQDDGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGALKAGSKAKLEVIR 352

Query: 364 EGSKHSVAVVLGSSPTA-------KNDMHLEVGDKELLGMVLQDINDGNKKLVRI---VA 413
           EG + +V + +G+ P          N           LG+ + ++ D  KK   +   V 
Sbjct: 353 EGKRQNVELTVGAIPEEGATLDALGNAKPGAERSSNRLGIAVAELTDEQKKSFDLKSGVV 412

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           +   ++      G+Q G  I  +N   +   K +  +     + +  S+ +         
Sbjct: 413 IKEVQDGPASLIGLQPGDVITHLNNQAIDNTKQLTDIAKALPKNRSVSMRVL-------- 464

Query: 474 SGNDNMSRFVSLKIDK 489
                 + F++ K+ +
Sbjct: 465 --RQGRASFITFKLAE 478


>gi|319780155|ref|YP_004139631.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166043|gb|ADV09581.1| protease Do [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 506

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 151/513 (29%), Positives = 244/513 (47%), Gaps = 43/513 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSV-----------DLPPVIARVSPS 50
            +R    V ++   AL    F  ++        P++               P++A   P+
Sbjct: 5   LRRH--RVAALLGAALIISPFVMSFAQSAGNTVPTTQTPVAGITAPNGSFAPIVAADKPA 62

Query: 51  IVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS--GEEPILSDTVERL 108
           +V+V    K +       + +         P  +YFR+ F        + P         
Sbjct: 63  VVTVTTVMKAQPETMSDASPFDG-----GSPFDDYFRQFFGDQGMPTPKTPPQQQPQRAE 117

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF +  DG I+T+NH+++  +S  V L D TELPAKLVG DA  DLAVLK++SD+ 
Sbjct: 118 ALGSGFIVASDGTIVTNNHVIDGASSIKVTLDDGTELPAKLVGRDAKNDLAVLKIKSDKP 177

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQ 227
              V++ D++ +  G+ V   GNPF +  TV+AGIVSA  RD+   P   F QIDAPIN 
Sbjct: 178 LPTVKWGDSDKLMPGDQVLAFGNPFGIGTTVTAGIVSARGRDLHSGPFDDFIQIDAPINH 237

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP  +  G+V+G+N  I +     +GVG  IP    +K +  L+  G + +G+ G+
Sbjct: 238 GNSGGPLVDVAGNVVGINTAIYSPNGGSVGVGFAIPSDQAQKVVAKLMKGGSIQYGYLGV 297

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T ++A  +GL    G+L++ V   SPA KAG++ GDVI    G+ +K  +D    
Sbjct: 298 QIQEVTPDVASAIGLDHPGGALVSEVNDGSPAAKAGIETGDVITSFAGQDVKDPKDLSRA 357

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD-------KELLGMVLQD 400
           +A  +P     + + ++G    ++V +G +        L+ G           +G+ L D
Sbjct: 358 VADVAPGATETVDVWRKGKPMRISVDVGQNSADAKTASLDDGSDTPSAGRAPAIGLGLMD 417

Query: 401 INDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           I    ++ +         V  + N ++   A GIQ G  IV+VN   V   + V + I +
Sbjct: 418 ITPDIRQQMNLAGKQHGAVVASVNPDKAAAASGIQAGDIIVAVNQVPVKNARQVTQAIAQ 477

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           A +  R SVLL ++          +   ++++ 
Sbjct: 478 AGKSGRKSVLLLVERG--------DAQIYIAVP 502


>gi|115351060|ref|YP_772899.1| protease Do [Burkholderia ambifaria AMMD]
 gi|115281048|gb|ABI86565.1| protease Do [Burkholderia ambifaria AMMD]
          Length = 499

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 126/511 (24%), Positives = 223/511 (43%), Gaps = 44/511 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             +  L       V   C+       V       S  D   ++ +V P++V++       
Sbjct: 1   MTKLTLRNVFAAAVLCACLPLIPHTAVAATPPAASLPDFADLVEKVGPAVVNIRTTANVP 60

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS---------------GEEPILSDTVE 106
           +   +     GF N      +  +FR+ F                           D  +
Sbjct: 61  IPGPRGALPPGFDNGD----MSEFFRRFFGIPLPQAPGNGGGNGNPKNAPAPDNPPDAEQ 116

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+Q+ 
Sbjct: 117 NRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQAS 176

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPIN 226
                V   D+N +RVGE V  IG+PF L  TV+AGIVS+  R+  D    F Q D  +N
Sbjct: 177 NL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAVN 234

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G   
Sbjct: 235 PGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRIA 294

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +    +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D   
Sbjct: 295 VAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGIQPGDIILKFNGRPVETASDLPR 354

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE-------LLGMVLQ 399
            +    P  +  +S+ ++G    + + +  +P        +  +          LG+ + 
Sbjct: 355 MVGDTKPGTKATVSVWRKGQARDLPITIAETPAETTAKAEQRKNTPQKPRQANSLGLTVS 414

Query: 400 DINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
           DI     K +     +       +      G+Q+G  ++ V   +++  K    +  +  
Sbjct: 415 DIPADQMKSLKLKNGVQIDAV--DGPAARAGLQRGDIVLRVGDTDITSAKQFAEVTAQLD 472

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            +K  +VL++            + ++FV ++
Sbjct: 473 SQKAVAVLVR----------RGDNTQFVPVR 493


>gi|153004908|ref|YP_001379233.1| protease Do [Anaeromyxobacter sp. Fw109-5]
 gi|152028481|gb|ABS26249.1| protease Do [Anaeromyxobacter sp. Fw109-5]
          Length = 525

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 147/486 (30%), Positives = 234/486 (48%), Gaps = 33/486 (6%)

Query: 23  SSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK-VSVEQMFNAYGFGNLPEDHP 81
           +S     EA +PP    L P+I +V  ++V++      K      M N +G        P
Sbjct: 48  ASPQQPAEAAVPPQG-SLAPLIEKVKGAVVNISTTTVIKHPQTRGMPNPHGQAPGGRGGP 106

Query: 82  LKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
               F+  F +FF G   P + +       GSGF I+ DG+ILT+NH+V+D     V L+
Sbjct: 107 GDEEFQDFFERFFGGRPAPRMPEEFRGSSLGSGFVISPDGFILTNNHVVQDATDILVRLT 166

Query: 141 DDTELPAKLVGTDALFDLAVLKVQSDRKF-IPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           D  EL A+ VG D   D+A++++ +  K    V   D++ +R G+ V  +G+PF LR T 
Sbjct: 167 DGRELKAETVGRDPATDVALIRLVNPPKDLPNVVLGDSDALRQGDFVLALGSPFGLRDTA 226

Query: 200 SAGIVSALDR---DIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHM 256
           + GIVSA  R   +       F Q DA IN GNSGGP FN  G VIG+N  IV+  Q   
Sbjct: 227 TLGIVSAKHRREVNPTGTYDDFIQTDAAINSGNSGGPLFNLRGEVIGINTAIVSP-QLGS 285

Query: 257 GVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG-LRGTKGSLITAVVK 315
           GVG  +P+++ K  +P L  KG+V  G+ G+   +L ++LA   G     KG+LI AVV 
Sbjct: 286 GVGFAVPINLAKSILPQLREKGKVTRGYVGVSITDLNRDLAQGFGLPPDQKGALIQAVVP 345

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             PA KAG++ GDV+  ++G+ + S  D    +A   P  +V +++ + G K   +  + 
Sbjct: 346 RGPAAKAGVQPGDVVVAVNGKPVTSGGDLTRAVALVQPGSKVDLTVVRSGQKKQFSFAVA 405

Query: 376 SSPTAKNDM--------HLEVGDKELLGMVLQDINDGNKKLVR------IVALNPNRERE 421
             P  +  +                 LG+ L D+     + +       ++  +      
Sbjct: 406 QRPDDEEAIARGQGGEQEEGGDKAPKLGVTLGDLTPQIARQLGIEPGEGVLVRDVAPAGP 465

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSR 481
               GI+ GM IV +N   V  ++DV + I K K+   +  LL+++   D+         
Sbjct: 466 AGRAGIEPGMVIVELNRKPVKTVQDVAQAIAKMKDG--EVALLRVRRGQDLF-------- 515

Query: 482 FVSLKI 487
           +V++ +
Sbjct: 516 YVAVPV 521


>gi|83720454|ref|YP_441231.1| serine protease [Burkholderia thailandensis E264]
 gi|83654279|gb|ABC38342.1| serine protease [Burkholderia thailandensis E264]
          Length = 495

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 133/456 (29%), Positives = 220/456 (48%), Gaps = 21/456 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK--FFS 95
            D   ++    P++V++  +   +   ++   A     +  + P   +FR  + +     
Sbjct: 54  PDFSGLVETYGPAVVNISAKHVVQRVAQR--RAAPQLPIDPEDPFYQFFRHFYGQVPGMG 111

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
           G      D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VGTD  
Sbjct: 112 GGRQPQPDDQPSTSLGSGFIISADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGTDKQ 171

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD  
Sbjct: 172 SDVAVLKIDASGL-PTVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDEN 230

Query: 216 GT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
            T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L
Sbjct: 231 YTPFIQTDVPVNPGNSGGPLFNLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDEL 290

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           +  G V  G  G+  Q L Q LA   GL+   G+L+++V  + PA KAG++ GDVI  +D
Sbjct: 291 VKTGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVD 350

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKEL 393
           G  ++       QIAS  P  +  + + ++ SK +V+V L S    +      E  ++  
Sbjct: 351 GVPVQDSTTLPAQIASMKPGTKADLQIWRDKSKKTVSVTLASLADDQAKAGADEPVEQGR 410

Query: 394 LGMVLQDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           LG+ ++ +    +    +      ++      + GIQ G  I++VN   V+  + +   +
Sbjct: 411 LGVAVRPLLPRERNGTSLTHGLVVQQSTGPAASAGIQPGDVILAVNGRPVTSAEQLRDAV 470

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            +A     +S+ L I+ D        +   FV + +
Sbjct: 471 KRA----GNSLALLIQRD--------DAQIFVPVDL 494


>gi|78067416|ref|YP_370185.1| peptidase S1C, Do [Burkholderia sp. 383]
 gi|77968161|gb|ABB09541.1| Peptidase S1C, Do [Burkholderia sp. 383]
          Length = 494

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 130/456 (28%), Positives = 214/456 (46%), Gaps = 23/456 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVSRRVPQPQL--PIDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF I+ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFVISSDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDASGL-PTVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPNGPAAKAGLQPGDVILSVNGS 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ SK S++V LG+   AK         ++  LG
Sbjct: 352 PVADSTSLPAQIANLKPGSKADLQIWRDKSKKSISVTLGAMADAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKK----LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           + ++ ++   +        ++             GIQ G  I++VN   V+  + +   +
Sbjct: 412 VAVRPLSPQERSADNLSHGLIV--QQAGGPAANAGIQPGDVILAVNGRPVTSPEQLRDAV 469

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             A     +S+ L I+ D        N   FV + +
Sbjct: 470 KGA----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|222054294|ref|YP_002536656.1| protease Do [Geobacter sp. FRC-32]
 gi|221563583|gb|ACM19555.1| protease Do [Geobacter sp. FRC-32]
          Length = 476

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 131/453 (28%), Positives = 217/453 (47%), Gaps = 24/453 (5%)

Query: 32  KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFH 91
           ++  S      +  +V P++V++      KV    +     F    +D PL  +F+++F 
Sbjct: 36  EVNSSFRSFADIAEKVKPAVVNISTTSTVKVPANPLEQ---FLGPNDDSPLSEFFKRNFG 92

Query: 92  KFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVG 151
           +            +++   GSG  I  DG ILT+NH+V++     V LSD  E  AK++G
Sbjct: 93  ENG-------EREMKQQSLGSGSIINKDGLILTTNHVVDNAEEIKVKLSDGREFKAKVIG 145

Query: 152 TDALFDLAVLKVQSDRKF-IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD 210
            DA  DLA++K+ S  +    +   D++ +RVG+ V  +GNPF L  TV+ GI+S   R 
Sbjct: 146 RDAKTDLALIKIASPFENLPVLSLGDSDRMRVGDWVIAVGNPFGLEETVTHGIISGTARV 205

Query: 211 IPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKK 269
           I   P   F Q DAPIN GNSGGP  N  G VIG+N +IV+      G+G  +P ++   
Sbjct: 206 IGSGPYDNFLQTDAPINPGNSGGPLVNVTGEVIGINTIIVSG---GQGLGFAVPSTLASS 262

Query: 270 AIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDV 329
            +  L  KG+V  GW G+  QN++  +A   GL+  KG+LI  V+   PADK GMK GD+
Sbjct: 263 VVDQLKEKGKVVRGWMGVSIQNVSPPIAKAFGLKEPKGALIADVIAGGPADKGGMKSGDI 322

Query: 330 ICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG 389
           I   DG+ IK+  D    +A  +  +++K +  ++G +    + +      +        
Sbjct: 323 ITSFDGKEIKTANDLSRVVAGTAVGKEIKGTAIRDGKEIPFTMKVEELTEERTASKALPP 382

Query: 390 DKELLGMVLQDINDGNKKLV------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
                GM L+D+    ++ +       +V ++       +  GI+ G  +  +N   V  
Sbjct: 383 LHGF-GMKLEDMTPKLREQLKSEEKTGVVVVDVEPGSFADDAGIKPGDVVREINRKPVKN 441

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
           + +      K K+   + +LL +K        +
Sbjct: 442 LAEYRAEAEKIKKG--EPILLLLKRGKQTFYIS 472


>gi|313105588|ref|ZP_07791854.1| serine protease MucD precursor [Pseudomonas aeruginosa 39016]
 gi|310878356|gb|EFQ36950.1| serine protease MucD precursor [Pseudomonas aeruginosa 39016]
          Length = 474

 Score =  205 bits (520), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 136/487 (27%), Positives = 230/487 (47%), Gaps = 29/487 (5%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    K          A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNISTRQKLPDRA----MARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
             ++P+   L   FR    +              E    GSGF I++DGYILT+NH+V D
Sbjct: 59  QLSIPDLEGLPPMFRDFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVAD 118

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V LSD +E  AKL+G D   D+AVLK+++      ++  D+N ++VGE V  IG+
Sbjct: 119 ADEILVRLSDRSEHKAKLIGADPRSDVAVLKIEAKNL-PTLKLGDSNKLKVGEWVLAIGS 177

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T
Sbjct: 178 PFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLEGEVVGINSQIFT 237

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+
Sbjct: 238 RSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALV 297

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+
Sbjct: 298 AQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSL 357

Query: 371 AVVLGSSPTAKND-----MHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREV 422
           ++ +GS P    +               LG+ + D+    +K +     V +   ++   
Sbjct: 358 SMAVGSLPDDDEEIASMGAPGAERSSNRLGVTVADLTAEQRKSLDIQGGVVIKEVQDGPA 417

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
              G++ G  I  ++   V+  K    +     + +  S+ +               + F
Sbjct: 418 AVIGLRPGDVITHLDNKAVTSTKVFADVAKALPKNRSVSMRVL----------RQGRASF 467

Query: 483 VSLKIDK 489
           ++ K+ +
Sbjct: 468 ITFKLAE 474


>gi|218893291|ref|YP_002442160.1| serine protease MucD precursor [Pseudomonas aeruginosa LESB58]
 gi|218773519|emb|CAW29331.1| serine protease MucD precursor [Pseudomonas aeruginosa LESB58]
          Length = 474

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 136/487 (27%), Positives = 230/487 (47%), Gaps = 29/487 (5%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    K          A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNISTRQKLPDRA----MARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
             ++P+   L   FR    +              E    GSGF I++DGYILT+NH+V D
Sbjct: 59  QLSIPDLEGLPPMFRDFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVAD 118

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V LSD +E  AKL+G D   D+AVLK+++      ++  D+N ++VGE V  IG+
Sbjct: 119 ADEILVRLSDRSEHKAKLIGADPRSDVAVLKIEAKNL-PTLKLGDSNKLKVGEWVLAIGS 177

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T
Sbjct: 178 PFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLEGEVVGINSQIFT 237

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+
Sbjct: 238 RSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALV 297

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+
Sbjct: 298 AQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSL 357

Query: 371 AVVLGSSPTAKND-----MHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREV 422
           ++ +GS P    +               LG+ + D+    +K +     V +   ++   
Sbjct: 358 SMAVGSLPDDDEEIASMGAPGAERSSNRLGVTVADLTAEQRKSLDIQGGVVIKEVQDGPA 417

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
              G++ G  I  ++   V+  K    +     + +  S+ +               + F
Sbjct: 418 AVIGLRPGDVITHLDNKAVTSTKIFADVAKALPKNRSVSMRVL----------RQGRASF 467

Query: 483 VSLKIDK 489
           ++ K+ +
Sbjct: 468 ITFKLAE 474


>gi|312795537|ref|YP_004028459.1| Endopeptidase degP [Burkholderia rhizoxinica HKI 454]
 gi|312167312|emb|CBW74315.1| Endopeptidase degP (EC 3.4.21.-) [Burkholderia rhizoxinica HKI 454]
          Length = 503

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 126/499 (25%), Positives = 227/499 (45%), Gaps = 37/499 (7%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           + +   A+   I   +     A    S  D   ++ +V P++V++      +        
Sbjct: 12  RFLLAAAMAICIPLVSPCAAAAPAAASLPDFTDLVDKVGPAVVNIRTTTHAQQQGPIGGL 71

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGE--------------EPILSDTVERLMFGSGFF 115
             G   L +   +  +FR+ F      +              +   SD+ +    GSGF 
Sbjct: 72  PPG---LDDGGDMAEFFRRFFGIPLPQQPGKPNPPRGGGGGEDSDPSDSEQSSGVGSGFI 128

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
           ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+A++K+ +      V   
Sbjct: 129 LSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDERTDVALVKINAASL-PTVTIG 187

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCF 235
           D+N +RVGE V  IG+PF L  TV++GIVSA  RD  D    F Q D  +N GNSGGP  
Sbjct: 188 DSNKVRVGEWVVAIGSPFGLDNTVTSGIVSAKGRDTGDYLP-FIQTDVAVNPGNSGGPLI 246

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G VIG+N+ I +     MG+   IP+    +    L   GRV  G   +    ++++
Sbjct: 247 NMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKVNGRVVRGRIAVAVGEVSKD 306

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           ++  LGL   +G+L+++V  + PADKAG++ GD+I   + R + +  D    +    P  
Sbjct: 307 VSDSLGLPKAQGALVSSVEVDGPADKAGVQPGDIILKFNERTVDTATDLPRMVGETKPGT 366

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL------LGMVLQDINDGNKKLV 409
           +  +++ ++G    ++VV+      K                  LG+ + D++   +K +
Sbjct: 367 RATLTIWRKGQTKDLSVVVAEMQPDKTKAQTSRRTPPRERASNQLGLAVSDLSPAQRKAM 426

Query: 410 RIVALNPNRE--REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
            +V               G+Q+G  I+ +   +V+  K  E L+ +   +K  ++L++  
Sbjct: 427 NLVGGVQVDGVHGPAARAGLQRGDIILRIGDTDVANTKQFESLVQQLDPQKAAALLVR-- 484

Query: 468 YDPDMQSGNDNMSRFVSLK 486
                     + ++FV ++
Sbjct: 485 --------RGDNTQFVPVR 495


>gi|258593847|emb|CBE70188.1| Putative Serine protease do-like precursor [NC10 bacterium 'Dutch
           sediment']
          Length = 494

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 135/450 (30%), Positives = 225/450 (50%), Gaps = 32/450 (7%)

Query: 43  VIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS 102
           +   ++P++V++      K  V+        G   ED P   +F++ F            
Sbjct: 66  LAKELTPAVVNISTTQVVKRGVQS------RGPYSEDDPFNEFFKRFFGD--------QP 111

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
              +    GSGF +  DGYILT+NH+VE+    +V L D  E  AK++G D   D+A++K
Sbjct: 112 RQFKATSLGSGFIVNKDGYILTNNHVVENATDITVKLGDSREFKAKVIGRDPKTDIAIIK 171

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQI 221
           +++      + F +++ + VGE V  IGNPF L  TV+ GIVSA  R I + P   F Q 
Sbjct: 172 IEASGL-PVIPFGNSDRLEVGEPVMAIGNPFGLNQTVTTGIVSAKGRFIGEGPYDNFIQT 230

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           DA IN+GNSGGP  N  G  +G+N  I +     +G+G  IP+ + K+ +P L  +G+V 
Sbjct: 231 DASINRGNSGGPLINTNGEAVGINTAIFSPTGGSIGIGFAIPIEMAKEVLPQLKERGQVT 290

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            GW G+  Q +T +L     L+   G+L++ V++ SPA++AG+K GDVI   DG+ IKS 
Sbjct: 291 RGWLGVAIQPITPDLGKKFSLKQANGALVSDVMEGSPAEQAGVKQGDVIVEFDGKTIKSS 350

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDI 401
            D    +AS    ++V + + ++G+  ++ V +G     +         K  LG+ +Q++
Sbjct: 351 TDLPHMVASTPVGKEVPMKVVRDGADVTLQVKVGELKEEQVAAMAATSPKTKLGIDIQEL 410

Query: 402 NDGNKKLVR------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
                +         +V      +   ++ G+Q G  I+ +N   V+ +  V R++ K K
Sbjct: 411 TPALARKFGLKGEKGVVITEVEPDSPGDSVGLQPGDLILEINRVRVTTVNQVRRVLEKTK 470

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
             +    LL +K D          +R+V +
Sbjct: 471 PDEPT--LLLVKRDGG--------TRYVVI 490


>gi|330502441|ref|YP_004379310.1| protease Do [Pseudomonas mendocina NK-01]
 gi|328916727|gb|AEB57558.1| protease Do [Pseudomonas mendocina NK-01]
          Length = 474

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 142/498 (28%), Positives = 230/498 (46%), Gaps = 35/498 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
            R++ S+  +  VAL         L+ +A LP    D   ++   SP++V++    K   
Sbjct: 1   MRKLKSIAPLLAVAL----LWGQSLLAQASLP----DFTDLVEEASPAVVNISTRQKMPE 52

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGY 121
                    G   LP+   L   FR+ F +              E    GSGF I+ DGY
Sbjct: 53  RAVA-----GQPGLPDLEGLPPMFREFFERSIPQVPRNPGGRQREAQSLGSGFIISPDGY 107

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+V D     V LSD +EL AKL+G D   D+A+LKV+       V    A++++
Sbjct: 108 IMTNNHVVADADEIIVRLSDRSELEAKLIGADPRSDVALLKVEGKDL-PVVRLGKADDLK 166

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGH 240
           VGE V  IG+PF    +V+AGIVSA  R++P D    F Q D  IN GNSGGP FN  G 
Sbjct: 167 VGEWVLAIGSPFGFDHSVTAGIVSAKGRNLPSDSYVPFIQTDVAINPGNSGGPLFNLQGE 226

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           V+G+N+ I T     MG+   IP+ +  +    L + G+V  GW G++ Q + ++LA   
Sbjct: 227 VVGINSQIFTRSGGFMGLSFAIPMEVAMQVADQLKADGKVTRGWLGVVIQEVNKDLAESF 286

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL    G+L+  V+++ PADK G+ VGDVI  L+G+ I    D    +    P E+ ++ 
Sbjct: 287 GLEKPAGALVAQVLEDGPADKGGLLVGDVILSLNGKPIIMSADLPHLVGGLKPGEKAELD 346

Query: 361 LCKEGSKHSVAVVLGSSPTA------KNDMHLEVGDKELLGMVLQDINDGNKKLV---RI 411
           + ++GS+  + V +G+ P                     LG+ + ++    KK +     
Sbjct: 347 VVRDGSRKKLDVTVGTLPEEGQELASSGSAQGAERSNNRLGVTVVELTAEQKKGLDLKGG 406

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V +           G++ G  I  +N   +       ++  +  + +  S+ +       
Sbjct: 407 VVVKEVLNGPAAMIGLRPGDVITHLNNQAIDSTSTFTQVAQELPKNRSVSMRVL------ 460

Query: 472 MQSGNDNMSRFVSLKIDK 489
                   + F++ K+ +
Sbjct: 461 ----RQGRASFITFKLAE 474


>gi|240139404|ref|YP_002963879.1| putative serine protease precursor [Methylobacterium extorquens
           AM1]
 gi|240009376|gb|ACS40602.1| putative serine protease precursor [Methylobacterium extorquens
           AM1]
          Length = 511

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 150/498 (30%), Positives = 243/498 (48%), Gaps = 37/498 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           V    V  ++  L   A+ P     L  +  +V+ ++V++      + S           
Sbjct: 27  VLGVTVTVTALPLPAFARGPE---SLADLADKVTDAVVNISASTTVEASNR---GGRTMP 80

Query: 75  NLPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
            LP+  P ++ F + F +   G     +E     T +    GSGF I   G ++T+NH++
Sbjct: 81  QLPQGTPFEDLFEEFFKRRGQGAPKGDDESPRGPTRKSNSLGSGFIIDASGIVVTNNHVI 140

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI--PVEFEDANNIRVGEAVF 187
            D     VILSD T+L A+++G D+  DLA+L+V+   +     V F D++ +R G+ V 
Sbjct: 141 GDANDIQVILSDGTKLKAEIIGKDSKIDLALLRVKPTAERPLKAVPFGDSDKMRPGDWVM 200

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N 
Sbjct: 201 AIGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINT 260

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG-LRGT 305
            I++     +G+G  +P +   + +  L   G V  GW G+  QN+ +  A  LG   G 
Sbjct: 261 AILSPSGGSVGIGFAVPSATAGQVVDQLRQFGEVRRGWIGVRIQNVDEATAEALGLKGGA 320

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           KG+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G
Sbjct: 321 KGALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKSVDVQVVRKG 380

Query: 366 SKHSVAVVLGSSPTAKN-------DMHLEVGDKELLGMVLQDINDGNKKLVRI------- 411
            + + +VVLG     +            E  ++++LG+ L  +ND  ++   I       
Sbjct: 381 EEQTKSVVLGRLEDGEKAQVANLKQPEAESVNRQVLGLNLSGLNDEVRRRYGIKESVKTG 440

Query: 412 -VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            V    +       K IQ G  IV V    +S   DV + +   K++ R SVLL +    
Sbjct: 441 VVVTKVDPNSTAADKRIQPGEVIVEVGQEAISNPADVTKRVEALKKEGRKSVLLLV---- 496

Query: 471 DMQSGNDNMSRFVSLKID 488
              +  +   RFV++ ++
Sbjct: 497 ---ASTNGDVRFVAIGLE 511


>gi|182678706|ref|YP_001832852.1| protease Do [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634589|gb|ACB95363.1| protease Do [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 522

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 147/515 (28%), Positives = 231/515 (44%), Gaps = 41/515 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSV----DLPPVIARVSPSIVSVMVEP 58
           + + L   S   ++LT  +  +T  +    L  +       L  + A VS ++V++    
Sbjct: 20  RGRALRFGSSLALSLTSGLMLATTSLPPFTLVEAQARGPESLADLSAAVSDAVVNISATQ 79

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP------ILSDTVERLMFGS 112
                            L    P  + F + F +                        GS
Sbjct: 80  TV-----DEKRPGNGPQLEPGTPFDDLFEEFFRRRQQRGGGGGGGAVPRPHERRSNSLGS 134

Query: 113 GFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
           GF I   G I+T+NH++ D    +VI +D  +L A+++G DA  D+AVLKV+ ++    V
Sbjct: 135 GFVIDPAGIIITNNHVIADANEVTVIFTDGQKLKAQVLGKDAKVDVAVLKVKPEKPLKAV 194

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSG 231
           +F D+  +RVG+ V  +GNPF L GTV+AGIVSA +R+I   P   + Q DA IN+GNSG
Sbjct: 195 KFGDSEVMRVGDWVIAVGNPFGLGGTVTAGIVSARNRNIDSGPYDNYIQTDAAINKGNSG 254

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP FN  G VIG+N  I++     +G+G   P S++   +  L   G    GW G+  QN
Sbjct: 255 GPLFNMAGEVIGINTAILSPSGGSIGIGFATPASMVVPIVEQLQKFGETRRGWLGVRIQN 314

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +   +A  L L   +G+LI  V  + PA  AG+  GDVI   DG  IK  +D    +A  
Sbjct: 315 VDDTIAESLNLGTARGALIAGVDDKGPAKSAGLSAGDVIVKFDGTAIKESRDLPKLVAMA 374

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE----------LLGMVLQDI 401
           +  + V + L ++G + +  V LG     +    L   D++          +LGM L  +
Sbjct: 375 AVGKDVPVVLIRQGKEITKNVKLGRLEDNEKQASLNTPDRDESALGSASQRVLGMSLSAL 434

Query: 402 NDGNKKLV--------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
            D  ++           +V  + + E     K IQ G  +V +N   V    ++ + +  
Sbjct: 435 TDEARQKFAIRDTVASGVVITDVDPESAAAEKHIQPGELVVEINQDAVKTPAEINKKLQS 494

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            KE+ + S LL +              RFV+L I 
Sbjct: 495 LKEQGKKSALLLVSNG-------QGEVRFVALAIP 522


>gi|116048682|ref|YP_792518.1| serine protease MucD precursor [Pseudomonas aeruginosa UCBPP-PA14]
 gi|12963467|gb|AAK11276.1|AF343973_1 MucD [Pseudomonas aeruginosa]
 gi|115583903|gb|ABJ09918.1| serine protease MucD precursor [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 474

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 136/487 (27%), Positives = 230/487 (47%), Gaps = 29/487 (5%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
           C  A+  ++  S  +   A+LP    D  P++ + SP++V++    K          A G
Sbjct: 7   CMAAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNISTRQKLPDRA----MARG 58

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
             ++P+   L   FR    +              E    GSGF I++DGYILT+NH+V D
Sbjct: 59  QLSIPDLEGLPPMFRDFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVAD 118

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
                V LSD +E  AKLVG D   D+AVLK+++      ++  D+N ++VGE V  IG+
Sbjct: 119 ADEILVRLSDRSEHKAKLVGADPRSDVAVLKIEAKNL-PTLKLGDSNKLKVGEWVLAIGS 177

Query: 192 PFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T
Sbjct: 178 PFGFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLEGEVVGINSQIFT 237

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
                MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+
Sbjct: 238 RSGGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALV 297

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
             +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+
Sbjct: 298 AQLVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSL 357

Query: 371 AVVLGSSPTAKND-----MHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREV 422
           ++ +G+ P    +               LG+ + D+    +K +     V +   ++   
Sbjct: 358 SMAVGNLPDDDEEIASMGAPGAERSSNRLGVTVADLTAEQRKSLDIQGGVVIKEVQDGPA 417

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
              G++ G  I  ++   V+  K    +     + +  S+ +               + F
Sbjct: 418 AVIGLRPGDVITHLDNKAVTSTKIFADVAKALPKNRSVSMRVL----------RQGRASF 467

Query: 483 VSLKIDK 489
           ++ K+ +
Sbjct: 468 ITFKLAE 474


>gi|92113752|ref|YP_573680.1| peptidase S1C, Do [Chromohalobacter salexigens DSM 3043]
 gi|91796842|gb|ABE58981.1| Peptidase S1C, Do [Chromohalobacter salexigens DSM 3043]
          Length = 478

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 136/491 (27%), Positives = 232/491 (47%), Gaps = 33/491 (6%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
            +      L  +   +  L     LP    D   ++   +P +V++      +       
Sbjct: 5   ARHTTLWCLALLTLFTAQLAQARDLP----DFTQLVKDAAPGVVNISTTSTVESRGM-AG 59

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV---ERLMFGSGFFITDDGYILTS 125
           + +G  ++P      + FR  F        P         ER   GSGF I+ DGYI+T+
Sbjct: 60  SPFGSQDVP------DIFRHFFGDQMPPMIPGAPGYGGSEERHSLGSGFVISRDGYIMTN 113

Query: 126 NHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
            H+V+      V L+D  EL A LVG D   D+AVLKV +D     +E  D++ + VGE 
Sbjct: 114 AHVVDGADEIVVRLNDRRELEATLVGADKKTDVAVLKVDADDL-PVLEMGDSDALEVGEW 172

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  IG+PF    +V++GIVSA+DR +P      F Q D  IN GNSGGP FN  G V+G+
Sbjct: 173 VAAIGSPFGFDHSVTSGIVSAIDRTLPSDAYVPFIQTDVAINPGNSGGPLFNLDGEVVGI 232

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N+ I T     MGV   IP+++       L   G V+ GW G++ Q ++++LA   GL G
Sbjct: 233 NSQIYTRSGGFMGVSFAIPINVAMDIADQLKDSGHVNRGWLGVVIQPVSRDLAESFGLDG 292

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
            +G+LI+ V  +SPA +AG++ GDV+  ++   ++        +   +P E + +++ ++
Sbjct: 293 PRGALISDVTDDSPASRAGLEAGDVVLSVNDDRVEDSSSLPRLVGRVAPGEDITLTVMRD 352

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGDKE---LLGMVLQDINDGNKKLV----RIVALNPN 417
           G +  + V +GS P     +       +    LG+ + D+++  ++ +     ++    +
Sbjct: 353 GERRDLDVTVGSWPDEGKAVTGTSKKDDSQVRLGIAISDLDEPMRRQLDVDSGVLVRQVD 412

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
                 A G+ +G  IVS N  ++     +   +  A   +  +V ++I  D        
Sbjct: 413 PRGAAAAAGLSRGDVIVSFNGQDIEDTDALMEAVKDAPTDR--AVPVRIVRD-------- 462

Query: 478 NMSRFVSLKID 488
             S FV+L+++
Sbjct: 463 GQSLFVALRLE 473


>gi|146281611|ref|YP_001171764.1| serine protease MucD precursor [Pseudomonas stutzeri A1501]
 gi|145569816|gb|ABP78922.1| serine protease MucD precursor [Pseudomonas stutzeri A1501]
 gi|327479790|gb|AEA83100.1| serine protease MucD precursor [Pseudomonas stutzeri DSM 4166]
          Length = 473

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 136/495 (27%), Positives = 227/495 (45%), Gaps = 33/495 (6%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE 65
           +L+  S         +F    +       P   D  P++   SP++V++  + K      
Sbjct: 1   MLNRNSCFAFVAGLALFGQAVVAQAQAALP---DFTPLVENASPAVVNISTKQKVPTRGA 57

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVERLMFGSGFFITDDGYIL 123
                     +PE   L   FR+ F +        P      E    GSGF I+DDGY+L
Sbjct: 58  TA-------QIPELEGLPPIFREFFERSIPQMPGAPGQGQQREAQSLGSGFIISDDGYVL 110

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+NH+V       V L D +EL AKL+G D   D+AVLKV+       V+   ++ ++ G
Sbjct: 111 TNNHVVAGADEIIVRLPDRSELEAKLIGADPRSDVAVLKVEGKGL-PTVKIGRSDELKAG 169

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVI 242
           E V  IG+PF    TV+AGIVSA  R +P+     F Q D  IN GNSGGP FN  G VI
Sbjct: 170 EWVLAIGSPFGFDHTVTAGIVSATGRSLPNESYVPFIQTDVAINPGNSGGPLFNLKGEVI 229

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N+ I T     MG+   IP+ +       L + G+V+ GW G++ Q + ++LA   GL
Sbjct: 230 GINSQIFTRSGGFMGLSFAIPIDVAMDVANQLRTDGKVNRGWLGVVIQEVNKDLAESFGL 289

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
               G+L+  V+   PA ++G++VGDVI  L+G+ I    D    + +  P  + ++ + 
Sbjct: 290 ERPAGALVAQVMDGGPAARSGLRVGDVILSLNGKPIVMSADLPHLVGALKPGSKARMEVV 349

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVGDKE----LLGMVLQDINDGNKKLV----RIVAL 414
           ++G + ++ V +G+ P     +    G +E     LG+ + ++ +  KK +     +V  
Sbjct: 350 RDGDRKTLDVSIGAMPEEGEAVAASGGGQERSDNRLGVKVTELTEEQKKSLDLPGGVVIT 409

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
                      G++ G  I  +N   ++      R+  +  + +  S+ +          
Sbjct: 410 EIL-NGPAAMIGLRPGDVITHLNNQAINSAATFSRVAEQLPKNRSVSMRVL--------- 459

Query: 475 GNDNMSRFVSLKIDK 489
                + F++ K+ +
Sbjct: 460 -RQGRASFITFKLAE 473


>gi|292491274|ref|YP_003526713.1| protease Do [Nitrosococcus halophilus Nc4]
 gi|291579869|gb|ADE14326.1| protease Do [Nitrosococcus halophilus Nc4]
          Length = 482

 Score =  204 bits (518), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 145/493 (29%), Positives = 228/493 (46%), Gaps = 35/493 (7%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
             +    L   + +         L  +      V  +VSPS+V + VE   +      F 
Sbjct: 8   LFLWVAFLALPVHALEGDGGVESLRQTGKAFAAVARQVSPSVVFIQVETTHEGRAPTPFG 67

Query: 70  AYGFGNLPEDHPL-KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-------DDGY 121
                   ++ P    +FR+ F + FS  +         +  GSGF  +       D  Y
Sbjct: 68  --------DEWPFGDEFFRRFFGEPFSPPQEEPRGQRRAISQGSGFVFSSKKGLLSDKTY 119

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           ILT+NH+VE      V   D  E  A++VGTD   ++AV++++       +++ D++ + 
Sbjct: 120 ILTNNHVVEGADKIRVQFQDGREFDAEIVGTDPKSEIAVIEIEVGGL-PALQWGDSSKLE 178

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRD--IPDRPGTFTQIDAPINQGNSGGPCFNALG 239
           VGE V  +GNPF L  T++ G+VSA  R          F Q DA IN GNSGGP  N  G
Sbjct: 179 VGEWVVALGNPFGLSHTLTVGVVSAKGRTSLGISDYEDFIQTDAAINPGNSGGPLVNLDG 238

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIGVN  I +    +MGVG  IP S+ K     LI  G V  G+ GI+ Q LT ELA  
Sbjct: 239 KVIGVNTAIFSRSGGYMGVGFAIPSSLAKIIADQLIETGEVIRGYLGIVIQPLTAELAES 298

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL+ ++G L+  V ++SPA KAG+K GDVI    G+ +K   DF  ++A   P  +  +
Sbjct: 299 FGLKQSQGILVAQVSEDSPAAKAGLKQGDVIISYQGKSVKDIGDFRNRVALTPPGSREAL 358

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV------RIVA 413
           +L ++G +  V V +G     +          E LG+ +Q +     +         +V 
Sbjct: 359 TLLRDGKQREVKVTIGELSKTQTLAQGPAQTAEELGLAVQTLTPELARQFDAKAGEGVVV 418

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
                       GI+ G  I+ VN   V+  ++ +R + ++++ +R  VLL ++      
Sbjct: 419 TGVKAGSIAAMAGIRPGNVILQVNRKPVNSAEEFDRAVKESRDDRR--VLLLVR------ 470

Query: 474 SGNDNMSRFVSLK 486
             + +M R+V L+
Sbjct: 471 --SGDMQRYVVLR 481


>gi|206561166|ref|YP_002231931.1| subfamily S1B serine peptidase [Burkholderia cenocepacia J2315]
 gi|198037208|emb|CAR53129.1| serine peptidase, subfamily S1B [Burkholderia cenocepacia J2315]
          Length = 494

 Score =  204 bits (518), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 129/456 (28%), Positives = 212/456 (46%), Gaps = 23/456 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    +         +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVARRAPQPQL--PIDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIVSSDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDASGL-PIVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDANGPAAKAGLQPGDVILSVNGS 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ SK S+ V LG+   AK         ++  LG
Sbjct: 352 PVADSTSLPAQIANLKPGSKADLQIWRDKSKKSITVTLGAMADAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKK----LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           + ++ ++   +        ++             GIQ G  I++VN   V+  + +   +
Sbjct: 412 VAVRPLSPQERSADNLSHGLIV--QQAGGPAANAGIQPGDVILAVNGRPVTSPEQLRDAV 469

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             A     +S+ L I+ D        N   FV + +
Sbjct: 470 KGA----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|116690636|ref|YP_836259.1| protease Do [Burkholderia cenocepacia HI2424]
 gi|170733980|ref|YP_001765927.1| protease Do [Burkholderia cenocepacia MC0-3]
 gi|254247343|ref|ZP_04940664.1| Peptidase S1 [Burkholderia cenocepacia PC184]
 gi|116648725|gb|ABK09366.1| protease Do [Burkholderia cenocepacia HI2424]
 gi|124872119|gb|EAY63835.1| Peptidase S1 [Burkholderia cenocepacia PC184]
 gi|169817222|gb|ACA91805.1| protease Do [Burkholderia cenocepacia MC0-3]
          Length = 493

 Score =  204 bits (518), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 129/456 (28%), Positives = 213/456 (46%), Gaps = 23/456 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    +         +    P   +F+  + +     
Sbjct: 54  PDFSGLVETYGPAVVNISAKHVVKQVSRRAPQPQL--PIDPSDPFYQFFKHFYGQVPGMG 111

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 112 GDAQPDDQPSASLGSGFIVSADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 171

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 172 VAVLKIDASGL-PTVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 230

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 231 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 290

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 291 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPNGPAAKAGLQPGDVILSVNGS 350

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ SK S++V LG+   AK         ++  LG
Sbjct: 351 PVADSTSLPAQIANLKPGSKADLQIWRDKSKKSISVTLGAMADAKLASNDGGPVEQGRLG 410

Query: 396 MVLQDINDGNKK----LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           + ++ ++   +        ++             GIQ G  I++VN   V+  + +   +
Sbjct: 411 VAVRPLSPQERTADNLSHGLIV--QQAGGPAANAGIQPGDVILAVNGRPVTSPEQLRDAV 468

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             A     +S+ L I+ D        N   FV + +
Sbjct: 469 KGA----GNSLALLIQRD--------NAQIFVPVDL 492


>gi|107023553|ref|YP_621880.1| peptidase S1C, Do [Burkholderia cenocepacia AU 1054]
 gi|105893742|gb|ABF76907.1| Peptidase S1C, Do [Burkholderia cenocepacia AU 1054]
          Length = 493

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 129/454 (28%), Positives = 213/454 (46%), Gaps = 19/454 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    +         +    P   +F+  + +     
Sbjct: 54  PDFSGLVETYGPAVVNISAKHVVKQVSRRAPQPQL--PIDPSDPFYQFFKHFYGQVPGMG 111

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 112 GDAQPDDQPSASLGSGFIVSADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 171

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 172 VAVLKIDASGL-PTVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 230

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 231 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 290

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 291 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPNGPAAKAGLQPGDVILSVNGS 350

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ SK S++V LG+   AK         ++  LG
Sbjct: 351 PVADSTSLPAQIANLKPGSKADLQIWRDKSKKSISVTLGAMADAKLASNDGGPVEQGRLG 410

Query: 396 MVLQDINDGNKKLVRI--VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ ++   +    +    +           GIQ G  I++VN   V+  + +   +  
Sbjct: 411 VAVRPLSPQERTADNLSHDLIVQQAGGPAANAGIQPGDVILAVNGRPVTSPEQLRDAVKG 470

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 471 A----GNSLALLIQRD--------NAQIFVPVDL 492


>gi|114569493|ref|YP_756173.1| protease Do [Maricaulis maris MCS10]
 gi|114339955|gb|ABI65235.1| protease Do [Maricaulis maris MCS10]
          Length = 506

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 149/510 (29%), Positives = 255/510 (50%), Gaps = 41/510 (8%)

Query: 4   RQILSVKSICTVALTCVIF-----SSTYLVLEAKLPPSS--------VDLPPVIARVSPS 50
           R++  V  +   AL             Y V  ++ PP +        +    +I  VSPS
Sbjct: 8   RRLGGVSLLVLSALAAGSLLDRSMGEAYAVQSSEAPPLAAAVPAGAPLSFADLIETVSPS 67

Query: 51  IVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMF 110
           +V+V V    + S       +G GN P+   L    R+   + F G+         R   
Sbjct: 68  VVTVQVSGLVESS------PFGGGNGPDLDNLPPQMREWMERQFGGQ-RQAPQPQPRQSL 120

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGFFI+ DGY++T++H+V +    ++  ++  E PA+++GTD   DLA+LKV  +  F 
Sbjct: 121 GSGFFISADGYLVTNHHVVANADEITIGTAEGEEFPARVIGTDPQTDLALLKVDGETDFP 180

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD-RPGTFTQIDAPINQGN 229
            V  E+  N RVG+ V  +GNPF L GT +AGI+SA+ R I +     F Q DA IN+GN
Sbjct: 181 FVRLEENPNYRVGDWVVAVGNPFGLGGTATAGIISAIGRPIGNSTYNDFIQTDASINRGN 240

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F+  G+VIGVN+ I +    ++G+G  IP  +  + +  L   GRV  GW G+  
Sbjct: 241 SGGPTFDLNGNVIGVNSQIFSPSGGNVGIGFAIPSDVAARIVGDLRDDGRVARGWLGVSI 300

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           QN+T+++A  LGL GT G++I+++V+  PAD+AG +  DV+  +DG  +   +D   ++ 
Sbjct: 301 QNVTEDIAEALGLEGTTGAIISSIVEGGPADRAGFEREDVVLEIDGEAVDGSRDLTRRVG 360

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-----NDMHLEVGDKELLGMVLQDINDG 404
           +      V+  + ++G + ++   LG  P  +     + +        + GM +  + + 
Sbjct: 361 NIQAGGDVRFLVLRDGRERTIRATLGDRPGEEQLASMSSVDAAPARTSVFGMSMAPLAEE 420

Query: 405 NKKL-------VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK 457
           ++++         +V        E   KG+Q G  I+    + V+  + +  +  +A+E 
Sbjct: 421 DREVRGLGAEVSGVVVDEIEPGSEAARKGVQVGDIILEAGGNSVADAEALRAIADEARED 480

Query: 458 KRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            R ++LL ++       G     R+V+L++
Sbjct: 481 GRSAILLLVE-------GRGGQ-RYVALQL 502


>gi|296390884|ref|ZP_06880359.1| serine protease MucD precursor [Pseudomonas aeruginosa PAb1]
          Length = 467

 Score =  204 bits (517), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 136/485 (28%), Positives = 229/485 (47%), Gaps = 29/485 (5%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
            A+  ++  S  +   A+LP    D  P++ + SP++V++    K          A G  
Sbjct: 2   AAMVALLALSLAMTARAELP----DFTPLVEQASPAVVNISTRQKLPDRA----MARGQL 53

Query: 75  NLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
           ++P+   L   FR    +              E    GSGF I++DGYILT+NH+V D  
Sbjct: 54  SIPDLEGLPPMFRDFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVADAD 113

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
              V LSD +E  AKL+G D   D+AVLK+++      ++  D+N ++VGE V  IG+PF
Sbjct: 114 EILVRLSDRSEHKAKLIGADPRSDVAVLKIEAKNL-PTLKLGDSNKLKVGEWVLAIGSPF 172

Query: 194 RLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
               +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T  
Sbjct: 173 GFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQIFTRS 232

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+  
Sbjct: 233 GGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALVAQ 292

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+++
Sbjct: 293 LVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSLSM 352

Query: 373 VLGSSPTAKND-----MHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREVEA 424
            +GS P    +               LG+ + D+    +K +     V +   ++     
Sbjct: 353 AVGSLPDDDEEIASMGAPGAERSSNRLGVTVADLTAEQRKSLDIQGGVVIKEVQDGPAAV 412

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVS 484
            G++ G  I  ++   VS  K    +     + +  S+ +               + F++
Sbjct: 413 IGLRPGDVITHLDNKAVSSTKIFADVAKALPKNRSVSMRVL----------RQGRASFIT 462

Query: 485 LKIDK 489
            K+ +
Sbjct: 463 FKLAE 467


>gi|309781182|ref|ZP_07675919.1| MucD serine protease MucD [Ralstonia sp. 5_7_47FAA]
 gi|308920003|gb|EFP65663.1| MucD serine protease MucD [Ralstonia sp. 5_7_47FAA]
          Length = 503

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 136/512 (26%), Positives = 231/512 (45%), Gaps = 52/512 (10%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLE------AKLPPSSVDLPPVIARVSPSIVSVMVE 57
           R + +++ +C  A   V  + T    +      A       D   ++ +VSP++V++   
Sbjct: 5   RSVHALRLLCVAAALAVGSALTPAHAQNATGSVATGTYGLPDFADLVEKVSPAVVNIRTT 64

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE---------PILSDTVERL 108
            K ++              P D  +  +FR+ F     G           P   +  +  
Sbjct: 65  EKVRMQQ----------GGPNDDDMAEFFRRFFGVPMPGMPGQGQKRRNAPPQQEEEQSR 114

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF I+ DGYILT+ H+VE   +  V L D  E  AKL+G D   D+A++KV+    
Sbjct: 115 GVGSGFIISGDGYILTNAHVVEGAETIYVTLIDKREYKAKLIGLDKRTDVALVKVE-ATG 173

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQG 228
              ++  D++ +RVGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D  +N G
Sbjct: 174 LPSLKLGDSDKVRVGEWVLAIGSPFGLDNTVTAGIVSAKGRDTGDYLP-FIQSDVAVNPG 232

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP  N  G VIG+N  I +    +MG+   IP+    +    L + GRV  G  G+ 
Sbjct: 233 NSGGPLINLRGEVIGINNQIYSQSGGYMGISFSIPIDEAMRVAEQLKATGRVTRGRIGVA 292

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
             N+ ++ A  LGL   +G+ +  V    PADKAG++ GD++   +GR I+   D   Q+
Sbjct: 293 IDNVPKDAAESLGLGRARGAYVGNVESGGPADKAGIEAGDIVLKYNGRDIEKAGDLQRQV 352

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-----------KNDMHLEVGDKELLGMV 397
               P  +  + + ++G+   + V +                  ++     G    LG+V
Sbjct: 353 GETKPGTRATVQVWRKGATRDLTVTVAELQADTKVAQRSKGAQPDNSQQGPGKPNALGLV 412

Query: 398 LQDINDGNKKLVR---IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           + D++DG ++  +    V +  +        GI+ G  I+ V   +V+  K    ++ + 
Sbjct: 413 VSDLSDGARREFKTKSGVEVQVSEG-PAARVGIRPGDLILRVGDTDVTNAKQFNEVVARL 471

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            + +  +V ++            + ++ V+L+
Sbjct: 472 DKNRMVAVFVR----------RGDATQVVTLR 493


>gi|296114530|ref|ZP_06833183.1| protease Do [Gluconacetobacter hansenii ATCC 23769]
 gi|295978886|gb|EFG85611.1| protease Do [Gluconacetobacter hansenii ATCC 23769]
          Length = 530

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 141/483 (29%), Positives = 227/483 (46%), Gaps = 36/483 (7%)

Query: 30  EAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV-----SVEQMFNAYGFGNLPEDHPLKN 84
            A    +      + AR+ P++V+V      +        ++  ++    N PE  P + 
Sbjct: 55  PAPGHDTPDSFADLAARLLPAVVNVSTTEMVRPGDEDDDGDEGDSSPQIPNFPEGSPFEK 114

Query: 85  YFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
           +F    ++  +   P      +    GSGF I   G ++T+NH+V +    +V L D+T 
Sbjct: 115 FFHDFMNRQSTPNAPP----RKMQALGSGFIIDPAGIVVTNNHVVRNAEQITVTLQDNTV 170

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
           L A L+G D   DLAVLKV S +    V F D+++ RVG+ V  IGNPF L GTV+AGI+
Sbjct: 171 LKAHLLGHDDRTDLAVLKVDSPKPLPAVPFGDSDHARVGDWVLAIGNPFGLSGTVTAGII 230

Query: 205 SALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           S+  R+I   P   F Q DAPIN+GNSGGP FN  G VIG+N  I +     +G+G  IP
Sbjct: 231 SSRGRNIEQGPYDDFIQTDAPINKGNSGGPLFNLHGDVIGINTAIFSPSGGSIGIGFAIP 290

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
            +  +  I  L   G+V  GW G+  Q++TQ++A  LGL+   G+LI  V  + PA  A 
Sbjct: 291 SAEAQGIIAQLRQHGKVSRGWIGVRIQDVTQDIADGLGLKSAHGALIAGVEAKGPAAVAH 350

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND 383
           ++ GDVI  LDG+ I   +     +A         + + +     +VA+ +G+ P  K D
Sbjct: 351 LQTGDVIVTLDGKDI-DGRALPRLVAQLPAGSVAHLGIVRHDHPMNVAITIGALPEEKTD 409

Query: 384 MHLEVGDKE----------LLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKG 426
                  ++           LG  +  I+D  ++          +V      +     +G
Sbjct: 410 KADGKPAQKTPASGSVAVAGLGFTVGAIDDIARQKYNMPEGQKGVVVTGVTDDSPAAERG 469

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           ++ G  I  V    V+   +++  I   + +KR +VL  ++        N +  R+V   
Sbjct: 470 LRNGDIITEVQQTAVNTPAELKHQIDLVRAQKRRTVLFLVQ--------NSDGLRWVPFP 521

Query: 487 IDK 489
           + +
Sbjct: 522 LAE 524


>gi|149926457|ref|ZP_01914718.1| subfamily S1C unassigned peptidase [Limnobacter sp. MED105]
 gi|149824820|gb|EDM84034.1| subfamily S1C unassigned peptidase [Limnobacter sp. MED105]
          Length = 491

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 125/491 (25%), Positives = 215/491 (43%), Gaps = 32/491 (6%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
           +    L  ++F+ +             D   ++ RV P++V++    K   + +      
Sbjct: 14  MAFFLLATLLFAGSIPAHAQANSRGLPDFSDLVDRVGPAVVNIRTTQKVSQNPQ---GFP 70

Query: 72  GFGNLPEDHPLKNYFRKDFHK--FFSGEEPILSDTVE-------RLMFGSGFFITDDGYI 122
           GF  +  + P   +FR+         G+        +           GSGF I  DGY+
Sbjct: 71  GFPGMDPNDPFFEFFRRFMPPGTPMPGQPGQAPRGGQQAPEREVPSGVGSGFVIDSDGYL 130

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           LT++H+V+   S  V   D  E   K++G+D   D+A++K++       ++  + NN +V
Sbjct: 131 LTNHHVVDGAESIIVTFPDKREFKGKVIGSDQRTDVALVKIEGKNL-PFLKIGNVNNTKV 189

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVI 242
           G+ V  IG+PF L  +V+AGIVSA  RD  +    F Q D  +N GNSGGP  N  G VI
Sbjct: 190 GQWVVAIGSPFGLENSVTAGIVSAKGRDTGEYLP-FIQTDVAVNPGNSGGPLLNLDGEVI 248

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N+ I +     MG+   IP+    +    L   G+V  G  G+    + +++A  LGL
Sbjct: 249 GINSQIYSRTGGFMGISFAIPIDEAMRVAKQLRENGKVSRGRIGVGIGEVDKDVAKALGL 308

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
               G+L+ +V K+SPADKAG+  GD+I   DG+ ++   D    +    P  +V + L 
Sbjct: 309 DSAVGALVGSVGKDSPADKAGVIAGDIILRFDGKKVEKASDLPRIVGETKPGSKVNMVLW 368

Query: 363 KEGSKHSVAVVLGSSPTAKNDMHLEVG------DKELLGMVLQDINDGNKKLVRIVALNP 416
           ++G++ +V++ +    T                + + LG+ + D     K  + +     
Sbjct: 369 RKGAEKTVSITVAEFETEAAKPAAAPAEKPKPVEADKLGLTVTDPTGQEKSTLNLAGGVV 428

Query: 417 NRE--REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
                    A GI  G  I+ V   +++  K    L+    + +   +L++         
Sbjct: 429 VHNAVGMAAAAGITAGDVILRVGRTDITSAKQFADLVKAIPKGQAAPMLVR--------- 479

Query: 475 GNDNMSRFVSL 485
                S FV L
Sbjct: 480 -RGENSFFVVL 489


>gi|126667171|ref|ZP_01738145.1| serine protease MucD precursor [Marinobacter sp. ELB17]
 gi|126628327|gb|EAZ98950.1| serine protease MucD precursor [Marinobacter sp. ELB17]
          Length = 490

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 127/481 (26%), Positives = 217/481 (45%), Gaps = 16/481 (3%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           RQ  ++ +    AL         +  +A       D   ++   + ++V++        +
Sbjct: 11  RQSTNLVTSMWAALLATSLMILLVWSQATQARGLPDFTELVEDNAGAVVNISTTSAAPEN 70

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYIL 123
             +  N        E  P   +F+  F +      P           GSGF ++ DGY+L
Sbjct: 71  TSRFQNLPFDERQLEQMP--EFFQDFF-RGPGSGNPHGGRAQPTQSMGSGFIVSRDGYVL 127

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+NH+VE      V L+D  ELPA+L+GTD   D+AVLK+++      V+   + +++VG
Sbjct: 128 TNNHVVEGADEIIVRLNDRRELPARLIGTDPRSDMAVLKIENGDDLPVVQVGKSKDLKVG 187

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVI 242
           E VF IG+PF    TV+AGIVSAL R +P      F Q D  IN GNSGGP FN  G VI
Sbjct: 188 EWVFAIGSPFGFDYTVTAGIVSALGRSLPSENYVPFIQTDVAINPGNSGGPLFNMDGDVI 247

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N+ I T     MGV   IP+         +   G V  GW G++ Q +  +LA   GL
Sbjct: 248 GINSQIYTRSGGFMGVSFAIPIDDAMSVFRQIRDNGSVSRGWLGVLIQEVNLDLAESFGL 307

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
           +  +G+L+  V+  SPA+ AG++ GD++   DG  ++   +    +      E  ++++ 
Sbjct: 308 KRPRGALVAEVLGGSPAEAAGLQSGDIVLAYDGEELQLSSELPPMVGRTPIGESARLTVL 367

Query: 363 KEGSKHSVAVVLGSSPT-----AKNDMHLEVGDKELLGMVLQDI----NDGNKKLVRIVA 413
           + G++ S+ V +G  P      A++          L G+ ++ +     D       +  
Sbjct: 368 RGGNEMSIDVKIGQLPDERGAQAQSPATPGDSASSLFGLSVEPLPANMTDAQGVSAGVFV 427

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           ++  +       GI+    I  ++   V+ + D   + G   + +  +V +++       
Sbjct: 428 VDV-QGGPAFDAGIRPNDVITEIDRKAVTSVADFRNIAGNLADDR--AVPVRVVRQGRAL 484

Query: 474 S 474
            
Sbjct: 485 Y 485


>gi|182679196|ref|YP_001833342.1| protease Do [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635079|gb|ACB95853.1| protease Do [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 529

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 158/504 (31%), Positives = 236/504 (46%), Gaps = 32/504 (6%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKL-----------PPSSV-----DLPPVIARVS 48
           + + + +   VALT     S  L   A             P SS          V+  V 
Sbjct: 29  RAILLGATAAVALTGAFTHSVLLPQAANAETPTLNVPVNAPNSSPVVGPVSFADVVDHVR 88

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERL 108
            ++VSV V+  +    E+              PL+ +FR+   +                
Sbjct: 89  GAVVSVKVKITETADNEEANTGNDMPQFAPGDPLERFFRRFGEQGGVPFNKHSGKPRTGQ 148

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF I+ DGY++T+NH+VE+    S+       L A +VGTD   DLA+LK+     
Sbjct: 149 AQGSGFIISSDGYVVTNNHVVENATEVSLTTDGGQTLTASVVGTDKKTDLALLKINGSGT 208

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQ 227
           +  V+       RVGE V  +GNPF L GTV+AGI+SA  RDI   P   F Q+DAP+N+
Sbjct: 209 YPFVK-FSNETPRVGEWVIAVGNPFGLGGTVTAGIISARGRDIGAGPYDDFLQVDAPVNR 267

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP FNA G V+GVN  I +     +G+G  IP  + +  I SL  KG V  GW G+
Sbjct: 268 GNSGGPTFNAKGDVVGVNTAIFSPSGGSVGIGFAIPAEVAQNVITSLREKGTVARGWIGV 327

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T E+A  LGL+ +KG+L+      SPA  AG++ GDVI  +DG  I   ++   +
Sbjct: 328 QIQPVTAEIADSLGLKTSKGALVAEAQPNSPALSAGIRSGDVILGVDGERIDGPRELARK 387

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL-----LGMVLQDIN 402
           IA+  P +   +    +GS+ +VAV LG+ P  K          +      LG+ L    
Sbjct: 388 IAALGPGKSTNLMYWHDGSEKTVAVKLGNLPNDKEAKADITTRPDKNVLGDLGLTLAPAA 447

Query: 403 D-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
                    +V  + + +     KG++ G  I+    H VS   ++   +  AK+  R +
Sbjct: 448 QVPGAGDEGVVVSDIDPDGVAAQKGLRVGDVILEAGGHAVSRPAEIGATLSTAKKDGRKA 507

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSL 485
           VL+++K        N   +R+V+L
Sbjct: 508 VLMRVK--------NREGTRYVAL 523


>gi|83644628|ref|YP_433063.1| serine protease MucD precursor [Hahella chejuensis KCTC 2396]
 gi|83632671|gb|ABC28638.1| serine protease MucD precursor [Hahella chejuensis KCTC 2396]
          Length = 469

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 142/481 (29%), Positives = 219/481 (45%), Gaps = 32/481 (6%)

Query: 18  TCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLP 77
             ++   + +V          D   ++ R SP++V++    K      Q +        P
Sbjct: 9   AVLLVWLSAVVSMRAGAVDLPDFTGLVERTSPAVVNISTVRKVGDDSAQYY-----FGGP 63

Query: 78  EDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSV 137
           E   +  +FR  F   +    P      E    GSGF ++ DGYILT+NH+V       V
Sbjct: 64  EQDQIPEFFRHFFGDPYRRRGPQ-----EAQSTGSGFIVSKDGYILTNNHVVAGADEIFV 118

Query: 138 ILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRG 197
            L D  EL AKL+G+D   DLAVLKV++D     +    ++ ++VGE V  IG+PF    
Sbjct: 119 RLMDRRELTAKLIGSDEKSDLAVLKVEADDL-PVLNLGKSSELKVGEWVVAIGSPFGFEY 177

Query: 198 TVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHM 256
           TV+AGIVSA  R +P+     F Q D  IN GNSGGP FN  G V+G+N+ I T     M
Sbjct: 178 TVTAGIVSAKGRSLPNENYVPFIQTDVAINPGNSGGPLFNLEGEVVGINSQIYTRSGGFM 237

Query: 257 GVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKE 316
           GV   IP+ +    +  L   G V  GW G++ Q + ++LA    L   +G+L+  V+K 
Sbjct: 238 GVSFAIPIDVALDVMNQLKDTGAVKRGWLGVLIQEVNKDLAESFNLNKPRGALVAQVMKG 297

Query: 317 SPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGS 376
           SPADKAG++ GDVI   +G  I    +    +   SP ++  + + + G +  VAV +G 
Sbjct: 298 SPADKAGLQPGDVIVSYNGNEIGLSSELPHLVGRTSPGQKASMKVVRRGDEMDVAVEIGQ 357

Query: 377 SPTAKNDMHLEVGDK-----ELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGI 427
            P   N +      +       L + ++D+ D  K+ +     ++             GI
Sbjct: 358 LPADDNGVASVPAGQTAPQNNALNLQVRDLTDEEKESMQVAGGVMVAQVFPG-PAATAGI 416

Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           Q    I S+N  +V  +     ++ K    K   VL+                 F+ LK+
Sbjct: 417 QPNDVISSINNKDVETVAQFHEVVEKLPVGKSLPVLI----------IRQGNPAFIVLKL 466

Query: 488 D 488
           +
Sbjct: 467 N 467


>gi|300313678|ref|YP_003777770.1| periplasmic trypsin-like serine endoprotease [Herbaspirillum
           seropedicae SmR1]
 gi|300076463|gb|ADJ65862.1| periplasmic trypsin-like serine endoprotease protein
           [Herbaspirillum seropedicae SmR1]
          Length = 494

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 135/519 (26%), Positives = 231/519 (44%), Gaps = 57/519 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSV----------------------- 38
             R+I+ V++   V +  V+  S      A LP +                         
Sbjct: 1   MSRRIVFVRNTLAVMIAAVVGGSYVYFRGADLPSAHAAAVNAPLVASNSAPAAPAGPVVA 60

Query: 39  ---DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
              D   ++ R  P++V++ V  K +   +   N      L  + P   +F++       
Sbjct: 61  AATDFSGIVQRYGPAVVNISVTGKARKVADDDDN-----GLDPNDPFSEFFKRF-----G 110

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
            +  +          GSGF I+ DG ILT+ H+V+      V L+D  E  AK++G D  
Sbjct: 111 PQLQMPQQPRIMHGLGSGFIISPDGLILTNAHVVDGAQEVVVKLTDRREFKAKVLGIDKQ 170

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            D+AV+++ +         + +  ++VG+ V  IG+P+    T +AGI+SA  R +PD  
Sbjct: 171 SDIAVIRIDAKNLPTVQIGDPSR-VKVGQPVLAIGSPYGFDNTATAGIISAKSRSLPDDN 229

Query: 216 G-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q D  +N GNSGGP F+  G VIG+N+ I +      G+   IP+ +  K    L
Sbjct: 230 YVPFIQTDVAVNPGNSGGPLFDLNGQVIGINSQIYSQTGGFQGLSFSIPIDVAMKVEQQL 289

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           ++ G+V  G  G+  Q+L Q L+   GL+  +G+L+++V K SPADKAG++ GDVI   +
Sbjct: 290 VTHGKVTRGRLGVSVQDLNQALSDSFGLKKAEGALVSSVEKGSPADKAGLQAGDVIISFN 349

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKEL 393
           G  I    D    +A   P     + + + G   ++ V +G    AKND    +  D+  
Sbjct: 350 GHAIDHSVDLPTLVADTPPGSTKPMEVMRAGKVRTINVTVGEMKQAKNDAKASKSDDQGR 409

Query: 394 LGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
           LG+ ++ ++   +  +     ++  +          GIQ G  I++VN   VS +  + +
Sbjct: 410 LGLAVRPLDKDEQAQLGGQKGLLVEDV--SGPAAVAGIQSGDVILAVNGTPVSSVAQLRK 467

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           L   A      +V L ++          +   FV L ++
Sbjct: 468 LATDA----GKNVALLVERG--------DEKIFVPLALN 494


>gi|220904478|ref|YP_002479790.1| protease Do [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868777|gb|ACL49112.1| protease Do [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 475

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 141/504 (27%), Positives = 241/504 (47%), Gaps = 44/504 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MF ++ LS        L  V F       +A    +  D   + A+  P++V++  E   
Sbjct: 1   MFIKKCLS-------GLLAVTFVVAAQFAQAG---NLPDFSELAAKSGPAVVNINTEKMA 50

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
                + F    F N+P        F K F +F    +     + +    GSGF ++ DG
Sbjct: 51  ASGGSEEFFGEMFRNMPPG------FEKFFDQFGGKRDGKRPQSRQ-KSLGSGFLVSADG 103

Query: 121 YILTSNHIVEDGASFSVILSDDT----ELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           +I+T+NH+V D     V L  +        A L+G D   DLA+LKV++ +    + F +
Sbjct: 104 FIVTNNHVVADADVIRVTLDQENGKSESFTATLIGADEETDLALLKVETKKNLPFLVFGN 163

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCF 235
           ++ ++VGE +  IGNPF L  TV+AGI+SA +R+I   P   F Q DA IN GNSGGP  
Sbjct: 164 SDELKVGEWLLAIGNPFGLDHTVTAGILSAKNRNIHAGPFDNFLQTDASINPGNSGGPLL 223

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G V+G+N  I+ S     G+G  IP ++  K I  + S  +V  GW G+  Q++ + 
Sbjct: 224 NMQGQVVGINTAIIAS---GQGIGFAIPSNMAAKIIDQIKSGKKVSRGWIGVTIQDVEEN 280

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
            A  LG++  KG+L+ +V++  PA K GMK GD+I  +DG+ I      +  IA ++P  
Sbjct: 281 TAKALGMKDAKGALVGSVMENEPAGKGGMKDGDIILAVDGKDIDDASALLRAIAEKTPGS 340

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----ELLGMVLQDINDGNKKLV-- 409
           +  I + ++G    + V LG   +         G       LLG+ ++ +ND  ++ +  
Sbjct: 341 KAVIKVWRDGKVLDLTVTLGERQSTSQASASGKGGPKQNEGLLGIAVRPLNDTERRDMKI 400

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                ++ ++    +      ++ G  I+  N   V+  + + +++ + +  KR +++LQ
Sbjct: 401 DKNEGLLIVDVTPSKPAAEADLRPGDVILKANLKPVNTSEALSKIVNE-EGAKRGAIMLQ 459

Query: 466 IKYDPDMQSGNDNMSRFVSLKIDK 489
           I    D+         F ++ + K
Sbjct: 460 ISRRGDVY--------FRTIPLSK 475


>gi|148257342|ref|YP_001241927.1| putative Serine protease do-like [Bradyrhizobium sp. BTAi1]
 gi|146409515|gb|ABQ38021.1| Putative Serine protease do-like precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 498

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 141/501 (28%), Positives = 240/501 (47%), Gaps = 31/501 (6%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM 67
            ++ I T A+  V ++       A+ P     +  V  +V  ++V++      +      
Sbjct: 9   RLRPIVTAAVFAVGWALAPAPASARGPEG---IADVAEKVIDAVVNISTSQTVEAKGGGE 65

Query: 68  FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL---SDTVERLMFGSGFFITDDGYILT 124
                   +P   P + +F   F     G        +        GSGF + D G ++T
Sbjct: 66  GRG-ANPQVPPGSPFEEFFDDFFKNRRGGPGGRGGADNSPRRTNSLGSGFIVDDSGVVVT 124

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH++ D    +VI++D T++ A+LVG D   DLAVLK +  R    V+F D++ +R+G+
Sbjct: 125 NNHVIADADEINVIMNDGTKIKAELVGVDKKTDLAVLKFKPPRPLTVVKFGDSDKLRLGD 184

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP FN  G VIG
Sbjct: 185 WVVAIGNPFSLGGTVTAGIVSAKNRDISSGPYDSYIQTDAAINRGNSGGPLFNLDGEVIG 244

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           VN +I++     +G+G  +P   +   +  L   G +  GW G+  Q +T E+A  L ++
Sbjct: 245 VNTLIISPSGGSIGIGFAVPSKTVAGVVDQLRQFGELRRGWLGVRIQGVTDEIAESLNIK 304

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+L+  V  + PA  AG++ GDV+   DG  IK  +D    +A  +  ++V + + +
Sbjct: 305 PARGALVAGVDDKGPAKPAGIEPGDVVVKFDGHDIKEPKDLSRIVADTAVGKEVDVIVIR 364

Query: 364 EGSKHSVAVVLGSSPTA---------KNDMHLEVGDKELLGMVLQDINDGNKKLV----- 409
           +G + ++ V LG              K++   +   ++ LG+ L  ++   +        
Sbjct: 365 KGQEQTLKVKLGRLEDNEKVQQAAIKKDEPAEKPQTQKALGLDLAALSKDLRTRYKIKDS 424

Query: 410 --RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              ++    ++  +   K +  G  IV V    V+   D+++ + + K+  + SVLL + 
Sbjct: 425 VKGVIVTGVDQGSDAAEKRLSAGDVIVEVAQEAVTSGADIKKRVDQLKKDGKKSVLLLV- 483

Query: 468 YDPDMQSGNDNMSRFVSLKID 488
                 S  D   RFV+L + 
Sbjct: 484 ------SNADGELRFVALSLQ 498


>gi|85858210|ref|YP_460412.1| trypsin-like serine protease [Syntrophus aciditrophicus SB]
 gi|85721301|gb|ABC76244.1| trypsin-like serine protease [Syntrophus aciditrophicus SB]
          Length = 506

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 137/506 (27%), Positives = 248/506 (49%), Gaps = 44/506 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLP--------------PSSVDLPPVIAR 46
           + +R+ +    +  + +  V+  +      A L                + V    +  +
Sbjct: 6   LKRRKKVFSVILMFIMMAGVMMPAFPCPAWAPLSGSGEAHARDVLPDSAAPVSFADLAEK 65

Query: 47  VSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE 106
           + P++V++      K    ++       +         +FR+ F         +    ++
Sbjct: 66  LGPAVVNISTTKVIKTGARRLPGGETPFDRFFGS--DEFFRRFFDD-------LPERELK 116

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
           +   GSGF I+ DGYI T+NH+VE      V LS   E  A++ G D+  D+A++K+++D
Sbjct: 117 QRSLGSGFIISSDGYIFTNNHVVEKADKIRVKLSSGKEYDAEVKGRDSNTDIALIKIKAD 176

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPI 225
           R    V   +++ +RVGE VF IGNPF L  TV+AGI+SA  R I   P   F Q DA I
Sbjct: 177 RVLPVVTLGNSDKLRVGEWVFAIGNPFGLDHTVTAGIISAKGRVIGAGPYDNFLQTDASI 236

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N GNSGGP FN  G V+G+N  IV       G+G  IP+++ ++ +  L + GRV  GW 
Sbjct: 237 NPGNSGGPLFNMAGEVVGINTAIVAQ---GQGIGFAIPINMAREILEDLKTSGRVTRGWL 293

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           GI  Q++T+E++  L L+ ++G+L++ V++  P DKAGMK GD+I  +DG+ + S +D +
Sbjct: 294 GITVQDITEEISANLKLKNSQGALVSQVLEGEPGDKAGMKAGDIIIGIDGKPVTSTKDLL 353

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGN 405
             +A+    ++V++   ++G + +++ V+G    A+     E   ++ LGM +Q++    
Sbjct: 354 KIVAALKVGKKVQVRTLRDGREMTLSAVIGERKDAREIAAKEPVHQQ-LGMTVQEVTPEI 412

Query: 406 KKLV------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
            + +       ++          +  G++    I+ +N   +  +KD +  + +  E   
Sbjct: 413 ARNLGRKVQGGVIITRIRPGSAADDAGLKIQDIILQINRARIRTLKDYQNALSRGPENN- 471

Query: 460 DSVLLQIKYDPDMQSGNDNMSRFVSL 485
            + LL ++          + S FV+L
Sbjct: 472 -TWLLLVQRG--------DSSFFVTL 488


>gi|115352714|ref|YP_774553.1| protease Do [Burkholderia ambifaria AMMD]
 gi|115282702|gb|ABI88219.1| protease Do [Burkholderia ambifaria AMMD]
          Length = 494

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 128/454 (28%), Positives = 213/454 (46%), Gaps = 19/454 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVSRRVQQPQL--PMDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIVSADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDASGL-PTVKIGDPGQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPNGPAAKAGLQPGDVILGVNGS 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ SK +++V LG+   AK         ++  LG
Sbjct: 352 PVADSTSLPAQIANLKPGSKADLQVWRDKSKKTISVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ +    +    +    +           GIQ G  I++VN   V+  + +   +  
Sbjct: 412 VAVRPLTPQERSATNLSHGLIVQQAGGPAATAGIQPGDVILAVNGRPVTSAEQLREAVKG 471

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 472 A----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|218530834|ref|YP_002421650.1| protease Do [Methylobacterium chloromethanicum CM4]
 gi|218523137|gb|ACK83722.1| protease Do [Methylobacterium chloromethanicum CM4]
          Length = 511

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 149/498 (29%), Positives = 242/498 (48%), Gaps = 37/498 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           V    V  ++  L   A+ P     L  +  +V+ ++V++      + S           
Sbjct: 27  VLGVTVTVTALPLPAFARGPE---SLADLADKVTDAVVNISASTTVEASNR---GGRTMP 80

Query: 75  NLPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
            LP+  P ++ F + F +   G     +E     T +    GSGF I   G ++T+NH++
Sbjct: 81  QLPQGTPFEDLFEEFFKRRGQGAPKGDDESPRGPTRKSNSLGSGFIIDASGIVVTNNHVI 140

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI--PVEFEDANNIRVGEAVF 187
            D     VILSD T+L A+++G D+  DLA+L+V+   +     V F D++ +R G+ V 
Sbjct: 141 GDANDIQVILSDGTKLKAEIIGKDSKIDLALLRVKPTAERPLKAVPFGDSDKMRPGDWVM 200

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N 
Sbjct: 201 AIGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINT 260

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG-LRGT 305
            I++     +G+G  +P +   + +  L   G V  GW G+  QN+ +  A  LG   G 
Sbjct: 261 AILSPSGGSVGIGFAVPSATAGQVVDQLRQFGEVRRGWIGVRIQNVDEATAEALGLKGGA 320

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           KG+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G
Sbjct: 321 KGALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKSVDVQVVRKG 380

Query: 366 SKHSVAVVLGSSPTAKN-------DMHLEVGDKELLGMVLQDINDGNKKLVRI------- 411
            + + +VVLG     +            +  ++++LG+ L  +ND  ++   I       
Sbjct: 381 EEQTKSVVLGRLEDGEKAQVANLKQPEADSVNRQVLGLNLSGLNDEVRRRYGIKESVKTG 440

Query: 412 -VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            V    +       K IQ G  IV V    +S   DV + +   K++ R SVLL +    
Sbjct: 441 VVVTKVDPNSTAADKRIQPGEVIVEVGQEAISNPADVTKRVEALKKEGRKSVLLLV---- 496

Query: 471 DMQSGNDNMSRFVSLKID 488
              +      RFV++ ++
Sbjct: 497 ---ASTSGDVRFVAIGLE 511


>gi|152981037|ref|YP_001353055.1| periplasmic serine protease [Janthinobacterium sp. Marseille]
 gi|151281114|gb|ABR89524.1| periplasmic serine protease [Janthinobacterium sp. Marseille]
          Length = 493

 Score =  203 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 127/501 (25%), Positives = 222/501 (44%), Gaps = 38/501 (7%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           +++  V      A      +     + A       D   ++ +  P++V++    K KV 
Sbjct: 9   KKLSVVLFGVASAFFIPAVAGVAPSIAAPSVAGLPDFTDLVEKTGPAVVNIRTTEKAKVQ 68

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-----------RLMFGS 112
                         +D  ++ +FR+ F       +   +                   GS
Sbjct: 69  QGNAAT--------DDEEMQEFFRRFFGAPIPPRQQQPAPRGRGKAGPDAEEEVPRGVGS 120

Query: 113 GFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
           GF I+ DGY++T+ H+V       V L+D  E  AK++G D   D+A++K++       +
Sbjct: 121 GFIISADGYVMTNAHVVNGADEVYVTLTDKREYKAKIIGADTRTDVALVKIEGSNL-PRL 179

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGG 232
              D+N IRVGE V  IG+PF L  +V+AGIVSA  RD  D      Q D  +N GNSGG
Sbjct: 180 TMGDSNKIRVGEWVIAIGSPFGLDNSVTAGIVSAKARDTGDYLP-LIQTDVAVNPGNSGG 238

Query: 233 PCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNL 292
           P  N  G VIG+N+ I +    +MG+   +P+    +    L + G+V  G  G+    +
Sbjct: 239 PLINMRGEVIGINSQIYSRSGGYMGISFAVPIDEAMRVSDQLRATGKVTRGRVGVQIGEV 298

Query: 293 TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRS 352
           T+++A  LGL   +G+L+  V    PA+K G++ GDVI   +G  I+   D    + S  
Sbjct: 299 TKDVAESLGLSRPQGALVQRVEPGGPAEKGGVEAGDVILKFNGVGIERSSDLPRLVGSTK 358

Query: 353 PKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-----ELLGMVLQDINDGNKK 407
           P  +  +++ ++G+   + +V+      K     +   K       LG+++ D+N    K
Sbjct: 359 PGTRSVMTVWRKGAMRDLNLVVTELEADKVVKKEDKKPKAEQVANALGLIVSDLNAAQLK 418

Query: 408 LVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
            ++I    L    E      G++ G  I+ +N  ++   +    L+ K     + + LL 
Sbjct: 419 ELKIDGGILIEATEGAAARAGLRGGDIILRLNNTDIKDARQFNGLVAKL--DTKKTTLLL 476

Query: 466 IKYDPDMQSGNDNMSRFVSLK 486
           ++          + S+FV++K
Sbjct: 477 VRRG--------DSSQFVTIK 489


>gi|254561820|ref|YP_003068915.1| serine protease [Methylobacterium extorquens DM4]
 gi|254269098|emb|CAX25061.1| putative serine protease precursor [Methylobacterium extorquens
           DM4]
          Length = 511

 Score =  203 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 150/498 (30%), Positives = 242/498 (48%), Gaps = 37/498 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           V    V  ++  L   A+ P     L  +  +V+ ++V++      + S           
Sbjct: 27  VLGVTVTVTALPLPAFARGPE---SLADLADKVTDAVVNISASTTVEASNR---GGRTMP 80

Query: 75  NLPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
            LP+  P ++ F + F +   G     +E     T +    GSGF I   G ++T+NH++
Sbjct: 81  QLPQGTPFEDLFEEFFKRRGQGVPKGDDESPRGPTRKSNSLGSGFIIDASGIVVTNNHVI 140

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI--PVEFEDANNIRVGEAVF 187
            D     VILSD T+L A+++G D+  DLA+L+V+   +     V F D++ +R G+ V 
Sbjct: 141 GDANDIQVILSDGTKLKAEIIGKDSKIDLALLRVKPTAERPLKAVPFGDSDKMRPGDWVM 200

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N 
Sbjct: 201 AIGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINT 260

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG-LRGT 305
            I++     +G+G  +P +   + +  L   G V  GW G+  QN+ +  A  LG   G 
Sbjct: 261 AILSPSGGSVGIGFAVPSATAGQVVDQLRQFGEVRRGWIGVRIQNVDEATAEALGLKGGA 320

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           KG+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G
Sbjct: 321 KGALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKSVDVQVVRKG 380

Query: 366 SKHSVAVVLGSSPTAKN-------DMHLEVGDKELLGMVLQDINDGNKKLVRI------- 411
            + + +VVLG     +            E  ++++LG+ L  +ND  ++   I       
Sbjct: 381 EEQTKSVVLGRLEDGEKAQVANLKQPEAESVNRQVLGLNLSGLNDEVRRRYGIKESVKTG 440

Query: 412 -VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            V    +       K IQ G  IV V    +S   DV + +   K++ R SVLL +    
Sbjct: 441 VVVTKVDPNSTAADKRIQPGEVIVEVGQEAISNPADVTKRVEALKKEGRKSVLLLV---- 496

Query: 471 DMQSGNDNMSRFVSLKID 488
              +      RFV++ ++
Sbjct: 497 ---ASASGDVRFVAIGLE 511


>gi|163852076|ref|YP_001640119.1| protease Do [Methylobacterium extorquens PA1]
 gi|163663681|gb|ABY31048.1| protease Do [Methylobacterium extorquens PA1]
          Length = 511

 Score =  203 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 150/498 (30%), Positives = 242/498 (48%), Gaps = 37/498 (7%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           V    V  ++  L   A+ P     L  +  +V+ ++V++      + S           
Sbjct: 27  VLGVTVTVTALPLPAFARGPE---SLADLADKVTDAVVNISASTTVEASNR---GGRTMP 80

Query: 75  NLPEDHPLKNYFRKDFHKFFSG-----EEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
            LP+  P ++ F + F +   G     +E     T +    GSGF I   G ++T+NH++
Sbjct: 81  QLPQGTPFEDLFEEFFKRRGQGAPKGDDESPRGPTRKSNSLGSGFIIDASGIVVTNNHVI 140

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI--PVEFEDANNIRVGEAVF 187
            D     VILSD T+L A+++G D+  DLA+L+V+   +     V F D++ +R G+ V 
Sbjct: 141 GDANDIQVILSDGTKLKAEIIGKDSKIDLALLRVKPTAERPLKAVPFGDSDKMRPGDWVM 200

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IGNPF L G+VSAGIVSA  R+I   P   + Q DA IN+GNSGGP FN  G VIG+N 
Sbjct: 201 AIGNPFGLGGSVSAGIVSARGRNIESGPYDNYIQTDAAINKGNSGGPLFNMDGEVIGINT 260

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG-LRGT 305
            I++     +G+G  +P +   + +  L   G V  GW G+  QN+ +  A  LG   G 
Sbjct: 261 AILSPSGGSVGIGFAVPSATAGQVVDQLRQFGEVRRGWIGVRIQNVDEATAEALGLKGGA 320

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           KG+L+  V ++ PA  AG++VGDVI   +G  +KS  +    +A+    + V + + ++G
Sbjct: 321 KGALVAGVDEKGPAKTAGLEVGDVIVKFNGVPVKSSSELPRIVAATPVGKSVDVQVVRKG 380

Query: 366 SKHSVAVVLGSSPTAKN-------DMHLEVGDKELLGMVLQDINDGNKKLVRI------- 411
            + + +VVLG     +            E  ++++LG+ L  +ND  ++   I       
Sbjct: 381 EEQTKSVVLGRLEDGEKAQVANLKQPEAESVNRQVLGLNLSGLNDEVRRRYGIKESVKTG 440

Query: 412 -VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            V    +       K IQ G  IV V    +S   DV + +   K++ R SVLL +    
Sbjct: 441 VVVTKVDPNSTAADKRIQPGEVIVEVGQEAISNPADVTKRVEALKKEGRKSVLLLV---- 496

Query: 471 DMQSGNDNMSRFVSLKID 488
              +      RFV++ ++
Sbjct: 497 ---ASASGDVRFVAIGLE 511


>gi|241662600|ref|YP_002980960.1| protease Do [Ralstonia pickettii 12D]
 gi|240864627|gb|ACS62288.1| protease Do [Ralstonia pickettii 12D]
          Length = 503

 Score =  203 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 137/512 (26%), Positives = 231/512 (45%), Gaps = 52/512 (10%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLE------AKLPPSSVDLPPVIARVSPSIVSVMVE 57
           R + +++ +C  A   V  + T    +      A       D   ++ +VSP++V++   
Sbjct: 5   RTVHALRLLCIAAALAVGSALTPAHAQNAMGSVATGTYGLPDFADLVEKVSPAVVNIRTT 64

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE---------PILSDTVERL 108
            K ++              P D  +  +FR+ F     G           P   +  +  
Sbjct: 65  EKVRMQQ----------GGPNDDDMAEFFRRFFGVPMPGMPGQGQKRRNAPPQQEEEQSR 114

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF I+ DGYILT+ H+VE   +  V L D  E  AKL+G D   D+A++KV+    
Sbjct: 115 GVGSGFIISGDGYILTNAHVVEGAETIYVTLIDKREYKAKLIGLDKRTDVALVKVE-ATG 173

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQG 228
              ++  D++ +RVGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D  +N G
Sbjct: 174 LPSLKLGDSDKVRVGEWVLAIGSPFGLDNTVTAGIVSAKGRDTGDYLP-FIQSDVAVNPG 232

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP  N  G VIG+N  I +    +MG+   IP+    +    L + GRV  G  G+ 
Sbjct: 233 NSGGPLINLRGEVIGINNQIYSQSGGYMGISFSIPIDEAMRVAEQLKATGRVTRGRIGVA 292

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
             N+ ++ A  LGL   +G+ +  V    PADKAG++ GD++   +GR I+   D   Q+
Sbjct: 293 IDNVPKDAAESLGLGRARGAYVGNVESGGPADKAGIEAGDIVLKYNGRDIEKAGDLQRQV 352

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-----------KNDMHLEVGDKELLGMV 397
               P  +  + + ++G+   + V +                  ++     G    LG+V
Sbjct: 353 GETKPGTRATVQVWRKGATRDLTVTVAELQADTKVAQRSKGAQPDNSQQGPGKPNALGLV 412

Query: 398 LQDINDGNKKLVR---IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           + D++DG ++  +    V +  +        GI+ G  I+ V   +V+  K    L+ + 
Sbjct: 413 VSDLSDGARREFKTKSGVEVQVSEG-PAARVGIRPGDLILRVGDTDVTNAKQFNELVARL 471

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            + +  +V ++            + ++ V+L+
Sbjct: 472 DKNRMVAVFVR----------RGDATQVVTLR 493


>gi|254470181|ref|ZP_05083585.1| protease DO [Pseudovibrio sp. JE062]
 gi|211960492|gb|EEA95688.1| protease DO [Pseudovibrio sp. JE062]
          Length = 494

 Score =  203 bits (514), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 152/506 (30%), Positives = 241/506 (47%), Gaps = 39/506 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             R I ++  +    L     + ++   +A+ P     L  +   +  ++V++    + K
Sbjct: 10  LGRSIKAI--VFASVLGVAAVTGSFNNAQARGPE---SLADLAEELGDAVVNISTAQRVK 64

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT-DDG 120
                        ++PE  P +      F +FF+G+EP           GSGF I  D+G
Sbjct: 65  AKRS-----LQLPDVPEGSPFQE----FFEEFFNGQEPEGESPQRVQSLGSGFVIDGDEG 115

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
            I+T+NH++E     +V  +D T+L A+L+G+D   DLAVLKV+       V+F  +  +
Sbjct: 116 IIVTNNHVIEGADEITVNFNDGTKLSAELLGSDEKTDLAVLKVEPQSTLDSVKFGSSEVL 175

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALG 239
           RVG+ V  IGNPF L GTV+AGIVSA +RDI   P   F Q DA IN+GNSGGP FN  G
Sbjct: 176 RVGDWVMAIGNPFGLGGTVTAGIVSARNRDINSGPYDNFIQTDAAINRGNSGGPLFNMDG 235

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+G+N +I +     +G+G  IP     + I  L   G    GW G+  Q++T E+A  
Sbjct: 236 EVVGINTVIFSPSGGSIGIGFAIPAETATRVIAQLREFGETRRGWLGVRIQHVTDEIAES 295

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           LG+   +G+LI  V ++ PA +AG+  GDV+   DGR +   +D    +A+ +    V +
Sbjct: 296 LGMDNAQGALIAGVSEDGPAKEAGIMPGDVVLTFDGREVPEMRDLPRMVATTTIGSTVPL 355

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE---------LLGMVLQDINDGNKKLV- 409
           ++ + G +  + V LG          +E   +          +LG+ L  I++  ++   
Sbjct: 356 TVLRRGEEVEIEVTLGRLDEVAEVEQVEEEQESPKDKADETVVLGLSLAKIDEPLRERFA 415

Query: 410 ------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
                  +V          E K ++ G  IV V    V+  KDV  ++   K  KR S L
Sbjct: 416 LSDEIEGVVITRVAEGSSAEDKRVRAGDVIVEVAQEPVASPKDVVDMVEALKADKRRSAL 475

Query: 464 LQIKYDPDMQSGNDNMSRFVSLKIDK 489
           L         S      RFV+++I++
Sbjct: 476 LL-------LSNGAGELRFVAVRIEE 494


>gi|134296822|ref|YP_001120557.1| protease Do [Burkholderia vietnamiensis G4]
 gi|134139979|gb|ABO55722.1| protease Do [Burkholderia vietnamiensis G4]
          Length = 494

 Score =  203 bits (514), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 131/454 (28%), Positives = 213/454 (46%), Gaps = 19/454 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVSRRVQQPQL--PMDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIVSPDGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDASGL-PTVKIGDPARSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL    G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLPKPDGALVSSVDPSGPAAKAGLQPGDVILAVNGS 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIAS  P  Q  + + ++ SK S++V LG+   AK         ++  LG
Sbjct: 352 PVADSTSLPAQIASLKPGSQADLQIWRDKSKKSISVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ +    +    +    +         + GIQ G  I++VN   V+  + +   +  
Sbjct: 412 VAVRPLTPQERSATNLSHGLMVQQAGGPAASAGIQPGDVILAVNGRPVTNPEQLRDAVKG 471

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 472 A----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|171321221|ref|ZP_02910190.1| protease Do [Burkholderia ambifaria MEX-5]
 gi|171093505|gb|EDT38677.1| protease Do [Burkholderia ambifaria MEX-5]
          Length = 494

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 128/454 (28%), Positives = 214/454 (47%), Gaps = 19/454 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVSRRVQQPQL--PMDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIVSADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDASGL-PTVKIGDPGQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPNGPAAKAGLQPGDVILGVNGS 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ +K S++V LG+   AK         ++  LG
Sbjct: 352 PVADSTSLPAQIANLKPGSKADLQVWRDKAKKSISVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ +    +    +    +         + GIQ G  I++VN   V+  + +   +  
Sbjct: 412 VAVRPLTPQERSAANLSHGLIVQQAGGPAASAGIQPGDVILAVNGRPVTSAEQLRDAVKG 471

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 472 A----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|170751798|ref|YP_001758058.1| protease Do [Methylobacterium radiotolerans JCM 2831]
 gi|170658320|gb|ACB27375.1| protease Do [Methylobacterium radiotolerans JCM 2831]
          Length = 508

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 157/482 (32%), Positives = 238/482 (49%), Gaps = 24/482 (4%)

Query: 22  FSSTYLVLEAKLPPSSV--------DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGF 73
             +        LP S +            ++++V P +VSV V+     S +        
Sbjct: 34  LPAATPAYAQALPKSPIEAPEHPPGSFAGIVSKVKPGVVSVKVKLDDSASSDDDDGPSQG 93

Query: 74  GNLPEDHP-LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
            NL    P L+ +F++       G +P       R   GSGF I+ DGY++T+NH+V+  
Sbjct: 94  RNLQNVPPQLREFFKRFGQNGPGGMQPQHQG--PRGAVGSGFIISADGYVVTNNHVVDHA 151

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
            +  V L D   L AK++G D+  D+A+LK+     F  V+F  A   +VG+ V  IGNP
Sbjct: 152 KTVQVTLDDGRTLDAKVIGKDSKTDVALLKITEGSNFPYVQFGKAAP-QVGDWVVAIGNP 210

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP FN  G V+G+N  I + 
Sbjct: 211 FGLGGTVTAGIVSARGRDIGAGPYDDFLQIDAPINKGNSGGPTFNVNGEVVGMNTAIASP 270

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+   IP   ++  +  L + G+V  G+ G+  Q +TQ++A  LGL   KG+L+ 
Sbjct: 271 SGGSVGLAFAIPAETVQAVVDQLRTDGKVARGYLGVQIQPVTQDIAEGLGLDKAKGALVD 330

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
                +PA KAG+K GDVI  ++G  + S ++   +IA   P  +V++S  + G   +  
Sbjct: 331 HAENGTPAAKAGLKAGDVIEKVNGDTVDSARELSRKIAGLKPGAKVELSYLRGGKTDTAT 390

Query: 372 VVLGSSPTAKNDMHLEVGD----KELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGI 427
           V LG+ PT    M     D    +  LG+ L    D       +  +  + +    AKGI
Sbjct: 391 VTLGTMPTDGTKMASRDDDSGNGQPRLGLQLAPAGDVGLSDQGVAVVQVDPDGPAAAKGI 450

Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           + G  I+ V    VS   DV   I  A+   R +VL+++K            +RFV++ +
Sbjct: 451 EAGDVILDVGGQSVSRPADVATQIRAAETSGRKAVLMRVKSG-------KGQTRFVAVSL 503

Query: 488 DK 489
           +K
Sbjct: 504 NK 505


>gi|75675388|ref|YP_317809.1| peptidase S1C, Do [Nitrobacter winogradskyi Nb-255]
 gi|74420258|gb|ABA04457.1| peptidase S1C, Do [Nitrobacter winogradskyi Nb-255]
          Length = 516

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 146/511 (28%), Positives = 240/511 (46%), Gaps = 38/511 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPS-------------SVDLPPVIARVSP 49
           +R  L    +  V +     S +    E  + P+              +    ++ RV P
Sbjct: 19  RRFALMASVVAGVGVAAYGLSPSADKAEFFISPAYAQVNTDVSKVAQPIGFADIVERVKP 78

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF-SGEEPILSDTVERL 108
           S+  + V+ + K       +   F       P++ +FR+                     
Sbjct: 79  SV--ISVKIRMKDRAVASGDDSPFQ---PGSPMERFFRRFGGPDGLPPGMRGRRGPGLVT 133

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGFFI+ DGY +T+NH+V+      V   D     AK++G D   D+A++KV+    
Sbjct: 134 GQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYTAKVIGADPRTDIALIKVEGGSS 193

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQ 227
           F   +  D   +R+G+ V  +GNPF L G+V+AGIVSA  RDI   P   F QIDAP+N+
Sbjct: 194 FPFAKLSDD-KVRIGDWVLAVGNPFGLGGSVTAGIVSASGRDIGTGPYDDFIQIDAPVNK 252

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP FN  G VIGVN  I +     +G+   IP + +K  +  L  KG V  GW G+
Sbjct: 253 GNSGGPAFNMKGDVIGVNTAIYSPSGGSVGIAFSIPANTVKSVVAQLKDKGSVSRGWIGV 312

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T ++A  LGL+  +G+L+      SPA KAG+K GDVI  ++G  +K  ++    
Sbjct: 313 QIQPVTSDIADSLGLKKAEGALVAEPQANSPAAKAGIKSGDVITAVNGDPVKDARELART 372

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK--------ELLGMVLQ 399
           I S +P   +K+++ ++G+   V + LG+ P          GD+          LG+ + 
Sbjct: 373 IGSLAPGTSIKLNVLRKGTDKVVNLTLGTLPDTVEARADHYGDRGSSRDNDIPRLGLTVA 432

Query: 400 DI-NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
              +        +V ++ + +     +G ++G  I+ V    VS   D+   I  A+ + 
Sbjct: 433 PAGSVAGAGGEGVVVVDVDPKSPAAERGFREGDVILEVAGKSVSSSADIREAIKAARAED 492

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++SVL++++          + +RFV++ I K
Sbjct: 493 KNSVLMRVR--------TGSTARFVAMPIAK 515


>gi|33597822|ref|NP_885465.1| serine protease [Bordetella parapertussis 12822]
 gi|33602724|ref|NP_890284.1| serine protease [Bordetella bronchiseptica RB50]
 gi|33574251|emb|CAE38583.1| serine protease [Bordetella parapertussis]
 gi|33577166|emb|CAE35723.1| serine protease [Bordetella bronchiseptica RB50]
          Length = 495

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 123/501 (24%), Positives = 228/501 (45%), Gaps = 33/501 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           +F R+  +   +  +A+T            A    +  D   ++ +V P++V++      
Sbjct: 9   LFFRRFGAAALVAFMAVTAAGTQVQAQTQVAPPAVALPDFTGIVEKVEPAVVNIRTTATV 68

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-------RLMFGSG 113
            V          +         + +F  DF                           GSG
Sbjct: 69  PVRGGPGGGNDPY------ELFRWFFGPDFQPPGPAPGQRRKQPQPQPEERTIPRGVGSG 122

Query: 114 FFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
           FFI+ DGYILT+NH++ D     V L+D  E  AK++G+D   D+A++K+ +      + 
Sbjct: 123 FFISADGYILTNNHVISDATDIYVTLTDGREFKAKVIGSDDRTDVALIKIDAKDMTP-LT 181

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGP 233
             D   ++ G+ V  IG+PF L  TV+AGIVSA+ RD  +    F Q D  +N GNSGGP
Sbjct: 182 IGDPKTLKKGQWVLAIGSPFGLDSTVTAGIVSAIGRDTGEYLP-FIQTDVAVNPGNSGGP 240

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
             N  G  +G+N+ I++     MG+ L IP+    + +  L + G+V  G  G+    + 
Sbjct: 241 LLNLQGEAVGINSQIISRSGGFMGISLAIPIDEAMRVVDQLRATGKVTRGRIGVQIGEVG 300

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
           +++A  +GL   +G+L+++V  E PA+ AG++ GDVI   +G  IK   D    +    P
Sbjct: 301 KDVADAIGLPRAEGALVSSVEAEGPAESAGVQPGDVILKFNGEPIKRWSDLPRIVGETKP 360

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTAKNDM------HLEVGDKELLGMVLQDINDGNKK 407
               K+ + ++G   +++V +    + ++          E   +  LG+ + D+    ++
Sbjct: 361 GTSAKMDVWRKGRNVTLSVKVAELKSDRSAATADEGKQAEPTAENHLGLGVVDVPSDTQR 420

Query: 408 LVRIVALNP--NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
            +RI         E      G+Q+G  +++VN  +V+      +L+ +  +KK   +L++
Sbjct: 421 KLRIKGGAQVRVAEGAAAQAGLQEGDIVLAVNDTDVTDAAQFNKLVSRLDKKKAAGLLVR 480

Query: 466 IKYDPDMQSGNDNMSRFVSLK 486
                       + +++V+++
Sbjct: 481 ----------RGDQTQWVAVQ 491


>gi|312959554|ref|ZP_07774071.1| S1C (protease Do) subfamily peptidase MucD [Pseudomonas fluorescens
           WH6]
 gi|311286271|gb|EFQ64835.1| S1C (protease Do) subfamily peptidase MucD [Pseudomonas fluorescens
           WH6]
          Length = 479

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 132/496 (26%), Positives = 225/496 (45%), Gaps = 29/496 (5%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
            I  +K   ++  T ++          +LP    D   ++ + SP++V++    K     
Sbjct: 2   SIPRLKYYLSIVATVLVLGQAVTAQAVELP----DFTQLVEQASPAVVNISTTQKLPDRK 57

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
                      LP    L+ +F +   +  +          E    GSGF I+ DGYILT
Sbjct: 58  VSNQQMPDLEGLPPM--LREFFERGMPQPRAPRGGGGGQ-REAQSLGSGFIISPDGYILT 114

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH++ D     V L+D +EL AKLVGTD   D+A+LK++       ++   + +++ G+
Sbjct: 115 NNHVIADADEILVRLADRSELKAKLVGTDPRSDVALLKIEGKDL-PVLKLGKSQDLKAGQ 173

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IG+PF    TV+ GIVSA+ R +P+     F Q D PIN GNSGGP FN  G V+G
Sbjct: 174 WVVAIGSPFGFDHTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAGEVVG 233

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I T     MGV   IP+ +       L S G+V  GW G++ Q + ++LA   GL 
Sbjct: 234 INSQIYTRSGGFMGVSFAIPIDVAMDVSNQLKSGGKVSRGWLGVVIQEVNKDLAESFGLD 293

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
              G+L+  +    PA K G++VGDVI  ++G+ I    D    + +     + K+ + +
Sbjct: 294 KPAGALVAQIQDGGPAAKGGLQVGDVILSMNGQPIIMSADLPHLVGALKAGSKAKLEVIR 353

Query: 364 EGSKHSVAVVLGSSPTA-------KNDMHLEVGDKELLGMVLQDINDGNKKLVRI---VA 413
           +G + +V + +G+ P          N           LG+ + ++ D  KK   +   V 
Sbjct: 354 DGKRQNVELTVGAIPEEGATLDALGNTKPGAERSSNRLGIAVAELTDEQKKTFDLKSGVV 413

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
           +   ++      G+Q G  I  +N   +   K    +     + +  S+ +         
Sbjct: 414 IKEVQDGPAALIGLQPGDVITHLNNQAIETTKQFTDIAKALPKNRSVSMRVL-------- 465

Query: 474 SGNDNMSRFVSLKIDK 489
              +  + F++ K+ +
Sbjct: 466 --REGRASFITFKLAE 479


>gi|33593418|ref|NP_881062.1| serine protease [Bordetella pertussis Tohama I]
 gi|33572774|emb|CAE42706.1| serine protease [Bordetella pertussis Tohama I]
 gi|332382827|gb|AEE67674.1| serine protease [Bordetella pertussis CS]
          Length = 495

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 123/501 (24%), Positives = 228/501 (45%), Gaps = 33/501 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           +F R+  +   +  +A+T            A    +  D   ++ +V P++V++      
Sbjct: 9   LFFRRFGAAALVAFMAVTAAGTQVQAQTQVAPPAVALPDFTGIVEKVEPAVVNIRTTATV 68

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-------RLMFGSG 113
            V          +         + +F  DF                           GSG
Sbjct: 69  PVRGGPGGGNDPY------ELFRWFFGPDFQPPGPAPGQRRKQPQPQPEERTIPRGVGSG 122

Query: 114 FFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
           FFI+ DGYILT+NH++ D     V L+D  E  AK++G+D   D+A++K+ +      + 
Sbjct: 123 FFISADGYILTNNHVISDATDIYVTLTDGREFKAKVIGSDDRTDVALIKIDAKDMTP-LT 181

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGP 233
             D   ++ G+ V  IG+PF L  TV+AGIVSA+ RD  +    F Q D  +N GNSGGP
Sbjct: 182 IGDPKTLKKGQWVLAIGSPFGLDSTVTAGIVSAIGRDTGEYLP-FIQTDVAVNPGNSGGP 240

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
             N  G  +G+N+ I++     MG+ L IP+    + +  L + G+V  G  G+    + 
Sbjct: 241 LLNLQGEAVGINSQIISRSGGFMGISLAIPIDEAMRVVDQLRATGKVTRGRIGVQIGEVG 300

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
           +++A  +GL   +G+L+++V  E PA+ AG++ GDVI   +G  IK   D    +    P
Sbjct: 301 KDVADAIGLPRAEGALVSSVEAEGPAESAGVQPGDVILKFNGEPIKRWSDLPRIVGETKP 360

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTAKNDM------HLEVGDKELLGMVLQDINDGNKK 407
               K+ + ++G   +++V +    + ++          E   +  LG+ + D+    ++
Sbjct: 361 GTSAKMDVWRKGRNVTLSVKVAELKSDRSAATADEGKQAEPTAENHLGLGVVDVPSDMQR 420

Query: 408 LVRIVALNP--NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
            +RI         E      G+Q+G  +++VN  +V+      +L+ +  +KK   +L++
Sbjct: 421 KLRIKGGAQVRVAEGAAAQAGLQEGDIVLAVNDTDVTDAAQFNKLVSRLDKKKAAGLLVR 480

Query: 466 IKYDPDMQSGNDNMSRFVSLK 486
                       + +++V+++
Sbjct: 481 ----------RGDQTQWVAVQ 491


>gi|170697619|ref|ZP_02888708.1| protease Do [Burkholderia ambifaria IOP40-10]
 gi|170137506|gb|EDT05745.1| protease Do [Burkholderia ambifaria IOP40-10]
          Length = 494

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 128/454 (28%), Positives = 213/454 (46%), Gaps = 19/454 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVSRRVQQPQL--PMDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIVSADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDASGL-PTVKIGDPGQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPNGPAAKAGLQPGDVILGVNGS 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ SK +++V LG+   AK         ++  LG
Sbjct: 352 PVADSTSLPAQIANLKPGSKADLQVWRDKSKKTISVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ +    +    +    +           GIQ G  I++VN   V+  + +   +  
Sbjct: 412 VAVRPLTPQERSATNLSHGLIVQQAGGPAATAGIQPGDVILAVNGRPVTNAEQLRDAVKG 471

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 472 A----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|172061577|ref|YP_001809229.1| protease Do [Burkholderia ambifaria MC40-6]
 gi|171994094|gb|ACB65013.1| protease Do [Burkholderia ambifaria MC40-6]
          Length = 494

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 128/454 (28%), Positives = 213/454 (46%), Gaps = 19/454 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++    P++V++  +   K    ++        +    P   +F+  + +     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQVSRRVQQPQL--PMDPSDPFYQFFKHFYGQVPGMG 112

Query: 98  EPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFD 157
                D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK+VG+D   D
Sbjct: 113 GDAQPDDQPSASLGSGFIVSADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGSDKQSD 172

Query: 158 LAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT 217
           +AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   T
Sbjct: 173 VAVLKIDASGL-PTVKIGDPGQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYT 231

Query: 218 -FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLIS 276
            F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+ 
Sbjct: 232 PFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELVK 291

Query: 277 KGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGR 336
            G V  G  G+  Q L Q LA   GL+   G+L+++V    PA KAG++ GDVI  ++G 
Sbjct: 292 TGHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPNGPAAKAGLQPGDVILGVNGS 351

Query: 337 IIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK-NDMHLEVGDKELLG 395
            +        QIA+  P  +  + + ++ SK +++V LG+   AK         ++  LG
Sbjct: 352 PVADSTSLPAQIANLKPGSKADLQVWRDKSKKTISVTLGAMTDAKLASNDGGPVEQGRLG 411

Query: 396 MVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + ++ +    +    +    +           GIQ G  I++VN   V+  + +   +  
Sbjct: 412 VAVRPLTPQERSATNLSHGLIVQQAGGPAATAGIQPGDVILAVNGRPVTNAEQLRDAVKG 471

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           A     +S+ L I+ D        N   FV + +
Sbjct: 472 A----GNSLALLIQRD--------NAQIFVPVDL 493


>gi|330815982|ref|YP_004359687.1| hypothetical protein bgla_1g10480 [Burkholderia gladioli BSR3]
 gi|327368375|gb|AEA59731.1| hypothetical protein bgla_1g10480 [Burkholderia gladioli BSR3]
          Length = 513

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 127/515 (24%), Positives = 227/515 (44%), Gaps = 57/515 (11%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPS----------------------SVDLPPVIARVSP 49
           +  VALT  +  ++     A + P                         D   ++ +  P
Sbjct: 10  MAAVALTACLPLASLAAQPASIVPGASAPAAASVPVAPPSAPAARAALPDFADLVEKAGP 69

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-------EEPILS 102
           ++V++            +     F   P+D  +  +FR+ F              +P   
Sbjct: 70  AVVNIRTTATVPADPRGV-----FPQGPDDGDMSEFFRRFFGIPLPQAPGAPKNAQPDAP 124

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
           DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  A+L+G D   D+A++K
Sbjct: 125 DTEQNRGVGSGFILSQDGYVMTNAHVVDDADTIYVTLTDKREFKARLIGIDERTDIAIVK 184

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQID 222
           + +      V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+  D    F Q D
Sbjct: 185 I-NATNLPTVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FIQTD 242

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
             +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  
Sbjct: 243 VAVNPGNSGGPLINMNGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGKVTR 302

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           G   +    +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR +    
Sbjct: 303 GRIAVAIGEVTKDVADSIGLPRAEGALVSSVEAGGPADKAGVQPGDIILKFNGRDVDEAT 362

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK---------EL 393
           D    +    P  +  I++ ++G+   + + +   P  K +   + G             
Sbjct: 363 DLPRMVGDTKPGSKATITIWRKGTARDLPITIAEVPAEKGNARADGGKPSQPAKPRQSNA 422

Query: 394 LGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           LG+ + D+     K  ++         +      G+++   +V V   +++  K    + 
Sbjct: 423 LGLTVSDLTAEQLKAAKVPNGVHVDAADGPAARAGLKRDDIVVRVGDTDITSAKQFVEVT 482

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            K   +K  +VL++            + ++F+ L+
Sbjct: 483 SKLDPQKMVAVLVR----------RGDNTQFIPLR 507


>gi|67641132|ref|ZP_00439917.1| putative serine protease MucD [Burkholderia mallei GB8 horse 4]
 gi|121598480|ref|YP_993774.1| serine protease, MucD [Burkholderia mallei SAVP1]
 gi|124386574|ref|YP_001028760.1| serine protease, MucD [Burkholderia mallei NCTC 10229]
 gi|126451419|ref|YP_001081332.1| serine protease, MucD [Burkholderia mallei NCTC 10247]
 gi|134277628|ref|ZP_01764343.1| putative serine protease MucD [Burkholderia pseudomallei 305]
 gi|167000775|ref|ZP_02266582.1| putative serine protease MucD [Burkholderia mallei PRL-20]
 gi|167816756|ref|ZP_02448436.1| protease, Do family protein [Burkholderia pseudomallei 91]
 gi|167825164|ref|ZP_02456635.1| protease, Do family protein [Burkholderia pseudomallei 9]
 gi|167846661|ref|ZP_02472169.1| protease, Do family protein [Burkholderia pseudomallei B7210]
 gi|167911882|ref|ZP_02498973.1| protease, Do family protein [Burkholderia pseudomallei 112]
 gi|217421231|ref|ZP_03452736.1| serine protease MucD [Burkholderia pseudomallei 576]
 gi|226200005|ref|ZP_03795555.1| putative serine protease MucD [Burkholderia pseudomallei Pakistan
           9]
 gi|254177799|ref|ZP_04884454.1| serine protease, MucD [Burkholderia mallei ATCC 10399]
 gi|254184206|ref|ZP_04890796.1| protease, Do family [Burkholderia pseudomallei 1655]
 gi|254199228|ref|ZP_04905594.1| putative serine protease MucD [Burkholderia mallei FMH]
 gi|254205535|ref|ZP_04911887.1| putative serine protease MucD [Burkholderia mallei JHU]
 gi|254296867|ref|ZP_04964320.1| protease, Do family [Burkholderia pseudomallei 406e]
 gi|254357702|ref|ZP_04973975.1| putative serine protease MucD [Burkholderia mallei 2002721280]
 gi|121227290|gb|ABM49808.1| serine protease, MucD [Burkholderia mallei SAVP1]
 gi|124294594|gb|ABN03863.1| serine protease, MucD [Burkholderia mallei NCTC 10229]
 gi|126244289|gb|ABO07382.1| serine protease, MucD [Burkholderia mallei NCTC 10247]
 gi|134251278|gb|EBA51357.1| putative serine protease MucD [Burkholderia pseudomallei 305]
 gi|147748824|gb|EDK55898.1| putative serine protease MucD [Burkholderia mallei FMH]
 gi|147752978|gb|EDK60043.1| putative serine protease MucD [Burkholderia mallei JHU]
 gi|148026829|gb|EDK84850.1| putative serine protease MucD [Burkholderia mallei 2002721280]
 gi|157806926|gb|EDO84096.1| protease, Do family [Burkholderia pseudomallei 406e]
 gi|160698838|gb|EDP88808.1| serine protease, MucD [Burkholderia mallei ATCC 10399]
 gi|184214737|gb|EDU11780.1| protease, Do family [Burkholderia pseudomallei 1655]
 gi|217396643|gb|EEC36660.1| serine protease MucD [Burkholderia pseudomallei 576]
 gi|225928061|gb|EEH24098.1| putative serine protease MucD [Burkholderia pseudomallei Pakistan
           9]
 gi|238521997|gb|EEP85444.1| putative serine protease MucD [Burkholderia mallei GB8 horse 4]
 gi|243063325|gb|EES45511.1| putative serine protease MucD [Burkholderia mallei PRL-20]
          Length = 502

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 124/517 (23%), Positives = 225/517 (43%), Gaps = 50/517 (9%)

Query: 1   MF---KRQILSVKSICTV------ALTCVIFSSTYLVLEAKLPPS---SVDLPPVIARVS 48
           M     R  L   ++  +      + T     +T       +P +     D   ++ RV 
Sbjct: 1   MMNPSLRTWLVAAAVTALTPLAAQSATAAPNVTTTPAATGAVPAARAGLPDFADLVERVG 60

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL------- 101
           P++V++                       ++  +  +FR+ F                  
Sbjct: 61  PAVVNIRTTANVPADTRGALPPGL-----DNGDMSEFFRRFFGIPLPQGPGGQKNAPSTP 115

Query: 102 --SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
              DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+A
Sbjct: 116 DAPDTEQNRGVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDERTDVA 175

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT 219
           ++K+ +      V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+  D    F 
Sbjct: 176 IVKINASSL-PTVAIGDSNRVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FI 233

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+
Sbjct: 234 QTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGK 293

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  G   +    +T+E+A  +GL   +G+L+++V    PADKAG++ GD+I   +GR ++
Sbjct: 294 VTRGRIAVAIGEVTKEVADSIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVE 353

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN------DMHLEVGDKEL 393
           +  D    +    P  +  +++ ++G    + + +   P  K           +      
Sbjct: 354 AASDLPRMVGDTKPGAKATVTVWRKGQSRDLPITIAEFPADKAAKADSRQAPQQKPRSSA 413

Query: 394 LGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
           LG+ + D++    K +     +       +      G+Q+G  ++ V   +++  K    
Sbjct: 414 LGLTVSDLSPEQLKTLKLRNGVQIDAV--DGPASRAGLQRGDIVLRVGDVDITSAKQFVD 471

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +  K   ++  +VL++              ++F+ ++
Sbjct: 472 VTSKLDPQRAVAVLVR----------RGENTQFIPIR 498



 Score = 70.2 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 313 SIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKAT 372

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 373 VTV----------WRKGQSRDLPITIAE 390


>gi|78224552|ref|YP_386299.1| peptidase S1C, Do [Geobacter metallireducens GS-15]
 gi|78195807|gb|ABB33574.1| Peptidase S1C, Do [Geobacter metallireducens GS-15]
          Length = 464

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 144/491 (29%), Positives = 227/491 (46%), Gaps = 35/491 (7%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           ++ S++    +     +  +   V E+     + D   +  ++ P++V++          
Sbjct: 2   KLSSLRFFKEIVFAACL--AVLAVGESPAKVLTPDFVDLAEKLKPTVVNISTTKTLTPQF 59

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
                   F       P +++F   F +       +          GSGF I+  G+I+T
Sbjct: 60  RMRRQPSPFP-----DPFQDFFEHFFEE-------MPRRPQRERSLGSGFIISKQGFIIT 107

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH++       V LSD  E  A++ G+D   DLA++K+ +       E  D+  I+VGE
Sbjct: 108 NNHVIAGADEIKVRLSDGREFKAEVKGSDEKLDLALIKIDAKENLPVAELGDSAQIKVGE 167

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIG 243
            V  IGNPF L  TV+AGIVSA  R I   P   F Q DA IN GNSGGP FNA G VIG
Sbjct: 168 WVMAIGNPFGLAQTVTAGIVSATGRVIGSGPYDDFIQTDASINPGNSGGPLFNAEGKVIG 227

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N  IV       G+G  IP+++ K  +P L  KG+V  GW G+  Q ++ ELA   GL 
Sbjct: 228 INTAIVAG---GQGIGFAIPVNMAKDVLPQLEEKGKVTRGWLGVTMQPMSPELAKSFGLE 284

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
           G KG+LIT VVK+ PA  AG++ GD+I   DG+ I    +    +A+    + VKI + +
Sbjct: 285 GEKGALITDVVKDGPAANAGLRSGDIILEFDGKKINEMSELPRLVAAEPIGKAVKIKVLR 344

Query: 364 EGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIND------GNKKLVRIVALNPN 417
           EG      V +G       D + +    +  G+  +++        G K+   +V     
Sbjct: 345 EGKPREFTVSVGRL-AESGDENNQKTAGDAFGLSARELTKDLAARLGLKESRGVVVTGVK 403

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
           +    E  G Q G  I+ +    V+ + D E+LI +    K D V   ++          
Sbjct: 404 QGSIAELGGFQSGDIILEIGDKAVATVMDYEKLIKEY--GKGDVVRFLLRRGDSNY---- 457

Query: 478 NMSRFVSLKID 488
               +++L+I+
Sbjct: 458 ----YLALRIE 464


>gi|94312552|ref|YP_585761.1| multifunctional serine-type endopeptidase /oxidoreductase
           [Cupriavidus metallidurans CH34]
 gi|93356404|gb|ABF10492.1| multifunctional enzyme (serine-type endopeptidase / oxidoreductase)
           (degP / mucD-like) [Cupriavidus metallidurans CH34]
          Length = 487

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 133/478 (27%), Positives = 224/478 (46%), Gaps = 27/478 (5%)

Query: 16  ALTCVIFSSTYLVLEAK--LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGF 73
           A+T    + T +   A      +  D   ++ +  P++V++ V  + + +  Q+      
Sbjct: 30  AITPGYAAQTPVTASAGPIAVATPTDFSSIVDQYGPAVVNISVTARAQRTSAQVPQ---- 85

Query: 74  GNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
             +  D PL  +F++   +F   +             GSGF ++ DG ILT+ H+V++  
Sbjct: 86  -GVDPDDPLFQFFKRFGPQFQGPQNAQPQLVR---GLGSGFIVSQDGLILTNAHVVDNAT 141

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
             +V L+D  E  AK++G+D   D+AV+++ +      V   D +  RVGE V  IG+P+
Sbjct: 142 EVTVKLTDRREFKAKVLGSDPQTDIAVIRIDAKNL-PTVRLGDPSKTRVGEPVLAIGSPY 200

Query: 194 RLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
               TV+AGIVSA  R +PD     F Q D  +N GNSGGP FN  G VIG+N+ I +  
Sbjct: 201 GFENTVTAGIVSAKSRSLPDDTYVPFIQTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQT 260

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
             + G+   IP+++  K    L++ G+V  G  GI  Q + Q LA    L    G+L+ +
Sbjct: 261 GGYQGLSFAIPINVATKVEEQLVAHGKVTRGRLGISVQEVNQALAQSFNLPKPAGALVNS 320

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           V  +SPA K G+K GDVI  L   +I    D    +A   P  + K+ + ++G   ++ V
Sbjct: 321 VEPDSPAAKGGVKAGDVIVQLGDDVIDHSGDLPEHVADLKPGTETKLKVIRKGQPMTLTV 380

Query: 373 VLGS-SPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE--REVEAKGIQK 429
            +G+    A         D   LG+ ++ +    K+   I       +        GIQ 
Sbjct: 381 QVGAVKEDALAQKGNGGQDGGRLGLAVRQLTPAEKRDSGIDGGLVVEDVTGPAARVGIQP 440

Query: 430 GMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           G  I+S+N   +S  + +  L+ K+ ++    V L ++ D        +   F+ L +
Sbjct: 441 GDVILSLNGTPISSAEQLRTLVSKSGKQ----VALLVQRD--------DARIFIPLDL 486


>gi|39995191|ref|NP_951142.1| protease degQ [Geobacter sulfurreducens PCA]
 gi|39981953|gb|AAR33415.1| protease degQ [Geobacter sulfurreducens PCA]
          Length = 471

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 138/493 (27%), Positives = 237/493 (48%), Gaps = 43/493 (8%)

Query: 1   MFKRQILSVKSICTVALTCVI-----FSSTYLVLEAKLPPSSVD-------LPPVIARVS 48
           MF R++L +  +    LT                +A +     D          ++ +V+
Sbjct: 1   MFVRRLLLISLVFVTTLTACSKKEEKLFYESGRADAPVKEVPRDILATQQAFVELVKKVT 60

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERL 108
           PS+V++    ++K+                + P    F   F+ FF              
Sbjct: 61  PSVVNISTVSRRKI----------------EQPFFE-FSPFFNDFFDN----RPRFRREQ 99

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF I  +GYI+T++H+V D  S  V LS++      +VG+D   D+AV+K+ S  +
Sbjct: 100 SLGSGFIINREGYIVTNDHVVRDAESIKVKLSNENVYDGHIVGSDPKTDIAVIKIDSREE 159

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPIN 226
                  D++ ++VG+    IGNPF L  TV+ G+VSA  R     +    F Q DA IN
Sbjct: 160 LPVAVLADSDKLQVGQWAVAIGNPFGLDRTVTVGVVSATGRSNMGIETYEDFIQTDASIN 219

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  N  G VIG+N  IV       G+G  IP+++ K+ +  LI+KG+V  GW G
Sbjct: 220 PGNSGGPLLNVHGEVIGINTAIVA---AGQGIGFAIPVNMAKQIVTQLITKGKVTRGWLG 276

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q +T +LA   GL+  +G L++ VVK SPA  AG++ GD+I    G+ IK  Q    
Sbjct: 277 VTIQPVTDDLAKEFGLKKAQGVLVSDVVKGSPAAGAGIRQGDIILRFAGKEIKDAQHLQR 336

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN-DMHLEVGDKELLGMVLQDINDGN 405
            +   +P  +V + + +EG +  +++   SS +A+      + G  + LG+ ++++    
Sbjct: 337 VVGDTAPGTKVPVVVFREGKEVQLSLATASSDSAQARQARPQGGAPDTLGLAVEELPREY 396

Query: 406 KKL--VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
           ++     ++ +  +        GI++G  IV+VN   V+ + + +R++ +A   +R SV+
Sbjct: 397 RQEGFTGVLVVQVDDGSAAGEAGIREGDVIVAVNRRPVANLAEYDRVMREA--ARRGSVV 454

Query: 464 LQIKYDPDMQSGN 476
           L ++        +
Sbjct: 455 LLVRRGEASIYFS 467


>gi|186475602|ref|YP_001857072.1| protease Do [Burkholderia phymatum STM815]
 gi|184192061|gb|ACC70026.1| protease Do [Burkholderia phymatum STM815]
          Length = 502

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 132/515 (25%), Positives = 219/515 (42%), Gaps = 54/515 (10%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE 65
           ILSV+     A+             A    +  D   ++ +V P++V++    +   S  
Sbjct: 3   ILSVRKFFAAAVLVACLPLAPHTASAAPAANLPDFTDLVDKVGPAVVNIRTTARVSNSTR 62

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL-----------------------S 102
                 G     +D  +  +FR+ F                                   
Sbjct: 63  ------GLPPGMDDGDMSEFFRRFFGIPMPNSPQSPGTPNSPRGGNNGNNDQDQSPDNGP 116

Query: 103 DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLK 162
           DT +    GSGF ++ DGY++T+ H+++D  +  V L+D  E  AKL+G D   D+AV+K
Sbjct: 117 DTEQNSGVGSGFILSPDGYVMTNAHVIDDADTIYVTLTDKREFKAKLIGVDERTDVAVVK 176

Query: 163 VQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQID 222
           + +      V   D+N +RVGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D
Sbjct: 177 INAANL-PTVPIGDSNKVRVGEWVVAIGSPFGLENTVTAGIVSAKGRDTGDYLP-FIQTD 234

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
             +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  
Sbjct: 235 VAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKASGKVVR 294

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           G   +    +T+++A  LGL   +G+L+++V    PADKAG++ GD+I   +G  + +  
Sbjct: 295 GRIAVAIGEVTKDVADSLGLPKAQGALVSSVEPGGPADKAGVQPGDIILKFNGHNVDTAT 354

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-------KNDMHLEVGDKELLG 395
           D    +    P  +  I+L ++G    V V +             K     +      LG
Sbjct: 355 DLPRMVGDTKPGTKATITLWRKGQTREVPVTVAEMQPEKAAKADQKKAPTPKPRASNALG 414

Query: 396 MVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           + + DI     K +     +       +      G+Q+G  I+ V   +++  K  E + 
Sbjct: 415 VAVSDIPAEQMKSLKLHNGVQVDAV--DGPAARVGLQRGDIILRVGDTDITSAKQFEEVT 472

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
                 K  ++L++              ++FV ++
Sbjct: 473 SHLDASKMVALLVR----------RGENTQFVPVR 497


>gi|167581147|ref|ZP_02374021.1| serine protease, MucD [Burkholderia thailandensis TXDOH]
 gi|167619231|ref|ZP_02387862.1| serine protease, MucD [Burkholderia thailandensis Bt4]
 gi|257138455|ref|ZP_05586717.1| serine protease, MucD [Burkholderia thailandensis E264]
          Length = 502

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 122/513 (23%), Positives = 221/513 (43%), Gaps = 43/513 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLP-------------PSSVDLPPVIARVS 48
                L    +          ++      + +                  D   ++ RV 
Sbjct: 1   MMNPSLRTWLVAAAVTALTPLAAQSATAASNVTTAPAATGAAPTTRAGLPDFADLVERVG 60

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-----PILSD 103
           P++V++                 G  N       + +F     +   G++     P   D
Sbjct: 61  PAVVNIRTTANVPADTRGAL-PPGLDNGDMSEFFRRFFGIPLPQPPGGQKNAPSAPDAPD 119

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
           T +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+A++K+
Sbjct: 120 TEQNRGVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDERTDVAIVKI 179

Query: 164 QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDA 223
            +      V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+  D    F Q D 
Sbjct: 180 NASSL-PTVAIGDSNRVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FIQTDV 237

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G
Sbjct: 238 AVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGKVTRG 297

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
              +    +T+E+A  +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D
Sbjct: 298 RIAVAIGEVTKEVADSIGLPKAEGALVSSVESGGPADKAGLQPGDIILKFNGRSVETASD 357

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK------NDMHLEVGDKELLGMV 397
               +    P  +  +++ ++G    + + +   P  K           +      LG+ 
Sbjct: 358 LPRMVGDTKPGTKATVTVWRKGQSRDLPITIAEFPADKIAKASSRQAPQQKPRSSALGLA 417

Query: 398 LQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + D++    K +     +       +      G+Q+G  ++ V   ++S  K    +  K
Sbjct: 418 VSDLSPEQLKTLKLRNGVQIDAV--DGPAARAGLQRGDIVLRVGDVDISSAKQFVDVTSK 475

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
              ++  +VL++            + ++F+ ++
Sbjct: 476 LDPQRAVAVLVR----------RGDNTQFIPIR 498



 Score = 70.9 bits (171), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 33/88 (37%), Gaps = 2/88 (2%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 313 SIGLPKAEGALVSSVESGGPADKAGLQPGDIILKFNGRSVETASDLPRMVGDTKPGTKAT 372

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V   +      +     ++ F + KI K
Sbjct: 373 V--TVWRKGQSRDLPITIAEFPADKIAK 398


>gi|197106150|ref|YP_002131527.1| serine protease HtrA [Phenylobacterium zucineum HLK1]
 gi|196479570|gb|ACG79098.1| serine protease HtrA [Phenylobacterium zucineum HLK1]
          Length = 519

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 143/492 (29%), Positives = 243/492 (49%), Gaps = 37/492 (7%)

Query: 19  CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
             +  ++   + A  P + +    +  RVSP++VS+ V  +   S  +    + F  +P 
Sbjct: 40  AGLIKASTTPIFAPPPGAPMSFADIFDRVSPAVVSINVTSRVNPSDLRQIPGFPFNLIPR 99

Query: 79  DHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
                        +     E        +   GSGFFI+ DGYI+T+NH+VE+    +V+
Sbjct: 100 QPDGGE------DEEGGQTERGQPRLPTQQSAGSGFFISADGYIVTNNHVVENAEKITVV 153

Query: 139 LSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRG 197
           L D+TEL A +VG D   D+AV+KV++    F  V FE++   RVG+ V T+GNPF L G
Sbjct: 154 LKDETELEATVVGRDEATDIAVIKVKNGKGPFPFVNFENSARPRVGDWVITVGNPFGLGG 213

Query: 198 TVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           T +AGI+SA  RDI +    + QIDAPIN+GNSGGP F+  G VIGVN  I +     +G
Sbjct: 214 TATAGIISAYGRDIGETFVDYIQIDAPINRGNSGGPTFDVYGRVIGVNTAIFSPSGGSVG 273

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +G  IP  +       LI  G+++ G+ G   QN T E+A   GL   KG+++  +    
Sbjct: 274 IGFAIPADLADSVTKQLIRGGKIERGYIGATIQNFTTEMAEAAGLGEQKGAIVADLTPGG 333

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           P+ +AG++VGDV+  ++G  ++S  +   Q+A   P + +++ + +EG + +V V  G+ 
Sbjct: 334 PSQRAGLQVGDVVTAINGTAVRSSSELTRQVARAKPGDSLRLDVIREGRRRTVEVRAGTR 393

Query: 378 PTAKN---------------DMHLEVGDKELLGMVLQDINDGNKKLV-------RIVALN 415
           P+ +                           LG+ L  + D  +  +         V  +
Sbjct: 394 PSERELAAANDNLGGQGAPGGEGQPQASPSALGLTLGVVTDAMRSRLNLPADVRGAVVES 453

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
            ++  +  +KG+++G  I   N   ++   ++  ++ +AK+  R SVL+ +  +      
Sbjct: 454 VDQNSDAASKGLRRGDVITRANNRAINSPAELVAVVEEAKKAGRTSVLVGVFRN------ 507

Query: 476 NDNMSRFVSLKI 487
               + F+ LK+
Sbjct: 508 --GRTSFLPLKV 517


>gi|107100227|ref|ZP_01364145.1| hypothetical protein PaerPA_01001250 [Pseudomonas aeruginosa PACS2]
          Length = 464

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 135/485 (27%), Positives = 225/485 (46%), Gaps = 32/485 (6%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           VAL  +  + T             D  P++ + SP++V++    K          A G  
Sbjct: 2   VALLALSLAMTARA-------ELPDFTPLVEQASPAVVNISTRQKLPDRA----MARGQL 50

Query: 75  NLPEDHPLKNYFRKDFHKFFSG-EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
           ++P+   L   FR    +              E    GSGF I++DGYILT+NH+V D  
Sbjct: 51  SIPDLEGLPPMFRDFLERSIPQVPRNPRGQQREAQSLGSGFIISNDGYILTNNHVVADAD 110

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
              V LSD +E  AKLVG D   D+AVLK+++      ++  D+N ++VGE V  IG+PF
Sbjct: 111 EILVRLSDRSEHKAKLVGADPRSDVAVLKIEAKNL-PTLKLGDSNKLKVGEWVLAIGSPF 169

Query: 194 RLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
               +V+AGIVSA  R +P+     F Q D  IN GNSGGP  N  G V+G+N+ I T  
Sbjct: 170 GFDHSVTAGIVSAKGRSLPNESYVPFIQTDVAINPGNSGGPLLNLQGEVVGINSQIFTRS 229

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              MG+   IP+ +       L   G+V  GW G++ Q + ++LA   GL    G+L+  
Sbjct: 230 GGFMGLSFAIPIDVALNVADQLKKAGKVSRGWLGVVIQEVNKDLAESFGLDKPSGALVAQ 289

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           +V++ PA K G++VGDVI  L+G+ I    D    + +  P +++ + + + G + S+++
Sbjct: 290 LVEDGPAAKGGLQVGDVILSLNGQSINESADLPHLVGNMKPGDKINLDVIRNGQRKSLSM 349

Query: 373 VLGSSPTAKND-----MHLEVGDKELLGMVLQDINDGNKKLV---RIVALNPNREREVEA 424
            +GS P    +               LG+ + D+    +K +     V +   ++     
Sbjct: 350 AVGSLPDDDEEIASMGAPGAERSSNRLGVTVADLTAEQRKSLDIQGGVVIKEVQDGPAAV 409

Query: 425 KGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVS 484
            G++ G  I  ++   V+  K    +     + +  S+ +               + F++
Sbjct: 410 IGLRPGDVITHLDNKAVTSTKVFADVAKALPKNRSVSMRVL----------RQGRASFIT 459

Query: 485 LKIDK 489
            K+ +
Sbjct: 460 FKLAE 464


>gi|325981695|ref|YP_004294097.1| protease Do [Nitrosomonas sp. AL212]
 gi|325531214|gb|ADZ25935.1| protease Do [Nitrosomonas sp. AL212]
          Length = 471

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 131/484 (27%), Positives = 234/484 (48%), Gaps = 33/484 (6%)

Query: 14  TVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGF 73
            + +  ++ SS   V   +LP    D   ++ +   ++V++       V   Q+      
Sbjct: 4   LIIIPFILLSSVTFVQATELP----DFTGLVEKHGVAVVNISAVQSLNVMSNQII--PEI 57

Query: 74  GNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
             +PE+ P  ++FR+    F            E    GSGF I+ DGYILT+ H+VE   
Sbjct: 58  PGIPENSPFYDFFRRHIQPFPG------PRKSEPKSLGSGFIISSDGYILTNAHVVETAD 111

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
             +V L+D  E  A+++GTD   D+A++K+        V   +  N++VGE V  IG+PF
Sbjct: 112 EITVKLNDKREFVAEIIGTDRKTDIALIKIS-ATDLPVVTQGNPENLKVGEWVIAIGSPF 170

Query: 194 RLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
               +V+AGIVSA  R +       F Q D  IN GNSGGP FN  G V+G+N+ I +  
Sbjct: 171 GFEHSVTAGIVSAKGRSLAQENYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQIYSRT 230

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
              MG+   IP+++  +    L + G+V  G  G+M Q +T+ELA   GL  ++G+L+ +
Sbjct: 231 GGFMGLSFAIPINVATEIADQLKTSGKVSRGRIGVMIQEVTKELAESFGLTDSRGALVVS 290

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           + K+ PA KAG++  D+I   D + + +  D    + +  P  +  I + ++G+  ++ V
Sbjct: 291 IEKDGPAGKAGVQARDIILKFDEKEVLTSSDLPRIVGNTKPGSKATIQIWRDGALRTIKV 350

Query: 373 VLGSSPTAKND------MHLEVGDKELLGMVLQDINDGNKKLVRI---VALNPNREREVE 423
            +G +P+ +           +      LG+ L ++ D  KK + I   + +   +     
Sbjct: 351 EVGETPSDEGAESRKLKQSKKPDTSNRLGLALSEVTDEQKKQLEIANGLLVEDMQSGIAS 410

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
             GI+ G  I+  N+ +V  +     L+ + K  K  ++L++            +++ F+
Sbjct: 411 RSGIRIGDIILGFNSKDVKSVAQFNELLNQVKSGKNIALLVK----------RGDITTFI 460

Query: 484 SLKI 487
           ++K+
Sbjct: 461 TMKL 464


>gi|332560859|ref|ZP_08415177.1| putative trypsin-like serine protease [Rhodobacter sphaeroides
           WS8N]
 gi|332274657|gb|EGJ19973.1| putative trypsin-like serine protease [Rhodobacter sphaeroides
           WS8N]
          Length = 483

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 133/483 (27%), Positives = 229/483 (47%), Gaps = 26/483 (5%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           R  L    I +  +T  +  +      A+          ++ARVSP++V + V  K K S
Sbjct: 7   RSSLKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVTAKSKES 66

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-RLMFGSGFFITDDGYI 122
                            P + + R+          P   +  +     GSGF I+ DG I
Sbjct: 67  TPMA-----------GSPFEEFLRRFGEIDPQFRMPQAPEGGQVMHGLGSGFLISQDGII 115

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+VE+     V L D  E  A++VGTD + D+AV++++  +    VE  D+  +RV
Sbjct: 116 VTNNHVVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRV 175

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHV 241
           G+AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V
Sbjct: 176 GDAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKV 235

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I +     +G+G  IP + +K  +  L  KG V  GW G+  Q +T E+A  +G
Sbjct: 236 VGMNTAIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMG 295

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L G  G+L+  V + SPAD+ G++ GDVI  ++G+ +         IA+    E+ ++++
Sbjct: 296 LEGRDGALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKAQLTV 355

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---LGMVLQDINDGNKKLV-------RI 411
            ++G +  + V +G     +  +      + L   LG+ +Q +     + +        +
Sbjct: 356 QRDGRQQEMTVTIGELTPDRAQVASAESPEGLGGPLGIEVQPLEPALARQLGLPDGASGV 415

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V    +       + +  G  I       V   +D+   + +A+   +  +L+++    +
Sbjct: 416 VVTAVDPSGPNADR-LAPGDVIQEAAGRPVETPRDLASAMREAR--GKGVMLMKVLRQGN 472

Query: 472 MQS 474
              
Sbjct: 473 PVY 475


>gi|167586628|ref|ZP_02379016.1| protease Do [Burkholderia ubonensis Bu]
          Length = 489

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 129/506 (25%), Positives = 224/506 (44%), Gaps = 41/506 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M K   L+++    VA              A    S  D   ++ +V P++V++      
Sbjct: 1   MMK---LTLRKWLAVAAVAACLPLMPHSAAAAPAASLPDFADLVEKVGPAVVNIRTTANV 57

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS---------GEEPILSDTVERLMFG 111
                +     GF N      +  +FR+ F               +     DT +    G
Sbjct: 58  PTGGPRGVLPPGFDNGD----MSEFFRRFFGIPLPQAPGNPKNAPQPDNPPDTEQNRGVG 113

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+Q+      
Sbjct: 114 SGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQASNL-PV 172

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSG 231
           V   D+N +RVGE V  IG+PF L  TV+AGIVS+  R+  D    F Q D  +N GNSG
Sbjct: 173 VAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAVNPGNSG 231

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G   +    
Sbjct: 232 GPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRIAVAIGE 291

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR + +  D    +   
Sbjct: 292 VTKDVADSIGLPKAEGALVSSVEPGGPADKAGVQPGDIILKFNGRPVDTASDLPRMVGDT 351

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKND-------MHLEVGDKELLGMVLQDINDG 404
            P  +  I++ ++G    + + +  +P               +      LG+ + DI   
Sbjct: 352 KPGAKATINVWRKGQARDLPITIAETPADTTAKADPGKKPPQKPRQSNALGLTVSDIPAD 411

Query: 405 NKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
             K +     +       +      G+Q+G  ++ V   +++  K    +  +   +K  
Sbjct: 412 QLKALKLRSGVQVDGV--DGPAARAGLQRGDIVLRVGDTDITSAKQFADVTAQLDPQKAV 469

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +VL++            + ++F  L+
Sbjct: 470 AVLVR----------RGDNTQFFPLR 485


>gi|77465252|ref|YP_354755.1| putative trypsin-like serine protease [Rhodobacter sphaeroides
           2.4.1]
 gi|77389670|gb|ABA80854.1| Putative trypsin-like serine protease [Rhodobacter sphaeroides
           2.4.1]
          Length = 483

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 133/483 (27%), Positives = 230/483 (47%), Gaps = 26/483 (5%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           R  L    I +  +T  +  +      A+          ++ARVSP++V + V  K K S
Sbjct: 7   RSSLKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVTAKSKES 66

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-RLMFGSGFFITDDGYI 122
                            P + + R+          P   +  +     GSGF I+ DG I
Sbjct: 67  TPMA-----------GSPFEEFLRRFGEIDPQFRMPQAPEGGQVMHGLGSGFLISQDGII 115

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+VE+     V L D  E  A++VGTD + D+AV++++  +    VE  D+  +RV
Sbjct: 116 VTNNHVVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRV 175

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHV 241
           G+AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V
Sbjct: 176 GDAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKV 235

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I +     +G+G  IP + +K  +  L  KG V  GW G+  Q +T E+A  +G
Sbjct: 236 VGMNTAIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMG 295

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L G  G+L+  V + SPAD+ G++ GDVI  ++G+ +         IA+    E+ ++++
Sbjct: 296 LEGRDGALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKAQLTV 355

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---LGMVLQDINDGNKKLV-------RI 411
            ++G +  + V +G     +  +      + L   LG+ +Q +     + +        +
Sbjct: 356 QRDGRQQEMTVTIGELTPDRAQVASAESPEGLGGPLGIEVQPLEPALARQLGLPDGASGV 415

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V    +       + +  G  I     H +   +D+   + +A+   +  +L+++    +
Sbjct: 416 VVTAVDPSGPNADR-LAPGDVIQEAAGHPIETPRDLASAMREAR--GKGVMLMKVLRQGN 472

Query: 472 MQS 474
              
Sbjct: 473 PVY 475


>gi|294084285|ref|YP_003551043.1| peptidase S1C, Do [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663858|gb|ADE38959.1| Peptidase S1C, Do [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 511

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 138/494 (27%), Positives = 220/494 (44%), Gaps = 40/494 (8%)

Query: 14  TVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGF 73
                 +  S ++    A            + R+SP++V++                   
Sbjct: 37  VAVFVVIFMSISFAGGIAGASERPDSFADQVERLSPAVVNISTTTIVNDGQR-----MEM 91

Query: 74  GNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
              P   P + +F+              +        GSGF I D G ++T++H++E+  
Sbjct: 92  PQFPPGSPFEEFFKNFGDN---------NRQRRAQSLGSGFIIDDAGIVVTNHHVIENAE 142

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNP 192
              VIL+D+T   AK++G D   D+AVLK+   D + + V+F D++ +RVG+ V  IGNP
Sbjct: 143 EIRVILADETSFTAKVLGQDKKTDIAVLKIDPGDTELVSVKFGDSDALRVGDWVLAIGNP 202

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L GTV+AGIVSA  RDI + P   F Q DA IN+GNSGGP FN  G VIG+N  I + 
Sbjct: 203 FGLGGTVTAGIVSARGRDIGNGPYDDFIQTDASINRGNSGGPLFNVEGEVIGINTAIFSQ 262

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
               +G+G  I  ++  +    L   G+   GW G+  Q +T ++A  LGL    G+L++
Sbjct: 263 SGGSVGIGFAISSNLASRVADQLTEFGKTRRGWLGVFIQEVTTDIAESLGLDEAVGALVS 322

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V + SPA  AG++ GDVI   DG+ I+  +D    +A      +VK+ L ++G K +V 
Sbjct: 323 TVNENSPAFVAGVEPGDVILKFDGKAIERMRDLPRIVAETDIGSKVKVELFRQGKKMTVT 382

Query: 372 VVLGSSP---------TAKNDMHLEVGDKELLGMVLQDINDGNKKLVR-------IVALN 415
           V LG            +  +           LGM +QDI+    + +        +  + 
Sbjct: 383 VELGELEKAELVGLVDSDSSSEPGNKQSFGSLGMSVQDIDAKLAEELGIDPELTGVAVVE 442

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
                    KG+  G  I       V     + + I  A+   +  +L+ ++ D      
Sbjct: 443 VLPGSPAADKGLAPGDIIRRYGQRRVENALGLAKDIKAAENGGKSGILILVERDGRE--- 499

Query: 476 NDNMSRFVSLKIDK 489
                RFV +   +
Sbjct: 500 -----RFVQIGFAE 508


>gi|330818167|ref|YP_004361872.1| Protease Do [Burkholderia gladioli BSR3]
 gi|327370560|gb|AEA61916.1| Protease Do [Burkholderia gladioli BSR3]
          Length = 497

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 130/455 (28%), Positives = 218/455 (47%), Gaps = 19/455 (4%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK-FFSG 96
            D   ++    P++V++  +   K S  +   A      P D P   +F+  + +    G
Sbjct: 56  PDFSGLVETYGPAVVNISAKHVVKASARRGGGAQQLPIDPSD-PFYQFFKHFYGQVPGMG 114

Query: 97  EEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALF 156
                +D       GSGF ++ DGYILT+ H+++     +V L+D  E  AK++G D   
Sbjct: 115 GGGGQADDTPSTSLGSGFIVSPDGYILTNAHVIDGANVVTVKLTDKREYRAKVIGADKQS 174

Query: 157 DLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG 216
           D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +PD   
Sbjct: 175 DVAVLKIDASGL-PTVKIGDPQQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENY 233

Query: 217 T-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
           T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K    L+
Sbjct: 234 TPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDELV 293

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
             G V  G  G+  Q L Q LA   GL+   G+L+++V  + PA KAG++ GDVI  ++G
Sbjct: 294 KTGHVSRGRLGVAVQGLDQTLASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILSVNG 353

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM-HLEVGDKELL 394
             ++       QIAS  P  +  + + ++ ++  V V L S   ++    + E  ++  L
Sbjct: 354 TPVQDSTMLPGQIASLKPGTKADLQIWRDKARKDVTVTLTSLADSQQVAGNDEPAEQGRL 413

Query: 395 GMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
           G+ ++ ++   +    +    +           GIQ G  I++VN   V+  + +   + 
Sbjct: 414 GVAVRQLSPQERAGSSLTHGLVVQQATGPAANAGIQPGDVILAVNGRPVTSPEQLRDAVK 473

Query: 453 KAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            A     +S+ L I+ D        +   FV + +
Sbjct: 474 NA----GNSLALLIQRD--------DAQIFVPVDL 496


>gi|307821954|ref|ZP_07652186.1| protease Do [Methylobacter tundripaludum SV96]
 gi|307736520|gb|EFO07365.1| protease Do [Methylobacter tundripaludum SV96]
          Length = 467

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 131/472 (27%), Positives = 233/472 (49%), Gaps = 32/472 (6%)

Query: 30  EAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHP--LKNYFR 87
                    D   ++     ++V++    K      +  NA     LPE  P  ++ +F+
Sbjct: 16  NQNALAQLPDFTDMVKTNGIAVVNISTTQKAP---PEAENAPEEPQLPEGMPPEMEEFFK 72

Query: 88  KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
           +  ++   G  P      +    GSGF I+ DGY+LT++H+V+D     V LSD  EL A
Sbjct: 73  RFLNEQGGGYVP-----RDTTSLGSGFVISPDGYVLTNSHVVKDADEIVVKLSDHRELLA 127

Query: 148 KLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSAL 207
           K++GTDA  D+A+LKV +      V   + N ++VGE V  IG+PF    +V+AGI+SA 
Sbjct: 128 KVIGTDARTDVALLKVDAKDL-PAVTIGNPNKLQVGEWVLAIGSPFGFEQSVTAGIISAK 186

Query: 208 DRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
            R +P      F Q D  IN GNSGGP FN  G V+G+N+ I +     MG+   IP+ +
Sbjct: 187 GRSLPGGNYVPFIQTDVAINPGNSGGPLFNMEGKVVGINSQIYSRTGGFMGLSFAIPMDV 246

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
           +   +  + + G+  HGW G+  Q++T+ELA   G++  +G+L++ V+ +SPA+KAG+++
Sbjct: 247 VMNVVDQIKATGKAAHGWLGVQIQDVTRELAESFGMKKPQGALVSKVLPDSPAEKAGLQI 306

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK----N 382
           GD+I   +G+ I++  D    +      ++  + + ++G   S+   +G  P        
Sbjct: 307 GDIITEFNGQQIETSGDLPPMVGITPINDKATLKIIRQGETKSLDFKVGLLPDEADKLAE 366

Query: 383 DMHLEVGDKELLGMVLQDINDGNKKLV-----RIVALNPNREREVEAKGIQKGMTIVSVN 437
                      LG+ + D+ D  ++ +      ++  +  +    +  GIQ+G  I+ + 
Sbjct: 367 AKVAPKLPHNRLGVNVIDLTDTQRETLQIAKNGVLVQDVAKGT-AKDAGIQRGDVILRIQ 425

Query: 438 THEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            + V    D E+++ K    K  ++L+Q                F+++K++K
Sbjct: 426 NNVVRDAADFEKIVTKLPAGKSVAILIQ----------RQGSPVFLAIKVEK 467


>gi|298504195|gb|ADI82918.1| protease lipoprotein DegQ [Geobacter sulfurreducens KN400]
          Length = 468

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 136/492 (27%), Positives = 235/492 (47%), Gaps = 44/492 (8%)

Query: 1   MFKRQILSVKSICTVALTCVI-----FSSTYLVLEAKLPPSSVD-------LPPVIARVS 48
           MF R++L +  +    LT                +A +     D          ++ +V+
Sbjct: 1   MFVRRLLLISLVFVTTLTACSKKEEKLFYESGRADAPVKEVPRDILATQQAFVELVKKVT 60

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERL 108
           PS+V++    ++K+                + P    F   F+ FF              
Sbjct: 61  PSVVNISTVSRRKI----------------EQPFFE-FSPFFNDFFDN----RPRFRREQ 99

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF I  +GYI+T++H+V D  S  V LS++      +VG+D   D+AV+K+ S  +
Sbjct: 100 SLGSGFIINREGYIVTNDHVVRDAESIKVKLSNENVYDGHIVGSDPKTDIAVIKIDSREE 159

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQIDAPIN 226
                  D++ ++VG+    IGNPF L  TV+ G+VSA  R     +    F Q DA IN
Sbjct: 160 LPVAVLADSDKLQVGQWAVAIGNPFGLDRTVTVGVVSATGRSNMGIETYEDFIQTDASIN 219

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  N  G VIG+N  IV       G+G  IP+++ K+ +  LI+KG+V  GW G
Sbjct: 220 PGNSGGPLLNVHGEVIGINTAIVA---AGQGIGFAIPVNMAKQIVTQLITKGKVTRGWLG 276

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q +T +LA   GL+  +G L++ VVK SPA  AG++ GD+I    G+ IK  Q    
Sbjct: 277 VTIQPVTDDLAKEFGLKKAQGVLVSDVVKGSPAAGAGIRQGDIILRFAGKEIKDAQHLQR 336

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNK 406
            +   +P  +V + + +EG +  ++  L ++ +       + G  + LG+ ++++    +
Sbjct: 337 VVGDTAPGTKVPVVVFREGKEVQLS--LATASSDSAQARPQGGAPDTLGLAVEELPREYR 394

Query: 407 KL--VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
           +     ++ +  +        GI++G  IV+VN   V+ + + +R++ +A   +R SV+L
Sbjct: 395 QEGFTGVLVVQVDDGSAAGEAGIREGDVIVAVNRRPVANLAEYDRVMREA--ARRGSVVL 452

Query: 465 QIKYDPDMQSGN 476
            ++        +
Sbjct: 453 LVRRGEASIYFS 464


>gi|163740765|ref|ZP_02148158.1| periplasmic serine protease, DO/DeqQ family protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161385756|gb|EDQ10132.1| periplasmic serine protease, DO/DeqQ family protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 499

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 141/506 (27%), Positives = 245/506 (48%), Gaps = 43/506 (8%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           RQ+   + +    ++ ++  +   + +A+       L P+  +VS              +
Sbjct: 17  RQMTQWRLLWLAMISTLMVLAQVAIAQAR----PESLAPLADKVS------RAVVNITTT 66

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYIL 123
                 +   G +PE  P +++FR+   +                  GSGF I++DGYI+
Sbjct: 67  TVVEGRSGPQGIVPEGSPFEDFFREFQDRNGG----QGDRPRRSSALGSGFVISEDGYIV 122

Query: 124 TSNHIVEDGASFSVILSDD-----TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           T+NH++E+     +            LPAK+VGTD   D+A+LKV++      V+F D++
Sbjct: 123 TNNHVIEEADEIEIEFFPGEGQPAQPLPAKVVGTDPNTDIALLKVEAPMPLTFVKFGDSD 182

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNAL 238
             RVG+ V  +GNP     ++SAGIVSA +R++      + Q DA IN+GNSGGP FN  
Sbjct: 183 LARVGDWVVAMGNPLGQGFSLSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMD 242

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+GVN  I++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A 
Sbjct: 243 GQVVGVNTAILSPNGGSIGIGFSMASNVVSKVVNQLKEFGETRRGWLGVRIQDVTKDVAE 302

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            +GL   KG+L+T  V E PA  AG+  GDVI   DG  +K  +  V Q+ +    + V+
Sbjct: 303 AMGLDSAKGALVTD-VPEGPAKAAGLLAGDVILSFDGVDVKDTRALVRQVGNTEVGKAVR 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD--------KELLGMVLQDINDGNKKLV- 409
           + + +EG   ++ V LG    A+       GD        K+LLG+ +  +++  +  + 
Sbjct: 362 VRVFREGKTETLRVTLGRREDAQRQSTPASGDDNAPDMTEKQLLGLTVSRLSEDQRSELN 421

Query: 410 ------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
                  +V  + +   E   KG++ G  I      +++ I ++E  I +AKE  R S+L
Sbjct: 422 VPDGMDGLVITSVDETSEAWEKGMRAGDLITEAGQQKLTSISELEARIDEAKEAGRKSLL 481

Query: 464 LQIKYDPDMQSGNDNMSRFVSLKIDK 489
           L ++   +         RFV+L + +
Sbjct: 482 LLVRRAGE--------PRFVALNLSE 499


>gi|126464715|ref|YP_001045828.1| protease Do [Rhodobacter sphaeroides ATCC 17029]
 gi|126106526|gb|ABN79056.1| protease Do [Rhodobacter sphaeroides ATCC 17029]
          Length = 483

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 134/483 (27%), Positives = 230/483 (47%), Gaps = 26/483 (5%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           R  L    I +  +T  +  +      A+          ++ARVSP++V + V  K K S
Sbjct: 7   RSSLKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVTAKSKES 66

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-RLMFGSGFFITDDGYI 122
                            P + + R+          P   +  +     GSGF I+ DG I
Sbjct: 67  TPMA-----------GSPFEEFLRRFGEIDPQFRMPQAPEGGQVMHGLGSGFLISQDGII 115

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+VE+     V L D  E  A++VGTD + D+AV++++  +    VE  D+  +RV
Sbjct: 116 VTNNHVVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRV 175

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHV 241
           G+AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V
Sbjct: 176 GDAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKV 235

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I +     +G+G  IP + +K  +  L  KG V  GW G+  Q +T E+A  +G
Sbjct: 236 VGMNTAIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMG 295

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L G  G+L+  V + SPAD+ G++ GDVI  ++G+ +         IA+    E+ ++++
Sbjct: 296 LEGRDGALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKAQLTV 355

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---LGMVLQDINDGNKKLV-------RI 411
            ++G +  + V +G     +  +      + L   LG+ +Q +     + +        I
Sbjct: 356 QRDGRQQEMTVTIGELTPDRAQVASAESPEGLGGPLGIEVQPLEPALARQLGLPDGASGI 415

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V    +       + +  G  I     H +   +D+   + +A+   +  +L+++    +
Sbjct: 416 VVTAVDPSGPNADR-LAPGDVIQEAAGHPIETPRDLASAMREAR--GKGVMLMKVLRQGN 472

Query: 472 MQS 474
              
Sbjct: 473 PVY 475


>gi|295677180|ref|YP_003605704.1| protease Do [Burkholderia sp. CCGE1002]
 gi|295437023|gb|ADG16193.1| protease Do [Burkholderia sp. CCGE1002]
          Length = 504

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 129/513 (25%), Positives = 221/513 (43%), Gaps = 51/513 (9%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
            SV+      +          +  A    +  D   ++ +V P++V++    +   S  +
Sbjct: 4   FSVRKFLAAVVVAACLPLLPHMASATPAANLPDFTDLVDKVGPAVVNIRTTTRVSNSSSR 63

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS----------------------DT 104
                G     +D  +  +FR+ F                                  D 
Sbjct: 64  GGLPPGM----DDGDMSEFFRRFFGIPLPQSPQSPRGGDNGGGGGGGSGGSPDSQDNTDP 119

Query: 105 VERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
            +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+ 
Sbjct: 120 EQNSGVGSGFILSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIN 179

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAP 224
           +      +   D+N +RVGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D  
Sbjct: 180 ASNL-PTITIGDSNKVRVGEWVVAIGSPFGLENTVTAGIVSAKGRDTGDYLP-FIQTDVA 237

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L S G+V  G 
Sbjct: 238 VNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKSSGKVVRGR 297

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
             +    +T+++A  LGL   +G+L+++V    PADKAG++ GD+I   +G  + +  D 
Sbjct: 298 IAVAIGEVTKDVADSLGLPKAQGALVSSVEPGGPADKAGVQPGDIILKFNGHSVDTATDL 357

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-------ELLGMV 397
              +    P  +  IS+ ++G    + + +      K     +   +         LG+ 
Sbjct: 358 PRMVGDTKPGTKTSISVWRKGQTRELPITIAEMQPDKVAKADQKKPQAPKQRATNALGIA 417

Query: 398 LQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           + DI    +K +     +       +      G+QKG  I+ V   +V+  K  + L   
Sbjct: 418 VSDIPADQQKALKISNGVQIDAV--DGPAARLGLQKGDIILRVGDTDVTSAKQFDELTSH 475

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
              +K  ++L++            + ++FV ++
Sbjct: 476 LDSQKMVALLVR----------RGDNTQFVPIR 498


>gi|296157269|ref|ZP_06840105.1| protease Do [Burkholderia sp. Ch1-1]
 gi|295892605|gb|EFG72387.1| protease Do [Burkholderia sp. Ch1-1]
          Length = 503

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 129/461 (27%), Positives = 217/461 (47%), Gaps = 24/461 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG---NLPEDHPLKNYFRKDFH--K 92
            D   ++    P++V++  +   K +  +     G G    +    P   +++  F    
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQTALRGNPGNGGGSQLPIDPSDPFYQFYKHFFGGMP 114

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
              G +   +        GSGF +++DGYILT+ H+V+     +V L+D  E  AK+VG 
Sbjct: 115 GMQGGDGGDAPDQPSASLGSGFIVSNDGYILTNAHVVDGANVVTVKLTDKREFRAKVVGA 174

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +P
Sbjct: 175 DKQSDVAVLKIDASNL-PTVKIGDPRQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRSLP 233

Query: 213 DRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
           +   T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K  
Sbjct: 234 NENYTPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVK 293

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             ++  G V  G  G+  Q + Q LA   G++  +G+L+++V    PA K G++ GDVI 
Sbjct: 294 DDIVKTGHVSRGRLGVAVQGMNQTLANSFGMQKPQGALVSSVDPGGPAAKGGLQPGDVIL 353

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD- 390
            ++G  +    D   Q+A  +P     + + ++ +   + V +GS   AK          
Sbjct: 354 SVNGEPVGDSADLPSQVAGLAPGSSATVQVWRDKATKDLKVTIGSLSDAKVASDKTDQPT 413

Query: 391 --KELLGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
             +  LG+ ++ +    K    I    L        E+ GIQ G  I++VN   +S +  
Sbjct: 414 QLQGRLGVAVRPLTPEEKSGASISHGLLVQQSGGAAESAGIQPGDVILAVNGRPISSVDQ 473

Query: 447 VERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           ++++I  A     +S+ L I+ D        N   FV + +
Sbjct: 474 LKQMIASA----GNSIALLIQRD--------NAQIFVPVDL 502


>gi|300698225|ref|YP_003748886.1| periplasmic protease; contains two PDZ domain [Ralstonia
           solanacearum CFBP2957]
 gi|299074949|emb|CBJ54518.1| periplasmic protease; contains two PDZ domain [Ralstonia
           solanacearum CFBP2957]
          Length = 490

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 136/511 (26%), Positives = 224/511 (43%), Gaps = 47/511 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYL---------------------VLEAKLPPSSVDL 40
             RQ ++  ++   A+  V     YL                             + +D 
Sbjct: 1   MTRQTMARSAVGLAAVLAVAGGYAYLQKDVISRAVAAPTAASAAAQASTAPVAVAAPMDF 60

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
             ++ R  P++V++      + +  Q         +  D P   +F+         + P 
Sbjct: 61  SGIVERYGPAVVNISTTAHAQRTSLQGLP----PGMSPDDPFAEFFKHFM-----PQMPQ 111

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++G D   D+AV
Sbjct: 112 QQGDQVVKGLGSGFIVSSDGLILTNAHVVDGAQEVNVKLTDRREFKAKVLGVDKQSDVAV 171

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFT 219
           L++ +      V+  +    +VGE V  IG+P+    TV+AGIVSA  R +PD     F 
Sbjct: 172 LRIAAGNL-PTVQIGNPAGTKVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYVPFI 230

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   +P+ +  K    L++ G+
Sbjct: 231 QTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAVPIDVAMKVEQQLVATGK 290

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  G  GI  Q + Q LA    L   +G+L+ AV K+ PA KAG++ GDVI  +    I 
Sbjct: 291 VTRGRLGISVQEVDQLLADSFNLPKPEGALVNAVEKDGPAAKAGLQPGDVILQIGNAHIG 350

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-DKELLGMVL 398
              D   Q+A   P   V + + ++G   +++V +G +  AK   +     DK  LG+ +
Sbjct: 351 HSGDLPEQVAEIKPGTTVPLQIIRQGRPTTLSVTVGEAKDAKVAANASAAPDKGRLGLAV 410

Query: 399 QDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           + +    K+   +       +        GIQ G  I+S+N   VS  +++  L+ +A  
Sbjct: 411 RPLQPEEKRQSGLPGGLVVMDSSGPAAKAGIQPGDVILSLNGTPVSSAQELRTLVDRA-- 468

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
                V L ++ D        +   FV L +
Sbjct: 469 --GKHVALLVQRD--------DAKIFVPLDL 489


>gi|149186378|ref|ZP_01864691.1| trypsin-like serine protease [Erythrobacter sp. SD-21]
 gi|148829967|gb|EDL48405.1| trypsin-like serine protease [Erythrobacter sp. SD-21]
          Length = 511

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 127/528 (24%), Positives = 243/528 (46%), Gaps = 61/528 (11%)

Query: 3   KRQILSVKSICTV---ALTCVIFSSTYLVLE---------AKLPPSSVDLPPVIARVSPS 50
            R   SV +       AL+   F +   V +              +      +  ++ P+
Sbjct: 1   MRYAYSVTATLLAGGAALSLAGFPAGAQVAQNDDSQMARVVPRAGAPESFADLTEQLQPA 60

Query: 51  IVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMF 110
           +V++    + +++     N   F   P        F   F++             E    
Sbjct: 61  VVNISTRQRIEIASR---NTNPFAGTP--------FEDLFNQRRGESGDAEPQFREGQSL 109

Query: 111 GSGFFITDDGYILTSNHIVEDG------ASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
           GSGF I+ DGY++T+NH+V            +V L D  E  A++VGTD+  DLAVLK+ 
Sbjct: 110 GSGFIISADGYVVTNNHVVNPPGQRAELEEVTVTLPDGNEYEAEVVGTDSQSDLAVLKIS 169

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDA 223
               F  V F D+   RVG+ V  IGNPF L GTV++GIVS++ R         + Q DA
Sbjct: 170 RREAFPFVTFGDSRQARVGDWVIAIGNPFGLGGTVTSGIVSSVLRSAGGGAYDRYLQTDA 229

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            IN+GNSGGP F+  G+VIG+N  I++     +G+G  IP    +  +  L+    ++ G
Sbjct: 230 SINRGNSGGPLFDMQGNVIGINNAIISPTGGSVGIGFAIPAETAEPIVDKLVRGVEIERG 289

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           + GI  Q +  ++A  LGL   +G ++  V     A +AG++ GD++  ++GR +   Q 
Sbjct: 290 YLGIQIQPVNDDVAASLGLARNRGEIVQMVQPGEAAARAGIEPGDIVLTVNGREVTPDQT 349

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK------------ 391
             + +A+ +P   + + + ++G +  + V +G  P+ +     ++ D             
Sbjct: 350 LSYLVANIAPGTTIPVEVIRDGQRRQINVTVGKRPSEEELRQSQMFDPDAEPEDDMAPSD 409

Query: 392 -----ELLGMVLQDINDGNKKLVR-------IVALNPNREREVEAKGIQKGMTIVSVNTH 439
                  LG+ + ++     + +        +V  + ++  +   KG+++G  +++ N +
Sbjct: 410 NEVIENSLGLQVLELTPAIARQLGADAGTRGLVVASVDQNSDAARKGLRRGDILLTANYN 469

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            +  ++D+E+++  A+   RD+VLL+++             +++++++
Sbjct: 470 PIVAVEDLEKIVRGAQSDDRDAVLLRVQR-------RGGSPQYIAVRM 510


>gi|144118|gb|AAA53693.1| immunoreactive stress response protein [Brucella abortus]
          Length = 500

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 152/471 (32%), Positives = 238/471 (50%), Gaps = 28/471 (5%)

Query: 14  TVALTCVIFSSTYLVLEAK--LPPSSVDLPPVIARVSPSIVSVMVEPKKK---VSVEQMF 68
              +T  + +      EA    PP       ++ +V P++VSV V+   +       Q F
Sbjct: 25  AFVVTGPLGALNEARAEAVHVTPPPQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFF 84

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP---------ILSDTVERLMFGSGFFITDD 119
              GF  LP+ HPLK +FR    +                        +  GSGF I++D
Sbjct: 85  GPPGFDQLPDGHPLKRFFRDFGMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISED 144

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ-SDRKFIPVEFEDAN 178
           GY++T+NH+V DG +++V+L D TEL AKL+G D   DLAVLK+    RKF+        
Sbjct: 145 GYVVTNNHVVSDGDAYTVVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYSPLATII 204

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNA 237
              VG+ V  +GNPF L GTV++GIVSA   DI   P   F QIDA +N+GNSGGP F+ 
Sbjct: 205 RCDVGDWVVAVGNPFGLGGTVTSGIVSARGADIGAGPYDDFIQIDAAVNKGNSGGPAFDL 264

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G VIG+N  I +     +G+   IP S  K+ +  LI KG V+ GW G+  Q +T+++A
Sbjct: 265 SGEVIGINTAIFSPSGGTVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIA 324

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
             LGL   KG+++ +   + PA KAG+K GDVI  ++G  ++  +D   ++A+ +P E+ 
Sbjct: 325 ASLGLAEEKGAIVASPQDDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKA 384

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE--------LLGMVLQDINDGNKKLV 409
            +++ ++     + V + + P  K     +  D +          G+ +    DG     
Sbjct: 385 ALTVWRKNKAEEINVTIAAMPNDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDGK---- 440

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
            +V  + + + +   +GI+ G  IVSVN   V    D+ + I  A++  R+
Sbjct: 441 GVVVTDVDPDSDAADRGIRSGDVIVSVNNQTVKTAGDINKAITAAEKSGRN 491



 Score = 72.1 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/93 (15%), Positives = 35/93 (37%), Gaps = 8/93 (8%)

Query: 390 DKELLGMVLQDINDGNKKLVRI------VALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
           ++  +G+ +Q +       + +      +  +P  +      GI+ G  I +VN   V  
Sbjct: 308 ERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGPAAKAGIKAGDVITAVNGETVQD 367

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
            +D+ R +      ++ +  L +      +  N
Sbjct: 368 PRDLARKVANIAPGEKAA--LTVWRKNKAEEIN 398


>gi|91977815|ref|YP_570474.1| peptidase S1C, Do [Rhodopseudomonas palustris BisB5]
 gi|91684271|gb|ABE40573.1| Peptidase S1C, Do [Rhodopseudomonas palustris BisB5]
          Length = 499

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 135/497 (27%), Positives = 227/497 (45%), Gaps = 31/497 (6%)

Query: 11  SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNA 70
            +  + L   +  S      A+ P     +  V  +V  ++V++      +         
Sbjct: 15  LLTAICLGAAVALSAPAPSHARGPEG---IADVAEKVIDAVVNISTTQTVEAKNSPGEGK 71

Query: 71  YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVE 130
               NLP   P + +F   F     GE+       +    GSGF +   G  +T+NH++ 
Sbjct: 72  GATPNLPPGSPFEEFFDDFFKNRRGGEKGGGP--RKTNSLGSGFIVDTAGVAVTNNHVIA 129

Query: 131 DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI--PVEFEDANNIRVGEAVFT 188
           D    ++I++D T++ A+LVG D   DLAVLK +         V+F D++ +R+GE V  
Sbjct: 130 DADEINLIMNDGTKIKAELVGVDKKTDLAVLKFKPPANKPLTAVKFGDSDKLRLGEWVVA 189

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP FN    VIGVN +
Sbjct: 190 IGNPFSLGGTVTAGIVSARNRDINSGPYDSYIQTDAAINRGNSGGPLFNLNAEVIGVNTL 249

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I++     +G+G  +P   +   +  L   G +  GW G+  Q +T E+A  L ++  +G
Sbjct: 250 IISPSGGSIGIGFAVPSKTVVGVVDQLRQFGELRRGWLGVRIQQVTDEIAESLNIKPARG 309

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+  +  + PA  AG++ GDV+   DG+ +K  +D    +A  +  + V + + ++G +
Sbjct: 310 ALVAGIDDKGPAKPAGIEPGDVVVKFDGKDVKEPKDLSRVVADTAVGKTVDVVIIRKGKE 369

Query: 368 HSVAVVLGSSPTAKNDMHLEVGDKEL---------LGMVLQDINDGNKKLVRIVAL---- 414
            +  V LG               +           LG+ L  ++   +   +I       
Sbjct: 370 ETKQVTLGRLDDGAKPQPASAKSQPEPEKPVTQKALGLDLAALSKDLRGRYKIKETVKGV 429

Query: 415 ---NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
                +   +   K +  G  IV V    V+   D+++ + + K+  + SVLL +     
Sbjct: 430 VVVGVDNGSDAAEKRLSAGDVIVEVAQEAVTSAADIKKRVDQLKKDGKKSVLLLVANG-- 487

Query: 472 MQSGNDNMSRFVSLKID 488
                +   RFV+L + 
Sbjct: 488 -----EGELRFVALSLQ 499


>gi|326794166|ref|YP_004311986.1| protease Do [Marinomonas mediterranea MMB-1]
 gi|326544930|gb|ADZ90150.1| protease Do [Marinomonas mediterranea MMB-1]
          Length = 469

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 134/491 (27%), Positives = 233/491 (47%), Gaps = 30/491 (6%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
             ++L   S+  ++ T +          A    +  D   ++ + SP++V++  E  +  
Sbjct: 1   MNRLLKTMSVAAISFTLMFSMF------ANAAANLPDFTDLVEKTSPAVVNISTEQTQSS 54

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM--FGSGFFITDDG 120
           +  +  N       P+   L  +FR  F +   G++       +R     GSGF I+ DG
Sbjct: 55  ATGRQLN-------PDAQELNEFFRHFFGQQPFGQQQSPKRQQQRQRSSLGSGFIISKDG 107

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y+LT+NH+++      V L+D  E  AKLVGTDA  DLA+LK+++D     V+  D++++
Sbjct: 108 YVLTNNHVIDGADVIHVRLNDRREYEAKLVGTDARTDLALLKIEADDL-PTVKMADSDDL 166

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALG 239
           + G+ V  IG+PF    TV+AGIVSAL R++P      F Q D  IN GNSGGP FN  G
Sbjct: 167 KAGQWVVAIGSPFGFDYTVTAGIVSALGRNLPSDNYVPFIQTDVAINPGNSGGPLFNLDG 226

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+G+N+ I T     MGV   IP  +    +  L + G+V   W G++ Q++  +LA  
Sbjct: 227 EVVGINSQIYTRSGGFMGVSFAIPSKVAMSVVDQLKADGKVSRAWLGVIIQDVNNDLAES 286

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL    G+L++ V+  SPA+KAG++ GD+I   +G+ I+   +  + +       +V  
Sbjct: 287 FGLDRPHGALVSRVMPGSPAEKAGLQPGDIIMSFEGKTIEHSSELPYIVGRMKADSEVTA 346

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV---RIVALNP 416
            + ++G + ++   L   P        +   +  LGM++ ++ +     +     V +  
Sbjct: 347 KVFRDGDEKTIDFTLDKRPDDSKLASQDQQQQNRLGMIVGEVPEKLASRLTIQGGVVVEQ 406

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
                    G+Q+G  I  +N   ++ + D   +       +  SV +++  D       
Sbjct: 407 VLGGTAARNGLQQGDVITMLNGKRINGVDDFSDIAKGIPSNR--SVPMRVIRDGY----- 459

Query: 477 DNMSRFVSLKI 487
                F+  KI
Sbjct: 460 ---PMFIPFKI 467


>gi|146306503|ref|YP_001186968.1| protease Do [Pseudomonas mendocina ymp]
 gi|145574704|gb|ABP84236.1| protease Do [Pseudomonas mendocina ymp]
          Length = 474

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 135/492 (27%), Positives = 228/492 (46%), Gaps = 32/492 (6%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           +KS+  + +  +++  + L        S  D   ++   SP++V++    K         
Sbjct: 4   LKSVTPLLMAALLWGQSLLAQA-----SLPDFTALVEEASPAVVNISTRQKMPERSVAAQ 58

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS-DTVERLMFGSGFFITDDGYILTSNH 127
                  LP+   L   FR+ F +              E    GSGF I+ DGY+LT+NH
Sbjct: 59  -----PGLPDLEGLPPMFREFFERSIPQMPRNPGGRQREAQSLGSGFIISADGYVLTNNH 113

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
           +V D     V LSD +EL AKL+G D   D+A+LKV+       V    ++ ++VGE V 
Sbjct: 114 VVADADEIIVRLSDRSELEAKLIGADPRSDVALLKVEGKGL-PTVRLGKSDELKVGEWVL 172

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIP-DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNA 246
            IG+PF    +V+AGIVSA  R++P D    F Q D  IN GNSGGP FN  G V+G+N+
Sbjct: 173 AIGSPFGFDHSVTAGIVSAKGRNLPSDSYVPFIQTDVAINPGNSGGPLFNLKGEVVGINS 232

Query: 247 MIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTK 306
            I T     MG+   IP+ +  +    L + G+V  GW G++ Q + ++LA   GL    
Sbjct: 233 QIFTRSGGFMGLSFAIPMEVALQVSEQLKADGKVTRGWLGVVIQEVNKDLAESFGLDRPA 292

Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366
           G+L+  V+++ PADK G++VGDVI  L+G+ I    D    +    P E+ ++ + ++GS
Sbjct: 293 GALVAQVLEDGPADKGGLQVGDVILSLNGKPIVMSADLPHLVGGLKPGEKAEMDVVRDGS 352

Query: 367 KHSVAVVLGSSPTAKNDMHLEVG------DKELLGMVLQDINDGNKKLV---RIVALNPN 417
           +  + V +G+ P    ++               LG+ + ++    KK +     V +   
Sbjct: 353 RKKLKVTIGTLPEEGQELAAAGSTKGGERSSNRLGVTVVELTAEQKKGLDLRGGVVVKEV 412

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
                   G++ G  I  +N   +       ++  +  + +  S+ +             
Sbjct: 413 LSGPAAMIGLRPGDVITHLNNQAIDSTATFAKVAQELPKNRSVSMRVL----------RQ 462

Query: 478 NMSRFVSLKIDK 489
             + F++ K+ +
Sbjct: 463 GRASFITFKLAE 474


>gi|323137185|ref|ZP_08072264.1| protease Do [Methylocystis sp. ATCC 49242]
 gi|322397543|gb|EFY00066.1| protease Do [Methylocystis sp. ATCC 49242]
          Length = 502

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 153/476 (32%), Positives = 246/476 (51%), Gaps = 28/476 (5%)

Query: 20  VIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
              +                   V+ RV P++V++ V+       E+  + +    L  D
Sbjct: 44  ASSAYAEAPQTLATVTGPSSFADVVDRVKPAVVAIKVKAT-----EEDHDHFDVPGLSPD 98

Query: 80  HPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
            P+  +F++       GE+         +  GSGF ++ DGY++T+NH+VE  +   V L
Sbjct: 99  DPMYRFFKRF------GEDGGRGQKHVTMSQGSGFIVSPDGYVVTNNHVVEHASEVEVAL 152

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
                LPAK++GTD   DLA+LK+    K   VE+  + N RVG+ V  +GNPF L G+V
Sbjct: 153 DSGKTLPAKVIGTDKRTDLALLKISDGDKLPYVEWS-SANPRVGDWVIAVGNPFGLGGSV 211

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGIVSA  RDI   P   F QIDAP+N+GNSGGP F+  G VIGVN  I +     +G+
Sbjct: 212 TAGIVSARGRDIGAGPYDDFLQIDAPVNRGNSGGPAFDTRGAVIGVNTAIYSPSGGSVGI 271

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  IP  + K  + +L  KG V  GW G+  QN+TQE+A  +GL+ TKG+LI    K +P
Sbjct: 272 GFAIPAEVAKDVVAALKEKGAVSRGWIGVKIQNVTQEIADSMGLKSTKGALIAQPQKGAP 331

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A++AG+K GDVI  ++G  I++ ++   +IA+  PK+ V I+  + G++ +V + LG  P
Sbjct: 332 AEEAGLKAGDVITAVNGEKIETPRELARKIAAMGPKKSVDITFLRNGAEKTVKLTLGVLP 391

Query: 379 TAKNDM------HLEVGDKELLGMVLQDIND-GNKKLVRIVALNPNREREVEAKGIQKGM 431
             K           + G+   LG+ +   ++        ++  + +       KG+++G 
Sbjct: 392 EEKEARADNDFGGGDGGEITGLGIEVAPASEVRGAGREGVIVTDIDPSGAAAQKGVRRGD 451

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            IV      V+   D+      A+++ R SVLL++K        + +  +FV++ +
Sbjct: 452 VIVEAGGQTVNSRADLASAFDAARKEGRRSVLLRVK--------SADGMKFVAVPV 499


>gi|163737662|ref|ZP_02145079.1| Peptidase S1C, Do [Phaeobacter gallaeciensis BS107]
 gi|161389188|gb|EDQ13540.1| protease do precursor [Phaeobacter gallaeciensis BS107]
          Length = 499

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 141/506 (27%), Positives = 245/506 (48%), Gaps = 43/506 (8%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           RQ+   + +    ++ ++  +   + +A+       L P+  +VS              +
Sbjct: 17  RQMTQWRLLWLAMISTLMVLAQVAIAQAR----PESLAPLADKVS------RAVVNITTT 66

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYIL 123
                 +   G +PE  P +++FR+   +                  GSGF I++DGYI+
Sbjct: 67  TVVEGRSGPQGIVPEGSPFEDFFREFQDRNGG----QGDRPRRSSALGSGFVISEDGYIV 122

Query: 124 TSNHIVEDGASFSVILSDD-----TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           T+NH++E+     +            LPAK+VGTD   D+A+LKV++      V+F D++
Sbjct: 123 TNNHVIEEADEIEIEFFPGEGQPAQPLPAKVVGTDPNTDIALLKVEAPMPLTFVKFGDSD 182

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNAL 238
             RVG+ V  +GNP     ++SAGIVSA +R++      + Q DA IN+GNSGGP FN  
Sbjct: 183 LARVGDWVVAMGNPLGQGFSLSAGIVSARNRELSGSYDDYIQTDAAINRGNSGGPLFNMD 242

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+GVN  I++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A 
Sbjct: 243 GQVVGVNTAILSPNGGSIGIGFSMASNVVSKVVNQLKEFGETRRGWLGVRIQDVTKDVAE 302

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            +GL   KG+L+T  V E PA  AG+  GDVI   DG  +K  +  V Q+ +    + V+
Sbjct: 303 AMGLDSAKGALVTD-VPEGPAKAAGLLAGDVILSFDGVDVKDTRALVRQVGNTEVGKAVR 361

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD--------KELLGMVLQDINDGNKKLV- 409
           + + +EG   ++ V LG    A+       GD        K+LLG+ +  +++  +  + 
Sbjct: 362 VRVFREGKTETLRVTLGRREDAQRQSTPVSGDDNAPDMTEKQLLGLTVSRLSEDQRSELN 421

Query: 410 ------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
                  +V  + +   E   KG++ G  I      +++ I ++E  I +AKE  R S+L
Sbjct: 422 VPDGMDGLVITSVDETSEAWEKGMRAGDLITEAGQQKLTSISELEARIDEAKEAGRKSLL 481

Query: 464 LQIKYDPDMQSGNDNMSRFVSLKIDK 489
           L ++   +         RFV+L + +
Sbjct: 482 LLVRRAGE--------PRFVALNLSE 499


>gi|300694600|ref|YP_003750573.1| periplasmic protease; contains two pdz domain [Ralstonia
           solanacearum PSI07]
 gi|299076637|emb|CBJ35975.1| periplasmic protease; contains two PDZ domain [Ralstonia
           solanacearum PSI07]
          Length = 490

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 137/511 (26%), Positives = 223/511 (43%), Gaps = 47/511 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYL---------------------VLEAKLPPSSVDL 40
             RQ ++  ++   A+  V     YL                        A    + +D 
Sbjct: 1   MTRQTMARSAVGLAAVLAVAGGYAYLQKDVISRAVAAPLAAPATAPASTAAVAVAAPMDF 60

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
             ++ R  P++V++      + +  Q         +  D P   +F+         + P 
Sbjct: 61  SGIVERYGPAVVNISTTAHAQRTSIQGLP----PGMNPDDPFAEFFKHFM-----PQMPQ 111

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF ++ DG ILT+ H+V+     SV L+D  E  AK++G D   D+AV
Sbjct: 112 QQGDQVVKGLGSGFIVSPDGLILTNAHVVDGAQEVSVKLTDRREFKAKVLGVDKQSDVAV 171

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFT 219
           L++ +      V+  +    +VGE V  IG+P+    TV+AGIVSA  R +PD     F 
Sbjct: 172 LRIAARNL-PTVQIGNPAGTKVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYVPFI 230

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   +P+ +  +    L++ G+
Sbjct: 231 QTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAVPIDVAMRVEQQLVATGK 290

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  G  GI  Q + Q LA    L   +G+L+ AV K+ PA KAG++ GDVI  +    I 
Sbjct: 291 VTRGRLGISVQEVDQSLADSFNLPKPEGALVNAVEKDGPAAKAGLQPGDVILQIGDAHIG 350

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-DKELLGMVL 398
              D   Q+A   P   V + + + G   +++V +G +  AK         DK  LG+ +
Sbjct: 351 HSGDLPEQVAEIKPGTNVPLQIIRHGKPTTLSVTVGEAKDAKVAASTSAAPDKGRLGLAV 410

Query: 399 QDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           + +    K+   +       +        GIQ G  I+S+N   VS  +++  L+ +A  
Sbjct: 411 RPLQPEEKRQSGLPGGLVVMDSSGPAAKAGIQPGDVILSLNGTPVSSAQELRSLVDRA-- 468

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
                V L ++ D        +   FV L +
Sbjct: 469 --GKHVALLVQRD--------DAKIFVPLDL 489


>gi|171319471|ref|ZP_02908575.1| protease Do [Burkholderia ambifaria MEX-5]
 gi|171095322|gb|EDT40305.1| protease Do [Burkholderia ambifaria MEX-5]
          Length = 499

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 126/511 (24%), Positives = 222/511 (43%), Gaps = 44/511 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             +  L       V    +   S           S  D   ++ +V P++V++       
Sbjct: 1   MTKLTLRKVFAAAVLCASLPLISHTAAAATPPAASLPDFADLVEKVGPAVVNIRTTANVP 60

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP---------------ILSDTVE 106
           +   +     GF N      +  +FR+ F                           DT +
Sbjct: 61  IPGPRGGLPPGFDNGD----MSEFFRRFFGIPLPQAPGNGSGNGNRKNAPAPDNPPDTEQ 116

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+Q+ 
Sbjct: 117 NRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQAS 176

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPIN 226
                V   D+N +RVGE V  IG+PF L  TV+AGIVS+  R+  D    F Q D  +N
Sbjct: 177 SL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAVN 234

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G   
Sbjct: 235 PGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRIA 294

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +    +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D   
Sbjct: 295 VAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGIQPGDIILKFNGRPVETASDLPR 354

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE-------LLGMVLQ 399
            +    P  +  +S+ ++G    + + +  +P        +  +          LG+ + 
Sbjct: 355 MVGDTKPGTKATVSVWRKGQARDLPITIAETPAETTAKAEQRKNTPQKPRQANSLGLTVS 414

Query: 400 DINDGNKK----LVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
           DI     K       +       +      G+Q+G  ++ V   +++  K    +  +  
Sbjct: 415 DIPADQMKSQKLKNGVQIDAV--DGPAARAGLQRGDIVLRVGDTDITSAKQFAEVTAQLD 472

Query: 456 EKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            +K  +VL++            + ++FV ++
Sbjct: 473 SQKAVAVLVR----------RGDNTQFVPVR 493


>gi|56417111|ref|YP_154185.1| hypothetical protein AM1066 [Anaplasma marginale str. St. Maries]
 gi|222475476|ref|YP_002563893.1| hypothetical protein AMF_805 [Anaplasma marginale str. Florida]
 gi|254995285|ref|ZP_05277475.1| hypothetical protein AmarM_04955 [Anaplasma marginale str.
           Mississippi]
 gi|255003464|ref|ZP_05278428.1| hypothetical protein AmarPR_04410 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004590|ref|ZP_05279391.1| hypothetical protein AmarV_04760 [Anaplasma marginale str.
           Virginia]
 gi|56388343|gb|AAV86930.1| hypothetical protein AM1066 [Anaplasma marginale str. St. Maries]
 gi|222419614|gb|ACM49637.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 487

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 143/497 (28%), Positives = 249/497 (50%), Gaps = 21/497 (4%)

Query: 2   FKRQ---ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
            KR     L + S+C++       SS      A +P S      + A++ P++V++  E 
Sbjct: 1   MKRFLSLFLLIASLCSIHSGGSALSSVAGSKTA-VPDSRRGFSGLAAKLLPAVVNISTEQ 59

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD 118
                   M   + F  +P+    + +F                   + +  GSGF +  
Sbjct: 60  TVDSDASSMGQGFRFPGIPKGI-FEEFF-----NNLEPLLVDPLKPRKVVSLGSGFIVDK 113

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
            G I+T+ H++ +     V  SD++   A ++G D   DLAVLKV++ +   PV   +++
Sbjct: 114 SGLIVTNYHVIANAKEIHVKFSDNSTAKATVLGKDPKTDLAVLKVKTKKDLQPVTLGNSD 173

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNA 237
            + VGE V  IGNPF L G+VS GI+S   RDI     + F Q DA IN+G+SGGP FNA
Sbjct: 174 EVLVGEWVLAIGNPFGLGGSVSVGIISGRARDINIGTASEFLQTDAAINRGHSGGPLFNA 233

Query: 238 LGHVIGVNAMIVTSGQF-HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
            G VIG+N  I++     ++GV   IP +   + I  L   GRV+HGW G++ Q++T ++
Sbjct: 234 DGEVIGINTAIMSPQGGGNVGVAFAIPSNNAARVIRVLSKGGRVEHGWLGVVIQHVTDDM 293

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
              LGL   +G+LI+ V K+SPA+KAG+KVGDVI   +G+ I++       I   +  E+
Sbjct: 294 TDSLGLESARGALISGVAKDSPAEKAGLKVGDVILEFNGQKIENMPQLTHLITKAAVNEK 353

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHLEV-GDKELLGMVLQDINDGNKKL-VRIVAL 414
            KI++ ++G   +V V +G  P        +     + +G+ + ++   +KK    ++ L
Sbjct: 354 AKITVQRDGRALNVMVTIGKLPDDAVPGGADQEATDDSVGLTVGNLPKNSKKQQEGVLIL 413

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK--EKKRDSVLLQIKYDPDM 472
             +   +  ++G++KG  ++ +N+  ++ + D  + + K K     + S+LL +K     
Sbjct: 414 RVDHRSDAFSEGVRKGDILLGINSATINSVSDFNKEMSKIKSGSGGKGSLLLLVKKGGGD 473

Query: 473 QSGNDNMSRFVSLKIDK 489
                    ++ +K++K
Sbjct: 474 AP-----PIYIPVKLNK 485


>gi|113868522|ref|YP_727011.1| trypsin-like serine protease [Ralstonia eutropha H16]
 gi|113527298|emb|CAJ93643.1| Trypsin-like serine protease, typically periplasmic, contains
           C-terminal PDZ domain [Ralstonia eutropha H16]
          Length = 494

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 131/504 (25%), Positives = 223/504 (44%), Gaps = 37/504 (7%)

Query: 1   MFKRQILSVKSICTVA--LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
           M  R     +++   A  L     +       A    +  D   ++ + SP++V++    
Sbjct: 1   MMFRSPALARAVVMAAMMLLGPTVAEVSHAQAAASNYNLPDFTDLVEKASPAVVNIRTTE 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG--------EEPILSDTVERLMF 110
             +                 D  +  +FR+ F     G                 +    
Sbjct: 61  LVRQRGAPGG----------DDEMAEFFRRFFGVPMPGAPAPGAPRRGQPPQQEEQSRGV 110

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF I+ DGY++T+ H+V D  +  V L D  E  AKL+G+D   D+A+LKV++     
Sbjct: 111 GSGFIISQDGYVMTNAHVVADAETIYVTLPDKREFKAKLIGSDKRTDVALLKVEASGL-P 169

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNS 230
            +   D+N +R GE V  IG+PF L  +V+AGIVSA  RD  D    F Q D  +N GNS
Sbjct: 170 RLPLGDSNKVRAGEWVLAIGSPFGLDNSVTAGIVSAKGRDTGDYLP-FIQTDVAVNPGNS 228

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP  N  G VIG+N+ I +    +MG+   IP+    +    L S GRV  G   +   
Sbjct: 229 GGPLINLRGEVIGINSQIYSRSGGYMGISFAIPIDEAMRVSEQLKSSGRVTRGRIAVAIG 288

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
           ++T+E+A  LGL   +G+L+ +V    PA+KAG++ GD+I   +GR I+   D    +  
Sbjct: 289 DVTKEVADSLGLGRARGALVGSVEPGGPAEKAGIEAGDIILKFNGRDIERASDLPRMVGE 348

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSP-----------TAKNDMHLEVGDKELLGMVLQ 399
             P  +V + L ++G+   V + +               T K+D   + G    LG+V+ 
Sbjct: 349 TKPGTRVPLQLWRKGAVREVTITVTELEPDGKAKARSGATPKDDSAAQAGKPNALGLVVN 408

Query: 400 DINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           D+ +   K +++   V +    +      GI+ G  I+ +   +V+  +    L+    +
Sbjct: 409 DLPEARLKELKLKSGVEVEV-ADGPALRAGIRPGDIILRLGDTDVTNARQFNELVRSLDK 467

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMS 480
            +  +V ++      + +     +
Sbjct: 468 NRIAAVFVRRGDATQVLTLRPGAT 491


>gi|73539383|ref|YP_299750.1| peptidase S1C, Do [Ralstonia eutropha JMP134]
 gi|72122720|gb|AAZ64906.1| Peptidase S1C, Do [Ralstonia eutropha JMP134]
          Length = 488

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 129/456 (28%), Positives = 219/456 (48%), Gaps = 26/456 (5%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           + +D   ++ +  P++V++ V  + + +  Q  +      +  D PL  +F++   +F  
Sbjct: 54  TPMDFSGIVDQYGPAVVNISVTARAQRTAMQAPS-----GMDPDDPLFQFFKRFGPQFQG 108

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
            +             GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++GTD  
Sbjct: 109 PQSGQQL----VKGLGSGFIVSPDGLILTNAHVVDGAQEVTVKLTDRREFKAKVLGTDPQ 164

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            D+AV+++ +      V   D   ++VGE V  IG+P+    TV+AGIVSA  R +PD  
Sbjct: 165 TDVAVIRIDAKDL-PTVRLGDPARVKVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDT 223

Query: 216 G-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   IP+++  K    L
Sbjct: 224 YVPFIQTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAIPINVATKVEQQL 283

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           ++ G+V  G  GI  Q + Q LA   GL    G+L+ +V  +SPA KAG+K GDVI  LD
Sbjct: 284 VAHGKVTRGRLGISVQEVNQALAQSFGLPKPSGALVNSVEADSPAAKAGVKPGDVIVQLD 343

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS-PTAKNDMHLEVGDKEL 393
             +I    D    +A   P  Q  + + ++G   ++AV +G++   +      +      
Sbjct: 344 DDVIDHSGDLPEHVADIKPGTQTTLKIIRKGQPMTLAVKVGAAKEESVAQKGNDSQAGGR 403

Query: 394 LGMVLQDINDGNKKLVRIVALNPNRE--REVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           LG+ ++ +    ++   I       +        GIQ G  I+S+N   ++    +  L+
Sbjct: 404 LGLAVRSLTPSERRESGIDGGLVVEDVAGPAARVGIQPGDVILSLNGTPITSADQLRALV 463

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            K+ ++    V L ++ D            F+ L +
Sbjct: 464 AKSGKQ----VALLVQRD--------EARIFIPLDL 487


>gi|239907577|ref|YP_002954318.1| putative protease Do [Desulfovibrio magneticus RS-1]
 gi|239797443|dbj|BAH76432.1| putative protease Do [Desulfovibrio magneticus RS-1]
          Length = 489

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 145/502 (28%), Positives = 244/502 (48%), Gaps = 38/502 (7%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           ++ + + T   T  + + T +  +A++P    D+  ++ +  P++V++      K     
Sbjct: 1   MARRLLATTIATLSLIAWTAMA-QARVP--LPDITELVDKDGPAVVNISTTKTVKAQEGM 57

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFS--GEEPILSDTVERLMFGSGFFITDDGYILT 124
                  G   +  P+ ++F +    F              ++   GSGF I+ DGYI+T
Sbjct: 58  RELFQRRGG--QGGPMDDFFEQFEKHFGPQGRGGGQGGKGQKQRSMGSGFVISADGYIVT 115

Query: 125 SNHIVEDGASFSVIL-SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           +NH+V+      V   +++  LPAK++G DA  DLA+LK++       +EF D+  ++VG
Sbjct: 116 NNHVVDGADEVKVQFKNNEKPLPAKIIGRDAETDLALLKIEGKSGLPYLEFGDSGKLKVG 175

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVI 242
           E V  IGNPF L  TV+ GIVSA  R I   P   F Q DA IN GNSGGP  +  G VI
Sbjct: 176 EWVLAIGNPFGLENTVTLGIVSAKGRIIGAGPFDNFIQTDASINPGNSGGPLIDLDGKVI 235

Query: 243 GVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGL 302
           G+N  IV S     G+G  IP ++ K  I  L    +V  GW G+  Q++ +  A  LGL
Sbjct: 236 GINTAIVAS---GQGIGFAIPSNMAKDVISQLRDGKKVQRGWLGVSIQDIDENTAKALGL 292

Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362
             TKG+LI++V++  PA KAG+K GDVI  + G+ + +  D + ++A+  P E  +  + 
Sbjct: 293 DSTKGALISSVMEGQPAAKAGIKTGDVITSVGGQKVDNANDLLRRVAAIRPGESAEFVVM 352

Query: 363 KEGSKHSVAVVLGSSP-----------TAKNDMHLEVGDKELLGMVLQDINDGNKKLV-- 409
           ++GS  +V+V LG                ++D   E      LG+ ++ +     K +  
Sbjct: 353 RKGSPVTVSVTLGERDAKKLAQSGRGQEGEDDAAGEDASASALGLSVRALAPKEAKAIGM 412

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                ++        E E   ++ G  I+ VN    +  ++ ++++G+   KK+  V+L 
Sbjct: 413 DKAQGVLITEVADGSEAEQADVRPGDVILEVNQRPATSPEEFKKIVGE-DGKKKGVVMLL 471

Query: 466 IKYDPDMQSGNDNMSRFVSLKI 487
           IK          N + F ++ +
Sbjct: 472 IKR--------QNQTVFRTVPL 485


>gi|325527572|gb|EGD04886.1| serine protease MucD 1 [Burkholderia sp. TJI49]
          Length = 494

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 125/510 (24%), Positives = 231/510 (45%), Gaps = 44/510 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSV---DLPPVIARVSPSIVSVMVE 57
           M K  + +       AL+  +  +++    A    ++    D   ++ +V P++V++   
Sbjct: 1   MMKPTLRN--WFAAAALSACLPLASHPAAAAPTAAAAASLPDFADLVEKVGPAVVNIRTT 58

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP----------ILSDTVER 107
                +  +     GF N      +  +FR+ F                      D  + 
Sbjct: 59  ANVPTAGPRGGLPPGFDNGD----MSEFFRRFFGIPLPQAPGNNPKNAPAPDNPPDIEQN 114

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+Q+  
Sbjct: 115 RGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQASN 174

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQ 227
               V   D+N +RVGE V  IG+PF L  TV+AGIVS+  R+  D    F Q D  +N 
Sbjct: 175 L-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDVAVNP 232

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G   +
Sbjct: 233 GNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADKLKATGKVTRGRIAV 292

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
               +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR + +  D    
Sbjct: 293 AIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGIQPGDIILKFNGRSVDAASDLPRM 352

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM-------HLEVGDKELLGMVLQD 400
           +    P  +  +++ ++G    V +V+  +P+              +      LG+ + D
Sbjct: 353 VGDTKPGTKATVTVWRKGQSRDVPIVIAETPSDTTAKADQRKSTPQKPRQSNALGLTVSD 412

Query: 401 INDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           ++    K +     +       +      G+Q+G  ++ V   +++  K    +  +   
Sbjct: 413 LSADQLKTLKLKNGVQVDGV--DGPASRAGLQRGDIVLRVGDTDITSAKQFADVTSQLDP 470

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +K  +VL++            + +++V ++
Sbjct: 471 QKPVAVLVR----------RGDNTQYVPVR 490


>gi|53720039|ref|YP_109025.1| peptidase [Burkholderia pseudomallei K96243]
 gi|52210453|emb|CAH36436.1| subfamily S1C unassigned peptidase [Burkholderia pseudomallei
           K96243]
          Length = 485

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 121/497 (24%), Positives = 220/497 (44%), Gaps = 41/497 (8%)

Query: 12  ICTVALTCVIFSSTYLVLEAKLPPS---SVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           +   + T     +T       +P +     D   ++ RV P++V++              
Sbjct: 4   LAAQSATAAPNVTTTPAATGAVPAARAGLPDFADLVERVGPAVVNIRTTANVPADTRGAL 63

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL---------SDTVERLMFGSGFFITDD 119
                    ++  +  +FR+ F                     DT +    GSGF ++ D
Sbjct: 64  PPGL-----DNGDMSEFFRRFFGIPLPQGPGGQKNAPSTPDAPDTEQNRGVGSGFILSPD 118

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GY++T+ H+V+D  +  V L+D  E  AKL+G D   D+A++K+ +      V   D+N 
Sbjct: 119 GYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDERTDVAIVKINASSL-PTVAIGDSNR 177

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALG 239
           +RVGE V  IG+PF L  TV+AGIVSA  R+  D    F Q D  +N GNSGGP  N  G
Sbjct: 178 VRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FIQTDVAVNPGNSGGPLINMQG 236

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIG+N+ I +     MG+   IP+    +    L + G+V  G   +    +T+E+A  
Sbjct: 237 EVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGKVTRGRIAVAIGEVTKEVADS 296

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D    +    P  +  +
Sbjct: 297 IGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKATV 356

Query: 360 SLCKEGSKHSVAVVLGSSPTAKN------DMHLEVGDKELLGMVLQDINDGNKKLV---- 409
           ++ ++G    + + +   P  K           +      LG+ + D++    K +    
Sbjct: 357 TVWRKGQSRDLPITIAEFPADKAAKADSRQAPQQKPRSSALGLTVSDLSPEQLKTLKLRN 416

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +       +      G+Q+G  ++ V   +++  K    +  K   ++  +VL++    
Sbjct: 417 GVQIDAV--DGPASRAGLQRGDIVLRVGDVDITSAKQFVDVTSKLDPQRAVAVLVR---- 470

Query: 470 PDMQSGNDNMSRFVSLK 486
                     ++F+ ++
Sbjct: 471 ------RGENTQFIPIR 481



 Score = 70.2 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 296 SIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKAT 355

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 356 VTV----------WRKGQSRDLPITIAE 373


>gi|78065714|ref|YP_368483.1| peptidase S1C, Do [Burkholderia sp. 383]
 gi|77966459|gb|ABB07839.1| Peptidase S1C, Do [Burkholderia sp. 383]
          Length = 500

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 124/514 (24%), Positives = 225/514 (43%), Gaps = 46/514 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M K  +    +   ++    +   T   + A    S  D   ++ +V P++V++      
Sbjct: 1   MMKLTLRKWLAAAALSACLPLVPHTAFAVTAPA-ASLPDFADLVEKVGPAVVNIRTTANV 59

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS-----------------GEEPILSD 103
             S              ++  +  +FR+ F                             D
Sbjct: 60  PTSSGPRGMLPPG---FDNGDMSEFFRRFFGIPLPQAPGNGSGNGGNNPKNAPAPDNPPD 116

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
           T +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+K+
Sbjct: 117 TEQNRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKI 176

Query: 164 QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDA 223
           Q+      V   D+N +RVGE V  IG+PF L  TV+AGIVS+  R+  D    F Q D 
Sbjct: 177 QASNL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLP-FIQTDV 234

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G
Sbjct: 235 AVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRG 294

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
              +    +T+++A  +GL   +G+L+++V    PADKAG++ GD+I   +GR + +  D
Sbjct: 295 RIAVAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGIQPGDIILKFNGRSVDTASD 354

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN-------DMHLEVGDKELLGM 396
               +    P  +  +S+ ++G    + + +  +P           +   +      LG+
Sbjct: 355 LPRMVGDTKPGAKATVSVWRKGQARDLPITIAETPAETTAKAEQRKNAPQKPRQTNSLGL 414

Query: 397 VLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
            + D+     K +     +       +      G+Q+G  ++ V   +++  K    +  
Sbjct: 415 TVSDLTAEQMKTLKLKNGVQIDGV--DGPAARAGLQRGDIVLRVGDTDITNAKQFADVTA 472

Query: 453 KAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +   +K  +VL++            + ++FV ++
Sbjct: 473 QLDPQKAVAVLVR----------RGDNTQFVPVR 496


>gi|307730870|ref|YP_003908094.1| protease Do [Burkholderia sp. CCGE1003]
 gi|307585405|gb|ADN58803.1| protease Do [Burkholderia sp. CCGE1003]
          Length = 502

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 129/460 (28%), Positives = 215/460 (46%), Gaps = 23/460 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED--HPLKNYFRKDFHKFFS 95
            D   ++    P++V++  +   K +  +     G   LP D   P   +++  F     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKRAALRGNGGMGGNQLPIDPSDPFYQFYKHFFGGMPG 114

Query: 96  GEEPILS--DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
            +               GSGF ++ DGYILT+ H+V+     +V L+D  E  AK+VG D
Sbjct: 115 MQGGDGGDVPDQPSASLGSGFIVSSDGYILTNAHVVDGANVVTVKLTDKREFKAKVVGAD 174

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +P+
Sbjct: 175 KQSDVAVLKIDASNL-PVVKIGDPRQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRSLPN 233

Query: 214 RPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
              T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K   
Sbjct: 234 ENYTPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKD 293

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            ++  G V  G  G+  Q + Q LA   G++  +G+L+++V  + PA KAG++ GDVI  
Sbjct: 294 DIVKTGHVRRGRLGVAVQGMNQTLANSFGMQKPQGALVSSVDPDGPAAKAGLQPGDVILS 353

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD-- 390
           ++G  +        QIA  +P     + + ++     + V +GS   +K           
Sbjct: 354 VNGEPVTDSSALPSQIAGLAPGSAATVQVWRDKGTKDLKVTIGSLSDSKLASDKTDQPTQ 413

Query: 391 -KELLGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
            +  LG+ ++ +    K    I    L        E+ GIQ G  I++VN   V+ +  +
Sbjct: 414 LQGRLGVAVRPLTPEEKSSASISHGLLVQQSGGAAESAGIQPGDVILAVNGRPVTSVDQL 473

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           ++++  A     +S+ L I+ D        N   FV + +
Sbjct: 474 KQMVAGA----GNSIALLIQRD--------NSQIFVPVDL 501


>gi|91201698|emb|CAJ74758.1| similar to serine proteinase HtrA/DegQ/DegS family [Candidatus
           Kuenenia stuttgartiensis]
          Length = 496

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 133/492 (27%), Positives = 219/492 (44%), Gaps = 26/492 (5%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
            +  L +  +     + +   +        L  +      V   VSPS+V + VE K   
Sbjct: 6   MKIKLMMLHVTLFCFSVMPAYALEDNGIKDLRQTGKAFASVAREVSPSVVFIQVESKVSD 65

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERL-----MFGSGFFI- 116
           S    F      + P       +F++ F + F G          +        GSGF   
Sbjct: 66  SARTRFRLPFGDSWPFGD---EFFKRFFGEPFPGIPRTPPSDKPQSEHRIIGQGSGFVFE 122

Query: 117 ------TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
                 +D  YILT+NH+VE+  +  V   + +E  AK+ G D   D+AV+++++     
Sbjct: 123 VKDGLLSDKTYILTNNHVVENADTIRVQFQNGSEYNAKITGRDPQSDVAVIEIKAS-SMP 181

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD--IPDRPGTFTQIDAPINQG 228
             +  D++ + VGE V  IGNPF L  T++ G+VSA  R     +    F Q DA IN G
Sbjct: 182 AAKLGDSSKLEVGEWVVAIGNPFGLSHTLTVGVVSAKGRTSIGINDYEDFIQTDAAINPG 241

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP  N    V+G+N  I +    +MGVG  IP+++ ++    LI KG V  G+ GI+
Sbjct: 242 NSGGPLVNLDAEVVGINTAIFSRSGGYMGVGFAIPINLAREIADQLIDKGEVTRGYLGIV 301

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
            Q LT +LA   G+   KG L++ V  +SPAD AG++ GD+I    G  + +   F  ++
Sbjct: 302 IQPLTADLAKSFGVEQVKGILVSQVSDDSPADMAGLRQGDIIIAYRGEPVTNVGSFRNRV 361

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKL 408
           +   P    ++++ +EG + ++ V +G     K          E LG+ +Q +     + 
Sbjct: 362 SLTQPGSTEELTILREGKQMTLTVTIGKLTREKLAAQTSSQSAEKLGLTVQTLTPQLAEQ 421

Query: 409 VRI------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
             +      V             GI+ G  I+ V+   V    + +R + K+ + K  S+
Sbjct: 422 FGVKMGEGVVVTEVRPGSIAAMAGIEPGTVIMQVDREPVKNAAEFKRAVEKSSDDK--SI 479

Query: 463 LLQIKYDPDMQS 474
           LL ++     Q 
Sbjct: 480 LLLLRRGNAQQY 491


>gi|116694114|ref|YP_728325.1| trypsin-like serine protease [Ralstonia eutropha H16]
 gi|113528613|emb|CAJ94960.1| Trypsin-like serine protease, contains C-terminal PDZ domain
           [Ralstonia eutropha H16]
          Length = 488

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 140/508 (27%), Positives = 233/508 (45%), Gaps = 43/508 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPP------------------SSVDLPPV 43
             RQ ++  ++   AL  +     YL  E   P                   +  D   +
Sbjct: 1   MMRQTIARTAVGIAALAALGGGYAYLQREVITPGYAAPAPAVAPAQPAAAVATPTDFSGI 60

Query: 44  IARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSD 103
           +A+  P++V++ V  + + +  QM        +  D PL  +F++   +F   +      
Sbjct: 61  VAQYGPAVVNISVTARAQRTAAQMP-----PGIDPDDPLFQFFKRFGPQFQGPQGGQQQL 115

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
                  GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++G+D   D+AV+++
Sbjct: 116 VR---GLGSGFIVSPDGLILTNAHVVDGAQEVTVKLTDRREFKAKVLGSDPQTDVAVIRI 172

Query: 164 QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQID 222
            +      V   D + +RVGE V  IG+P+    TV+AGIVSA  R +PD     F Q D
Sbjct: 173 DAKNL-PAVRLGDPSQVRVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYVPFIQTD 231

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
             +N GNSGGP FN  G V+G+NA I +    + G+   IP+ +  K    L++ G+V  
Sbjct: 232 VAVNPGNSGGPLFNQRGEVVGINAQIYSQTGGYQGLSFAIPIDVATKVQQQLVAHGKVTR 291

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           G  GI  Q + Q LA   GL    G+L+ +V  +SPA +AG+K GDVI  LD  +I    
Sbjct: 292 GRLGISVQEVNQALAQSFGLPKPTGALVNSVEPDSPAARAGLKPGDVIVQLDNDVIDHSG 351

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG-SSPTAKNDMHLEVGDKELLGMVLQDI 401
           D    +A   P  Q  + + ++G   +++V +G +   A             LG+ ++ +
Sbjct: 352 DLPEHVADIKPGTQTSLKIIRKGQPMTLSVTVGTARDRAVAQKGGGSEAGGRLGLAVRPL 411

Query: 402 NDGNKKLVRIVALNPNRE--REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
               K+   I       +        GIQ G  I+S+N   +S  + ++ L+ K+ ++  
Sbjct: 412 TPAEKRGSGIDGGLVVEDVAGPAARVGIQPGDVILSLNGTPISSPEQLKSLVSKSGKQ-- 469

Query: 460 DSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             V L ++ D        +   F+ L +
Sbjct: 470 --VALLVQRD--------DARIFIPLDL 487


>gi|238026613|ref|YP_002910844.1| hypothetical protein bglu_1g09600 [Burkholderia glumae BGR1]
 gi|237875807|gb|ACR28140.1| Hypothetical protein bglu_1g09600 [Burkholderia glumae BGR1]
          Length = 512

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 129/521 (24%), Positives = 229/521 (43%), Gaps = 51/521 (9%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAK---------------LPPSSVDLPPVIA 45
              R  ++  ++        + + T   ++                    +  D   ++ 
Sbjct: 4   FTLRPWMAAAALTACLPVASLAAQTAAPVQGASAPVTVPVAPPTAPAARAALPDFADLVE 63

Query: 46  RVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE------- 98
           +V P++V++                  F   P+D  +  +FR+ F     G         
Sbjct: 64  KVGPAVVNIRTTAIVPA----DPRGGVFPQGPDDGDMSEFFRRFFGIPLPGAPGSPGTPK 119

Query: 99  ---PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
              P   DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D  
Sbjct: 120 NALPDAPDTEQNRGVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDER 179

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRP 215
            D+A++K+ +      V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+  D  
Sbjct: 180 TDVAIVKINASGL-PTVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYL 238

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L 
Sbjct: 239 P-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLK 297

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
           + G+V  G   +    +T+++A  +GL   +G+L+++VV   PADKAG++ GD+I   +G
Sbjct: 298 TTGKVTRGRIAVAIAEVTKDVADSIGLPRAEGALVSSVVAGGPADKAGVQPGDIILKFNG 357

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKND--------MHLE 387
           R +    D    +    P  Q  +++ ++GS   + + +   P  KN             
Sbjct: 358 RQVDEATDLPRMVGDTKPGTQATLTIWRKGSSRDLPITIAEVPAEKNARADDGKPRRPAT 417

Query: 388 VGDKELLGMVLQDINDGNKKLVRIV-ALNPN-REREVEAKGIQKGMTIVSVNTHEVSCIK 445
                 LG+ + D+     K  ++   ++ +  E      G+++   ++ V   +++  K
Sbjct: 418 PRQSNALGLTVSDLTADQLKAAKVPNGVHVDLAEGPASRAGLKRDDIVIRVGDVDITSAK 477

Query: 446 DVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
               +  K   +K  +VL++            + ++FV L+
Sbjct: 478 QFVEVTSKLDPQKMVAVLVR----------RGDNTQFVPLR 508


>gi|312113146|ref|YP_004010742.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
 gi|311218275|gb|ADP69643.1| protease Do [Rhodomicrobium vannielii ATCC 17100]
          Length = 530

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 152/513 (29%), Positives = 239/513 (46%), Gaps = 39/513 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKL-------------PPSSVDLPPVIARVS 48
           F ++     S   +AL   + ++++    A+                      P++ +V 
Sbjct: 26  FGKKSTIYVSAAALALGAFVGAASFEPNPARAFSQGENVSQGEGMRQKLPSFAPLVKQVK 85

Query: 49  PSIVSVMVEPKKKVSVE-QMFNAYGFGNLPEDHPLKNYFRKDFHKFF------SGEEPIL 101
           P++VS+ V+                 GN  E  PL+ YF                     
Sbjct: 86  PAVVSIRVKSDAAAKAAFGDDEGGPRGNPFEGSPLERYFGGPGGPRGGFGPWGRAPGGKG 145

Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
                    GSGFFI+ DGY++T+NH+ +D  S  V++ D     AK++GTD   DLA+L
Sbjct: 146 GPRQLVTAQGSGFFISPDGYLVTNNHVAQDAVSLEVVMDDGKIYTAKVIGTDPRTDLALL 205

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQ 220
           KV     F   +F  +    +G+ V  +GNPF L GTV+AGIVSA  RDI + P   F Q
Sbjct: 206 KVDGRTDFPYTKFSHSGA-EIGDWVVAMGNPFGLGGTVTAGIVSARGRDIGEGPYDDFIQ 264

Query: 221 IDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV 280
           IDA +N+GNSGGP FN  G VIGVN  I +     +G+   IP   +++ + +L  KG V
Sbjct: 265 IDASVNKGNSGGPTFNESGEVIGVNTAIYSPSGGSVGIAFAIPAPTVERVVAALKDKGHV 324

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             GW G+  Q LT ELA  LGL+ T G+L+ A    SPA+KAG+K GDVI  +DG  +K 
Sbjct: 325 TRGWLGVQIQGLTPELADSLGLKTTAGALVAAPQSGSPAEKAGIKTGDVITEVDGTEVKD 384

Query: 341 HQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK----ELLGM 396
            +D   +IA  +P    K+++ ++G   +V + +G  P           D       LG+
Sbjct: 385 GRDLAKKIADLAPGANAKLTVLRDGETKTVDLKIGQLPEKPTQRASLSDDGRTGLNDLGI 444

Query: 397 VLQD---INDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
            +     ++  +++   +  +      +    G+ +G  I+ V    V+   D++R +  
Sbjct: 445 AVAPAADVSPNDRQ--GLAVVGVEPGGKAAEAGLAEGDIILRVGDQTVNRPGDLKRALSD 502

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           A +  + + L  +K + D         RFV+L 
Sbjct: 503 ASKSGKKNALALVKRNGDQ--------RFVALP 527


>gi|149374714|ref|ZP_01892488.1| serine protease MucD precursor [Marinobacter algicola DG893]
 gi|149361417|gb|EDM49867.1| serine protease MucD precursor [Marinobacter algicola DG893]
          Length = 493

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 132/456 (28%), Positives = 209/456 (45%), Gaps = 13/456 (2%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
            ++    S  D   ++   S ++V++    + K +     N   F N  +   L  +F+ 
Sbjct: 36  AQSVSARSLPDFTELVEENSNAVVNISTTTEPKSANRGGSNGLPF-NDRQLEQLPEFFQD 94

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAK 148
            F    S        +V R   GSGF ++ DGY+LT+NH+VE      V L+D  ELPAK
Sbjct: 95  FFRGPQSPFGGGPGGSVPRQSMGSGFIVSSDGYVLTNNHVVEGADEIIVRLNDRRELPAK 154

Query: 149 LVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALD 208
           L+GTD   D+AVLK++       V    +N+++VGE V  IG+PF    TV+AGIVSAL 
Sbjct: 155 LIGTDPRSDMAVLKIEGGDDLPVVRIGRSNDLKVGEWVLAIGSPFGFDYTVTAGIVSALG 214

Query: 209 RDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSII 267
           R +P      F Q D  IN GNSGGP FN  G V+G+N+ I T     MGV   IP+   
Sbjct: 215 RSLPSENYVPFIQTDVAINPGNSGGPLFNLDGEVVGINSQIYTRSGGFMGVSFAIPIDDA 274

Query: 268 KKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVG 327
                 L   G V  GW G++ Q + ++LA   GL+  +G+L+  V+  SPA+KAG++ G
Sbjct: 275 MNVFRQLRDNGSVSRGWLGVLIQEVNRDLAESFGLKRPRGALVAEVMAGSPAEKAGLQAG 334

Query: 328 DVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE 387
           D++   +G  +    D    +      E   + + +EG + ++ V +G  P    +    
Sbjct: 335 DIVLKYEGEDVTLSSDLPPMVGRTPVGETATMEVMREGRQITLDVEIGKLPEEGAEQASA 394

Query: 388 VGDKE------LLGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNT 438
                       LGM ++ +    ++ + +   V +           GI+    I  +N 
Sbjct: 395 PASGNNGPSSAPLGMTVEPLPAELQESLGVSGGVLVTDVARGPALDAGIRPRDVITELNR 454

Query: 439 HEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
            +V+ + D    +    E    SV  ++        
Sbjct: 455 RKVTSVDDFREAVSSLPEDSAVSV--RVVRQGRATY 488


>gi|238786286|ref|ZP_04630228.1| Protease do [Yersinia bercovieri ATCC 43970]
 gi|238712809|gb|EEQ04879.1| Protease do [Yersinia bercovieri ATCC 43970]
          Length = 480

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 135/484 (27%), Positives = 222/484 (45%), Gaps = 18/484 (3%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLP-PSSVDLPPVIARVSPSIVSVMVEPK 59
           M K  ++      ++ L     SS      A         L P++ +V PS+VS+ VE  
Sbjct: 1   MKKTTLVLSALALSIGLVMGPVSSAISAETAPSSSQQLPSLAPMLEKVMPSVVSINVEGS 60

Query: 60  KKVSVEQMFNAYGFGN--LPEDHPLK----NYFRKDFHKFFSGEEPILSDTVERLMFGSG 113
            +VS                +D P       +      +   G +  +    E    GSG
Sbjct: 61  TQVSNAAAGGIPPQFQQFFGDDSPFCQDGSPFQGSPMCQGGQGGKGAVPSKQEFRALGSG 120

Query: 114 FFITD-DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
             I    GY++T+NH+V++    +V LSD     AK++G D   D+A+L+++  +    +
Sbjct: 121 VIIDAAKGYVVTNNHVVDNATKINVKLSDGRSYEAKVIGKDPRTDIALLQLKDFKNLTAI 180

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNS 230
           +  D++ +RVG+    IGNP+ L  TV++GIVSAL R   +      F Q DA IN+GNS
Sbjct: 181 KMADSDQLRVGDYTVAIGNPYGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNS 240

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GG   N  G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM  
Sbjct: 241 GGALINLSGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEFGQVKRGELGIMGT 300

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            L  ELA  + +   KG+ I+ VV +S A KAG+K GDVI  ++G+ I S   F  +I +
Sbjct: 301 ELNSELAKAMNVDTQKGAFISQVVPKSAAAKAGIKAGDVIVSMNGKPINSFAGFRAEIGT 360

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVR 410
                ++ + L ++G   +V V L  S  A+ D        E  G  L + +   KK   
Sbjct: 361 LPVGSKMTLGLLRDGKPVNVEVTLEQSSQAQVDSGNIYTGIE--GAELSNSDVNGKK--G 416

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
           +   N          G++KG  I+ +N   V  + ++ +++    + K   + L I+   
Sbjct: 417 VKVDNVKAGSAAARIGLKKGDIIIGINQQPVQNLGELRKIL----DTKPSVLALNIQRGD 472

Query: 471 DMQS 474
               
Sbjct: 473 TSLY 476


>gi|209965272|ref|YP_002298187.1| periplasmic serine protease, Do [Rhodospirillum centenum SW]
 gi|209958738|gb|ACI99374.1| periplasmic serine protease, Do [Rhodospirillum centenum SW]
          Length = 516

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 142/475 (29%), Positives = 224/475 (47%), Gaps = 33/475 (6%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           +     P+  R+ P++V+V      +               P   P + +FR  F +   
Sbjct: 53  APESFAPLAERILPAVVNVSTTQTVQNRGRS---PVPMPEFPPGSPFEEFFRDFFDRQQP 109

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSD--DTELPAKLVGTD 153
            ++P           GSGF I   GY++T+NH+++      VIL D   TEL A+++G D
Sbjct: 110 QQDPNTPP-RRATSLGSGFIIDPAGYVVTNNHVIDGADEIRVILHDQEGTELKAEVIGVD 168

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              DLA+LKV + RK   + + D+  IRVG+ V  IGNPF L G+V+AGI+SA  RDI  
Sbjct: 169 KETDLALLKVDAGRKLPALSWGDSEKIRVGDWVVAIGNPFGLGGSVTAGIISARARDIGA 228

Query: 214 RPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
                F Q DA IN+GNSGGP  N  G VIG+N  I +     +G+G  IP ++ K  I 
Sbjct: 229 GRYDDFLQTDASINRGNSGGPLVNLSGDVIGINTAIFSQTGGSIGIGFAIPSAMAKNVIA 288

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L   G+V  GW G+  QN++ E A  L L   KG+L+  V    PA+KAG++ GDVI  
Sbjct: 289 QLRESGKVRRGWLGVQIQNISPEEAEALRLPEAKGALVGMVNPGGPAEKAGLQPGDVILS 348

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS----------PTAKN 382
            DGR + + +     +A     ++V + L + G + +V VVLG            P   +
Sbjct: 349 FDGREVTNSRSLPRMVADTPVGKKVPVELIRRGKRETVQVVLGELQPQDVQLANAPGQGD 408

Query: 383 DMHLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVE-AKGIQKGMTIV 434
               +    E +G+ +  I+   ++          +V             + ++ G  IV
Sbjct: 409 AAPGKPETIEGVGIAVTSISPEVRRQFELDDDVKGVVITQVAPNSPAAVRQQLRAGDVIV 468

Query: 435 SVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            V+  EV    DV   + KA++  + ++LL I+   ++         F ++ + +
Sbjct: 469 EVSQEEVGSPADVVARVKKARDAGQKALLLLIERRGELV--------FQAVPLTE 515


>gi|260433980|ref|ZP_05787951.1| protease Do subfamily [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417808|gb|EEX11067.1| protease Do subfamily [Silicibacter lacuscaerulensis ITI-1157]
          Length = 477

 Score =  199 bits (506), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 147/502 (29%), Positives = 244/502 (48%), Gaps = 41/502 (8%)

Query: 1   MFKRQ-----ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVM 55
           M  R+      LS K I   AL+  + + T +  +A        L  ++  VSPS+V+++
Sbjct: 1   MNIRKSPYTFPLSTKMIGVTALSTALLAGTAIPSQADEA-----LADLVESVSPSVVTII 55

Query: 56  VEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFF 115
                         A      PE     + F + F +F + E   +     R   GSGF 
Sbjct: 56  ASQDA---------APVPAGAPEFDFEGHPFGEFFKRFGAPEGFDVPQGGPRQGLGSGFV 106

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
           + +DGYI+T++H+V++  + +V LSDD    A++VGTD L D+A+LK+++D     V   
Sbjct: 107 LDEDGYIITNHHVVDNADTVTVRLSDDRSYEAEVVGTDPLTDIALLKIEADVPLKAVPLG 166

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPC 234
           D++ IRVGE V  IGNPF L  TV+ GIVSA  R+I D P   F Q DA IN+GNSGGP 
Sbjct: 167 DSDEIRVGEDVVAIGNPFGLSSTVTTGIVSAKGRNISDGPYAEFIQTDAAINKGNSGGPL 226

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
           FN  G V+GVN+ I +     +G+G  +  +I++     L   G+V  GW G+  QN++ 
Sbjct: 227 FNMDGEVVGVNSAIYSPSGGSVGLGFAVTSNIVEHIAEDLRDDGQVSRGWLGVSIQNVSP 286

Query: 295 ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK 354
           ELA  +G+ GT G+L++ VV  SPAD   +K GDVI   +G  + S  +    + + +  
Sbjct: 287 ELAAAMGIEGTTGALVSDVVPGSPADGV-LKQGDVIVEFNGEKVDSSSELPVLVGTTAIG 345

Query: 355 EQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK--ELLGMVLQDINDGNKKLV--- 409
              K+++ + G   ++ V +G   T              + LG+ +  +++  +  +   
Sbjct: 346 TDSKLTVLRNGKTETLKVTIGQRQTETAAAAPAQDKAAGKTLGVTVAPLSETTRAEMGVP 405

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +V      +      G+ +G  IV +    +   +D+++ +     +K D  L+ 
Sbjct: 406 ENVHGVVITGLRPDSPAAKAGLHRGDVIVRLGNEPIDSPEDLKKALE---NQKTDPALVL 462

Query: 466 IKYDPDMQSGNDNMSRFVSLKI 487
           I    +          FV++++
Sbjct: 463 INRGGNQ--------IFVAVEV 476


>gi|89902581|ref|YP_525052.1| peptidase S1C, Do [Rhodoferax ferrireducens T118]
 gi|89347318|gb|ABD71521.1| Peptidase S1C, Do [Rhodoferax ferrireducens T118]
          Length = 501

 Score =  199 bits (506), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 133/508 (26%), Positives = 224/508 (44%), Gaps = 39/508 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEA------------KLPPSSVDLPPVIARVSPS 50
           +R +L++ S+  +    V   S      A                +  D   + AR   +
Sbjct: 9   RRLVLALVSVGVLGAAGVGALSFSHAQAAVSTAPTASAAATAPVVALPDFSQIAARNGAA 68

Query: 51  IVSVMVEPKKKVSVEQMFNA------YGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDT 104
           +V++ V      S E   +        G   +  + P   +F++                
Sbjct: 69  VVNISVTGMINTSGEDNGDGAPHGARPGMPGMDPNDPFFEFFKRFQGPNGGFPGQPRMPM 128

Query: 105 VERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
                 GSGF I+ DG ILT+ H+V D    +V L+D  E  AK++GTD   D+AVLK+ 
Sbjct: 129 ---HGQGSGFIISPDGVILTNAHVVRDAKDVTVKLTDRREFRAKVLGTDLKTDVAVLKID 185

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDA 223
           +      +      +++VGE V  IG+PF    +V+AG+VSA  R +PD     F Q D 
Sbjct: 186 AKDL-PTITVGTTRDLKVGEWVLAIGSPFGFENSVTAGVVSAKGRSLPDDSFVPFIQTDV 244

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N GNSGGP FN  G V+G+N+ I +    + G+   IP+ +  K    +++ G   H 
Sbjct: 245 AVNPGNSGGPLFNTRGQVVGINSQIYSQSGGYQGLSFAIPIELASKVKDQIVATGHASHA 304

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
             G++ Q + Q  A    L   +G+L++ V K+ PADKAG+K GDVI  ++G+ I    D
Sbjct: 305 RLGVVIQEVNQTFADSFHLDKPEGALVSNVDKDGPADKAGLKSGDVILKVNGQPIIMSSD 364

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT--AKNDMHLEVGDKELLGMVLQDI 401
               I + +P ++V + + ++G +      LG +     +     +   +  LG+ L+ +
Sbjct: 365 LPALIGTAAPGDKVSLEIWRQGKREQFTARLGDASAKVEQLAKADDGVGQGKLGLALRAL 424

Query: 402 NDGNKKLVRI--VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
               K+   +    L  +        G+Q G  +V+VN   +  +  V  ++ KA     
Sbjct: 425 QPQEKRAAGVNQGLLVEDAAGPAALAGVQAGDVLVAVNGTPIESVTQVRAIVAKA----T 480

Query: 460 DSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            SV L I+ D            FV +++
Sbjct: 481 KSVALLIQRDGS--------KIFVPVRL 500


>gi|115524194|ref|YP_781105.1| peptidase S1C, Do [Rhodopseudomonas palustris BisA53]
 gi|115518141|gb|ABJ06125.1| protease Do [Rhodopseudomonas palustris BisA53]
          Length = 499

 Score =  199 bits (506), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 139/500 (27%), Positives = 230/500 (46%), Gaps = 33/500 (6%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           R +L    +   +L+     S               +  V  +V  ++V++       V+
Sbjct: 12  RPMLKTACVVVASLSVACALSMAPAAAR----GPDGIADVAEKVIDAVVNISTTQTV-VA 66

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYIL 123
                +      LP   P + +F   F      +        +    GSGF +   G  +
Sbjct: 67  KAGGDSKGAAPQLPPGSPFEEFFEDFFKNRRGDKGGGP---RKTNSLGSGFIVDTAGIAV 123

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP-VEFEDANNIRV 182
           T+NH++ D    ++I++D T++ A+LVG D   DLAVLK +   K +  V+F D++ +R+
Sbjct: 124 TNNHVIADADEINIIMNDGTKIKAELVGVDKKTDLAVLKFKPPAKPLVAVKFGDSDKLRL 183

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHV 241
           GE V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP FN  G V
Sbjct: 184 GEWVVAIGNPFSLGGTVTAGIVSARNRDINSGPYDSYIQTDAAINRGNSGGPLFNLNGEV 243

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +GVN +I++     +G+G  +P   +   + SL   G +  GW G+  Q +T E+A  L 
Sbjct: 244 VGVNTLIISPSGGSIGIGFAVPSKTVVGVVDSLRQFGELRRGWLGVRIQQVTDEIAESLN 303

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           ++  +G+LI  V  + PA  AG++ GDV+   DG+ IK  +D    +A  +  + V + +
Sbjct: 304 IKPARGALIAGVEDKGPAKPAGIEPGDVVVKFDGKDIKEPKDLSRVVADTAVGKSVDVVI 363

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---------LGMVLQDINDGNKKLV--- 409
            ++G + +  V LG            V  +           LG+ L  ++   +      
Sbjct: 364 IRKGEEQTKQVTLGKLEDTDKPQPASVKSQPEAEKPVTQKALGLDLAGLSKELRAKYKIK 423

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                ++  + +   +   K +  G  IV V    V+   D+++ I   K+  + SVLL 
Sbjct: 424 DSVKGVLVTSVDPGSDAAEKRLSAGDVIVEVAQEAVASAADIKKRIEAIKKDGKKSVLLL 483

Query: 466 IKYDPDMQSGNDNMSRFVSL 485
           +          D   RFV++
Sbjct: 484 VSNG-------DGELRFVAV 496


>gi|126439161|ref|YP_001059804.1| Do family protease [Burkholderia pseudomallei 668]
 gi|126453924|ref|YP_001067092.1| Do family protease [Burkholderia pseudomallei 1106a]
 gi|167739555|ref|ZP_02412329.1| protease, Do family protein [Burkholderia pseudomallei 14]
 gi|167895248|ref|ZP_02482650.1| protease, Do family protein [Burkholderia pseudomallei 7894]
 gi|167919877|ref|ZP_02506968.1| protease, Do family protein [Burkholderia pseudomallei BCC215]
 gi|242314817|ref|ZP_04813833.1| putative serine protease MucD [Burkholderia pseudomallei 1106b]
 gi|254191241|ref|ZP_04897745.1| protease, Do family [Burkholderia pseudomallei Pasteur 52237]
 gi|254195718|ref|ZP_04902144.1| protease, Do family [Burkholderia pseudomallei S13]
 gi|254261419|ref|ZP_04952473.1| protease, Do family [Burkholderia pseudomallei 1710a]
 gi|126218654|gb|ABN82160.1| serine protease MucD [Burkholderia pseudomallei 668]
 gi|126227566|gb|ABN91106.1| putative serine protease MucD [Burkholderia pseudomallei 1106a]
 gi|157938913|gb|EDO94583.1| protease, Do family [Burkholderia pseudomallei Pasteur 52237]
 gi|169652463|gb|EDS85156.1| protease, Do family [Burkholderia pseudomallei S13]
 gi|242138056|gb|EES24458.1| putative serine protease MucD [Burkholderia pseudomallei 1106b]
 gi|254220108|gb|EET09492.1| protease, Do family [Burkholderia pseudomallei 1710a]
          Length = 502

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 121/508 (23%), Positives = 219/508 (43%), Gaps = 52/508 (10%)

Query: 12  ICTVALTCVIFSSTYLVLEAK--------------LPPSSVDLPPVIARVSPSIVSVMVE 57
           +   A+T +   +      A                     D   ++ RV P++V++   
Sbjct: 10  LVAAAVTALTPLAAQSATAAPNVTTTPAATGAAPAARAGLPDFADLVERVGPAVVNIRTT 69

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL---------SDTVERL 108
                               ++  +  +FR+ F                     DT +  
Sbjct: 70  ANVPADTRGALPPGL-----DNGDMSEFFRRFFGIPLPQGPGGQKNAPSTPDAPDTEQNR 124

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+A++K+ +   
Sbjct: 125 GVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDERTDVAIVKINASSL 184

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQG 228
              V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+  D    F Q D  +N G
Sbjct: 185 -PTVAIGDSNRVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FIQTDVAVNPG 242

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G   + 
Sbjct: 243 NSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGKVTRGRIAVA 302

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
              +T+E+A  +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D    +
Sbjct: 303 IGEVTKEVADSIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMV 362

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN------DMHLEVGDKELLGMVLQDIN 402
               P  +  +++ ++G    + + +   P  K           +      LG+ + D++
Sbjct: 363 GDTKPGAKATVTVWRKGQSRDLPITIAEFPADKAAKADSRQAPQQKPRSSALGLTVSDLS 422

Query: 403 DGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
               K +     +       +      G+Q+G  ++ V   +++  K    +  K   ++
Sbjct: 423 PEQLKTLKLRNGVQIDAV--DGPASRAGLQRGDIVLRVGDVDITSAKQFVDVTSKLDPQR 480

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
             +VL++              ++F+ ++
Sbjct: 481 AVAVLVR----------RGENTQFIPIR 498



 Score = 70.2 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 313 SIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKAT 372

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 373 VTV----------WRKGQSRDLPITIAE 390


>gi|27381617|ref|NP_773146.1| DO-like serine protease [Bradyrhizobium japonicum USDA 110]
 gi|27354785|dbj|BAC51771.1| serine protease DO-like precursor [Bradyrhizobium japonicum USDA
           110]
          Length = 507

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 143/510 (28%), Positives = 239/510 (46%), Gaps = 36/510 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
            + +      I   AL    F +     +A+ P     +  V  +V  ++V++      +
Sbjct: 11  LRHRARLGVRIGLAALAVSAFGAFGTPAQARGPEG---IADVAEKVIDAVVNISTSQTVE 67

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNY------FRKDFHKFFSGEEPILSDTVERLMFGSGFF 115
                   +     LP   P + +       R+       G+        +    GSGF 
Sbjct: 68  AK---GGGSNTMPQLPPGSPFEEFFDDFFKNRRGPGGPGGGKGGDNGPPRKTNSLGSGFI 124

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
           I   G ++T+NH++ D    +VIL+D T++ A+LVG D   DLAVLK +  +  + V+F 
Sbjct: 125 IDTSGVVVTNNHVIADADEINVILNDGTKIKAELVGVDKKTDLAVLKFKPTKPLVAVKFG 184

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPC 234
           D++ +R+G+ V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP 
Sbjct: 185 DSDKLRLGDWVVAIGNPFSLGGTVTAGIVSAKNRDISSGPYDSYIQTDAAINRGNSGGPL 244

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
           FN  G VIGVN +I++     +G+G  +P   +   +  L   G +  GW G+  Q++T 
Sbjct: 245 FNLDGDVIGVNTLIISPSGGSIGIGFAVPSKTVMGVVDQLRQFGELRRGWLGVRIQSVTD 304

Query: 295 ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK 354
           E+A  L ++  +G+L+  V  + PA  AG++ GDV+   DG+ +K  +D    +A  +  
Sbjct: 305 EIAESLNIKPPRGALVAGVDDKGPAKPAGIEPGDVVVKFDGKDVKDPKDLSRVVADTAVG 364

Query: 355 EQVKISLCKEGSKHSVAVVLGSSPT---------AKNDMHLEVGDKELLGMVLQDINDGN 405
           ++V + + ++G + +  V LG                    +   ++ LG+ L  +N   
Sbjct: 365 KEVDVIIIRKGQEETKKVTLGRLQDPDKVQAAVKTDEPAPEKPVTQKALGLDLAVLNKDL 424

Query: 406 KKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
           +           +V  N +   +   K +  G  IV V    VS   D+++ + + K+  
Sbjct: 425 RTRYKIKDSVKGVVVTNVDANSDAAEKRLSAGDVIVEVAQEVVSSGADIQKRVDQLKKDG 484

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           + SVLL +       S  D   RFV+L + 
Sbjct: 485 KKSVLLLV-------SNADGELRFVALSVQ 507


>gi|254472015|ref|ZP_05085416.1| serine protease [Pseudovibrio sp. JE062]
 gi|211959217|gb|EEA94416.1| serine protease [Pseudovibrio sp. JE062]
          Length = 516

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 163/501 (32%), Positives = 250/501 (49%), Gaps = 23/501 (4%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLP-------PSSVDLPPVIARVSPSIVSVM 55
           KR+   +     +A+   + +   LV             P+  +   ++  V P++VSV 
Sbjct: 22  KRRSRLLNGTMALAIAGAMVAPLTLVPATSQAEPVRVDVPAMPNFVGLVEAVQPTVVSVR 81

Query: 56  VEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFF 115
           V  + K           F ++P+DHPL+ +FR+   K    ++            GSGFF
Sbjct: 82  VRSEVKEHDRLSGIPPMFRDMPDDHPLQKFFREFGGKGGEQKKKAPPRKRFDQSQGSGFF 141

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
           I+DDGY++T+ H+VE G  F+++ S+  EL A LVG D   DLA+LKV+S+ KF  V F 
Sbjct: 142 ISDDGYVVTNEHVVEGGTEFTIVTSEGDELEATLVGADKRSDLALLKVESEEKFEYVAFA 201

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR-PGTFTQIDAPINQGNSGGPC 234
           D   + VG  V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNSGGP 
Sbjct: 202 DDAPL-VGSWVVAVGNPFGLGGTVTAGIVSARGRDIGAGIYDDFLQIDASVNRGNSGGPA 260

Query: 235 FNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQ 294
           FN  G V+GVN+ IV+    ++G+   IP    KK I  L   G V  GW G+  Q +T+
Sbjct: 261 FNVKGEVVGVNSAIVSPSGGNVGIAFAIPAQTAKKIISDLKEDGAVTRGWLGVQIQPVTK 320

Query: 295 ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK 354
           ++A  LGL    G+L+  V  ++PA  AG + GD+I  +DG  +   ++    IA  SP 
Sbjct: 321 DIAESLGLDNENGTLVAEVQGDTPAKAAGFQAGDIILKVDGEEVNGPRELAKVIAGYSPN 380

Query: 355 EQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD------KELLGMVLQDINDGNKKL 408
            +V+I   ++G  ++  V LG+ P  K     +  +       + LG+ L    +     
Sbjct: 381 TEVEIEYWRDGEINTATVKLGTIPEEKQQASAKQSEDANTALVDSLGLELATAEEAGVDE 440

Query: 409 VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
             +V    + +     KG+  G  I  V   +V    DV   + KA+E+ R +VLL++  
Sbjct: 441 EGVVVTKVDPDGPAADKGLAPGAIITEVANVKVQSPADVAEQVEKAREQGRKAVLLRVTR 500

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
                      + FV++ ++K
Sbjct: 501 G--------ENTLFVAIPLEK 513


>gi|302035687|ref|YP_003796009.1| serine protease Do [Candidatus Nitrospira defluvii]
 gi|300603751|emb|CBK40083.1| Serine protease Do [Candidatus Nitrospira defluvii]
          Length = 492

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 129/476 (27%), Positives = 219/476 (46%), Gaps = 31/476 (6%)

Query: 18  TCVIFSSTYLVLEAKLPPS------SVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAY 71
                +S       + P +      +     V   V+P++V++     ++V+        
Sbjct: 28  LTTSHASNPSPAAEERPATLTGTLPAAGFADVAKTVTPAVVNITTSGAEEVADSTRPRGR 87

Query: 72  GFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
                     ++++F   F     G  P+          GSG  +T DGY+LT+NH++  
Sbjct: 88  ----------MEDFFGSPFGPRRFGP-PMEPRERRGGGQGSGVIVTPDGYVLTNNHVIAG 136

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
             + +V L D  E   ++VG+D   D+AV+K+   +    V + D++ ++VGE V  +GN
Sbjct: 137 AKTVTVTLPDKREFKGRIVGSDPKSDIAVVKIDGTQL-PTVTWGDSSRLQVGEYVLAVGN 195

Query: 192 PFRLRGTVSAGIVSA--LDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIV 249
           PF L  TV+ GIVSA         +   F Q DA IN GNSGG   N  G +IG+N  I 
Sbjct: 196 PFGLNSTVTLGIVSALGRGHMGITQYEDFIQTDAAINPGNSGGALVNTRGELIGINTAIF 255

Query: 250 TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSL 309
           +    + GVG  +P  + K    SL+  G+V  G+ G+  Q+L QELA    ++G+ G++
Sbjct: 256 SQTGGYQGVGFAVPTGMSKPIYESLVKTGKVVRGYLGVGIQDLNQELAKSFNVKGSNGAI 315

Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369
           +T V +E PADKAG+K GDVI    G  I+        +   S   +  I++ +EG +  
Sbjct: 316 VTDVKEEGPADKAGLKQGDVILSFQGTPIEDAVTLQRAVTRSSVGSKATITVMREGREKD 375

Query: 370 VAVVLGSSPTAKNDMHLEVG--DKELLGMVLQDINDGNKKLVR-------IVALNPNRER 420
           + V +G  P        E G  ++ L G+ +Q+++    + +        +V    + E 
Sbjct: 376 LTVTIGELPDNPQVAKAETGPSEQPLAGLAVQELDRETAQELGIKGKIQGVVVTTVDPES 435

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
           + E  G+  G  I  +N   V+ +KD +R     K+ +  +VL+ +         +
Sbjct: 436 DAERAGLMPGDVIREINRKPVTSMKDFDRAASDLKKGQ--TVLVLVNRRGASLYLS 489


>gi|221369257|ref|YP_002520353.1| Protease Do precursor [Rhodobacter sphaeroides KD131]
 gi|221162309|gb|ACM03280.1| Protease Do precursor [Rhodobacter sphaeroides KD131]
          Length = 474

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 131/480 (27%), Positives = 228/480 (47%), Gaps = 26/480 (5%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           +    I +  +T  +  +      A+          ++ARVSP++V + V  K K S   
Sbjct: 1   MKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVTAKSKESTPM 60

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-RLMFGSGFFITDDGYILTS 125
                         P + + R+          P   +  +     GSGF I+ DG I+T+
Sbjct: 61  A-----------GSPFEEFLRRFGEIDPQFRMPQAPEGGQVMHGLGSGFLISQDGIIVTN 109

Query: 126 NHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
           NH+VE+     V L D  E  A++VGTD + D+AV++++  +    VE  D+  +RVG+A
Sbjct: 110 NHVVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRVGDA 169

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V+G+
Sbjct: 170 VVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKVVGM 229

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  I +     +G+G  IP + +K  +  L  KG V  GW G+  Q +T E+A  +GL G
Sbjct: 230 NTAIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMGLEG 289

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
             G+L+  V + SPAD+ G++ GDVI  ++G+ +         IA+    E+ ++++ ++
Sbjct: 290 RDGALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKARLTVQRD 349

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGDKEL---LGMVLQDINDGNKKLV-------RIVAL 414
           G +  + V +G     +  +      + L   LG+ +Q +     + +        +V  
Sbjct: 350 GRQQEMTVTIGELTPDRAQVASAESPEGLGGPLGIEVQPLEPALARQLSLPDGASGVVVT 409

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
             +       + +  G  I       V   +D+   + +A+   +  +L+++    +   
Sbjct: 410 AVDPSGPNADR-LAPGDVIQEAAGRPVETPRDLASAMREAR--GKGVMLMKVLRQGNPVY 466


>gi|170693454|ref|ZP_02884613.1| protease Do [Burkholderia graminis C4D1M]
 gi|170141609|gb|EDT09778.1| protease Do [Burkholderia graminis C4D1M]
          Length = 502

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 129/460 (28%), Positives = 214/460 (46%), Gaps = 23/460 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED--HPLKNYFRKDFHKFFS 95
            D   ++    P++V++  +   K +  +     G   LP D   P   +++  F     
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKRAALRGNGGNGGNQLPIDPSDPFYQFYKHFFGGMPG 114

Query: 96  GEEPILS--DTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
            +               GSGF ++ DGYILT+ H+V+     +V L+D  E  AK+VG D
Sbjct: 115 MQGGDGGDVPDQPSASLGSGFIVSSDGYILTNAHVVDGANVVTVKLTDKREFKAKVVGAD 174

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +P+
Sbjct: 175 KQSDVAVLKIDAGNL-PTVKIGDPRQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRSLPN 233

Query: 214 RPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
              T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K   
Sbjct: 234 ENYTPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKD 293

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            ++  G V  G  G+  Q + Q LA   G++  +G+L+++V    PA KAG++ GDVI  
Sbjct: 294 DIVKTGHVSRGRLGVAVQGMNQTLANSFGMQKPQGALVSSVDPGGPAAKAGLQPGDVILS 353

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD-- 390
           ++G  +        QIA  +P     + + ++     + V +GS   +K           
Sbjct: 354 VNGEPVTDSSALPSQIAGLAPGSTAAVQVWRDKGTKDLKVTIGSLSDSKVASDKADQPTQ 413

Query: 391 -KELLGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
            +  LG+ ++ +    K    I    L        E+ GIQ G  I++VN   V+ +  +
Sbjct: 414 LQGRLGVAVRPLTPEEKSSAAISHGLLVQQSGGAAESAGIQPGDVILAVNGRPVASVDQL 473

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           ++++  A     +S+ L I+ D        N   FV + +
Sbjct: 474 KQMVAGA----GNSIALLIQRD--------NAQIFVPVDL 501


>gi|187927027|ref|YP_001893372.1| protease Do [Ralstonia pickettii 12J]
 gi|241665356|ref|YP_002983715.1| protease Do [Ralstonia pickettii 12D]
 gi|187728781|gb|ACD29945.1| protease Do [Ralstonia pickettii 12J]
 gi|240867383|gb|ACS65043.1| protease Do [Ralstonia pickettii 12D]
          Length = 492

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 136/513 (26%), Positives = 230/513 (44%), Gaps = 49/513 (9%)

Query: 2   FKRQILSVKSICTVALTCVIF------------SSTYLVLEAKLPPSSV----------- 38
             RQ L+  +    A+  V              +    +     P +S+           
Sbjct: 1   MTRQTLARSAAGLAAVIAVAGGYAYLQKDVITRAVAAPIAPVTTPQTSMATPAVAVAAPM 60

Query: 39  DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE 98
           D   ++ R  P++V++ V    + +  Q         +  D P  ++F+         + 
Sbjct: 61  DFSGIVERYGPAVVNISVTAHAQRTSMQGLP----PGMSPDDPFADFFKHFM-----PQM 111

Query: 99  PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
           P           GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++G D   D+
Sbjct: 112 PQQRGDQIVRGLGSGFIVSSDGLILTNAHVVDGAQEVNVKLTDRREFKAKVLGVDKQSDV 171

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-T 217
           AVL++ +      V+     N +VGE V  IG+P+    TV+AGIVSA  R +PD     
Sbjct: 172 AVLRISAKNL-PVVQIGSPANTKVGEPVVAIGSPYGFENTVTAGIVSAKSRSLPDDTYVP 230

Query: 218 FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISK 277
           F Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   IP+ +  K    L++ 
Sbjct: 231 FIQTDVAVNPGNSGGPLFNQHGEVIGINSQIYSQTGGYQGLSFAIPIDVAMKVEQQLVAT 290

Query: 278 GRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRI 337
           G+V  G  GI  Q + Q LA    L   +G+L+ +V  + PA KAG++ GDVI  ++G  
Sbjct: 291 GKVTRGRLGIAVQEVDQSLADSFNLPKPEGALVNSVESDGPAAKAGLQPGDVILQINGAR 350

Query: 338 IKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-DKELLGM 396
           I    D   Q+A   P   V + + ++G   +++V +G++  AK   + +   ++  LG+
Sbjct: 351 IDRSGDLPEQVADIKPGTTVPLQIMRQGKPTTLSVTVGAAKDAKVASNDKAAPNQGRLGL 410

Query: 397 VLQDINDGNKKLVRIVALNPN--REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
            ++ +    K+   +                GIQ G  I+S+N   VS ++++  L+ +A
Sbjct: 411 AVRPLQPDEKRQSGLPGGLVVMEASGPSAKVGIQPGDVILSLNGTPVSSVQELRTLVERA 470

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
                  V L ++ D        +   FV + +
Sbjct: 471 ----GKHVALLVQRD--------DTKIFVPVDL 491


>gi|209965441|ref|YP_002298356.1| periplasmic serine protease, Do [Rhodospirillum centenum SW]
 gi|209958907|gb|ACI99543.1| periplasmic serine protease, Do [Rhodospirillum centenum SW]
          Length = 498

 Score =  199 bits (505), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 129/466 (27%), Positives = 222/466 (47%), Gaps = 26/466 (5%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED---HPLKNYFRKDFHK 92
           +      +     P++V++    +                        PL+++F + F  
Sbjct: 39  APASFSALAKDKLPAVVTITAAGEIPAQAPGEMPGGPGAPPFGLPPGSPLEDFFGEFF-- 96

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
                 P           GSGF I   G+I+T+NH+VE+     V         AKL+GT
Sbjct: 97  --GRRGPDGGGPRPTRALGSGFVIDPAGFIVTNNHVVENADEIEVAFPSGDTYQAKLIGT 154

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   D+A+LKV++      + + D+    VG+ V  IGNPF L GTV+AGI+SA  RDI 
Sbjct: 155 DPATDIALLKVETPEPLPALAWGDSETAEVGDWVIAIGNPFGLGGTVTAGIISARARDIG 214

Query: 213 DRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
                 F Q D  IN GNSGGP  +  G VIGVN  I +    ++G+G  +P +I +   
Sbjct: 215 AGNYDDFLQTDTAINTGNSGGPLIDMKGEVIGVNTAIFSRSGGNIGIGFSVPSAIARSVA 274

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             L  +G V+ G+ G+  Q ++ E+A  LGL+  +G+L+++V  +SPA +AG++ GD+I 
Sbjct: 275 EELRDRGFVERGFLGVTIQQVSPEIAAALGLKEARGALVSSVTADSPAAQAGIETGDLIT 334

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK 391
            L+GR ++  +D    +A   P   V++ L ++G + +V   +G+ P  +     E G +
Sbjct: 335 TLNGRPVERPRDLSRAVADTDPGRTVELGLLRQGRERTVTPKVGTLPRERQVAEAETGGE 394

Query: 392 EL---LGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEV 441
                LG+ L  +    ++   +       V +          +G Q G  I   N  EV
Sbjct: 395 SGQATLGLTLAPLTPPLRERFGLEEDTQGTVVVGVAPNSPAAQRGFQPGDLITRANQSEV 454

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           +  +D+++ I +A+++ RD++++  +        + + + FV L +
Sbjct: 455 TSPEDLQQAIAEARKQGRDAIVVLRR--------SQDGALFVPLPV 492


>gi|270263988|ref|ZP_06192256.1| protease do, precursor [Serratia odorifera 4Rx13]
 gi|270042181|gb|EFA15277.1| protease do, precursor [Serratia odorifera 4Rx13]
          Length = 479

 Score =  199 bits (505), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 120/483 (24%), Positives = 220/483 (45%), Gaps = 17/483 (3%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M K  ++      ++ +     ++      +        L P++ +V PS+VS+ VE   
Sbjct: 1   MKKTALVFSALAFSIGMALGPMTAGAAETASSSTQQLPSLAPMLEKVMPSVVSINVEGST 60

Query: 61  KVSV---EQMFNAYGFGNLP---EDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGF 114
            V+       F  +   + P   +  P +               P      +    G+G 
Sbjct: 61  TVNAQKMPPQFQQFFGEDSPFCQDGSPFQASPMCQGGTDGGQGAPGQGTQEKFQALGAGV 120

Query: 115 FIT-DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
            I    GY++T+NH+V++     V LSD  +  AK++G D   D+A+++++  +    ++
Sbjct: 121 VIDAAKGYVVTNNHVVDNANKIQVQLSDGRKFDAKVIGKDPRSDIALIQLKDFKNLTAIK 180

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSG 231
             D+  +RVG+    IGNP+ L  T ++GIVSAL R   +      F Q DA IN+GNSG
Sbjct: 181 MADSEQLRVGDYTVAIGNPYGLGETATSGIVSALGRSGLNIENYENFIQTDAAINRGNSG 240

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           G   N  G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   
Sbjct: 241 GALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTAQMVEFGQVKRGELGIMGTE 300

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           L  ELA  + +   +G+ ++ V+ +S A KAG+K GDVI  ++G+ I S   F  +I + 
Sbjct: 301 LNSELAKAMKVDAQRGAFVSQVMPKSSAAKAGIKAGDVIVTMNGKAISSFASFRAEIGTL 360

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI 411
               ++ + + ++G   +V V L    +A+  +        + G  L +   G++K   +
Sbjct: 361 PVGSKMSLGIIRDGKPVTVDVTLEQ--SAQTQVESGNIYTGIEGAELSNAQAGSQK--GV 416

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
              N          G++KG  I+ VN   +  + ++ +++    + K   + L I+    
Sbjct: 417 KVDNVKAGSAAARIGLKKGDIILGVNQQPIQNLGELRKIL----DSKPSVLALNIQRGDT 472

Query: 472 MQS 474
              
Sbjct: 473 QLY 475


>gi|167837353|ref|ZP_02464236.1| protease, Do family protein [Burkholderia thailandensis MSMB43]
          Length = 502

 Score =  199 bits (505), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 118/517 (22%), Positives = 217/517 (41%), Gaps = 51/517 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPP-------------SSVDLPPVIARVS 48
                L    +          ++                           D   ++ RV 
Sbjct: 1   MMNPSLRTWLVAAAVTALTPLAAQSATAAPNATTAPAAAGAAPTTRAGLPDFADLVERVG 60

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL------- 101
           P++V++                       ++  +  +FR+ F                  
Sbjct: 61  PAVVNIRTTANVPADTRGALPPGL-----DNGDMSEFFRRFFGIPLPQPPGGQKNAPSTP 115

Query: 102 --SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLA 159
              DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  A+L+G D   D+A
Sbjct: 116 EAPDTEQNRGVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDKREFKARLIGVDERTDVA 175

Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFT 219
           ++K+ +      V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+  D    F 
Sbjct: 176 IVKINASSL-PTVAIGDSNRVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FI 233

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+
Sbjct: 234 QTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGK 293

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  G   +    +T+E+A  +GL   +G+L+++V    PADKAG++ GD+I   +GR ++
Sbjct: 294 VTRGRIAVAIGEVTKEVADSIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVE 353

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN------DMHLEVGDKEL 393
           +  D    +    P  +  +++ ++G    + + +   P  K           +      
Sbjct: 354 TASDLPRMVGDTKPGTKATVTVWRKGQSRDLPITITEFPADKTAKADSRQAPQQKPRSSA 413

Query: 394 LGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
           LG+ + D++    K +     +       +      G+Q+G  ++ V   +++  K    
Sbjct: 414 LGLTVSDLSPDQLKTLKLRNGVQIDAV--DGPAARAGLQRGDIVLRVGDVDITSAKQFVD 471

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +  K   ++  +VL++            + ++F+ ++
Sbjct: 472 VTSKLDPQRAVAVLVR----------RGDNTQFIPIR 498



 Score = 72.5 bits (175), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 313 SIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVETASDLPRMVGDTKPGTKAT 372

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 373 VTV----------WRKGQSRDLPITITE 390


>gi|92118235|ref|YP_577964.1| peptidase S1C, Do [Nitrobacter hamburgensis X14]
 gi|91801129|gb|ABE63504.1| Peptidase S1C, Do [Nitrobacter hamburgensis X14]
          Length = 497

 Score =  199 bits (505), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 136/478 (28%), Positives = 228/478 (47%), Gaps = 27/478 (5%)

Query: 28  VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFR 87
           +    L      +  V  +V  ++V++      +              LP   P + +F 
Sbjct: 28  ISAPALARGPDGIADVAEKVIDAVVNISTTQTVEAKGGS-EGHRVIPQLPPGSPFEEFFD 86

Query: 88  KDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPA 147
             F     G++  L    +    GSGF +   G ++T+NH++ D    +VIL+D  ++ A
Sbjct: 87  DFFKNRRGGKDGGLQPH-KTNSLGSGFIVDPAGIVVTNNHVIADSDEINVILNDGIKVKA 145

Query: 148 KLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSAL 207
           ++VG D   DLAVLK +       V+F D++ +R+GE V  IGNPF L GTV+AGIVSA 
Sbjct: 146 EIVGVDKKTDLAVLKFKPPHPLTAVKFGDSDKLRLGEWVVAIGNPFSLGGTVTAGIVSAR 205

Query: 208 DRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
           +RDI + P   + Q DA IN+GNSGGP FN  G V+GVN +I++     +G+G  +P   
Sbjct: 206 NRDINNGPYDSYIQTDAAINRGNSGGPLFNLDGEVVGVNTLIISPSGGSIGIGFAVPSKT 265

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
           +   +  L   G +  GW G+  Q +T E+A  L ++  +G+L+  V  + PA  AG++ 
Sbjct: 266 VAGVVDQLRQFGELRRGWLGVRIQQVTDEIADSLNIKPARGALVAGVEDKGPAKPAGIEP 325

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA------ 380
           GDVI   DG+ IK  +D    +A  +  + V + + ++G + +  V LG    +      
Sbjct: 326 GDVIIAFDGKDIKEPKDLSRIVADTAVGKTVNVMIIRKGKQETKKVTLGRLDDSDKATPV 385

Query: 381 ----KNDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQK 429
               K D   +   ++ LG+ L  ++   +           ++  + + + +   K +  
Sbjct: 386 SVKTKPDSDDKPVTQKALGLDLAALSKDLRTRYKIKDSVKGVIITDVDADSDAAEKRLSA 445

Query: 430 GMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           G  IV V    VS   D+ + I + K+  + +VLL +              RFV+L +
Sbjct: 446 GDVIVEVAQEAVSSASDIRKRIDQLKKDGKKAVLLMVSNGT-------GELRFVALSL 496


>gi|217976384|ref|YP_002360531.1| protease Do [Methylocella silvestris BL2]
 gi|217501760|gb|ACK49169.1| protease Do [Methylocella silvestris BL2]
          Length = 524

 Score =  199 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 158/505 (31%), Positives = 244/505 (48%), Gaps = 34/505 (6%)

Query: 5   QILSVKSICTVALTCVI----------FSSTYLVLEAKLP-PSSVDLPPVIARVSPSIVS 53
           +++ + ++ T ALT  +           + T   + A+ P  S V    V+  V  ++VS
Sbjct: 24  RVVLLGAVATAALTGALTTGFVSPHSAVAETAAPIAAQAPSASPVSFADVVDHVRDAVVS 83

Query: 54  VMVEPKKKVSVEQM-------FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE 106
           V V+  +                      L    PL+ +F++                  
Sbjct: 84  VKVKITETADASDDDDDNSDSPRPGQIPRLQPGDPLERFFKRFGQPGMPHPGGPGKPH-S 142

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSGF I+ DGY++T+NH+VE     ++   +   L A +VGTD   DLA+LK++ D
Sbjct: 143 AQAQGSGFIISSDGYVVTNNHVVEKATEVTLTTDEGKTLHATVVGTDKKTDLALLKIKED 202

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPI 225
             +  V+F  +   RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   F QIDAP+
Sbjct: 203 GSYPHVKFS-SATPRVGDWVIAVGNPFGLGGTVTAGIVSARGRDIGAGPYDDFLQIDAPV 261

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N+GNSGGP FN LG V+GVN  I +     +G+G  IP    +  I SL  KG V  GW 
Sbjct: 262 NRGNSGGPTFNTLGDVVGVNTAIFSPSGGSVGIGFAIPSETAQSIIASLKDKGAVARGWI 321

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  Q +T E+A  LGL+ +KG+L+      SPA +AG+K GDVI  ++G  +   +D  
Sbjct: 322 GVQIQPVTDEIADSLGLKSSKGALVADAQDNSPAKEAGIKSGDVILGVNGERVDGPRDLA 381

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL----LGMVLQDI 401
            ++A+  P ++  +    +G++ +VAV LGS P  K                LG+ L   
Sbjct: 382 KKVAALGPGKKADLLYWHDGAEKTVAVKLGSLPDEKEAAKPAALQDNSALAGLGLKLAPA 441

Query: 402 ND-GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
           +         +V  + + E     KG++ G  I+      VS   ++  +I  AK+  R 
Sbjct: 442 SSVQGAGNDGVVVADIDPEGSAAQKGLRVGDLILEAGGRAVSKPSEIAAIIADAKKDGRK 501

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSL 485
           +VLL++K        +   +RFV++
Sbjct: 502 AVLLRVK--------SGEGTRFVAV 518


>gi|167720562|ref|ZP_02403798.1| protease, Do family protein [Burkholderia pseudomallei DM98]
 gi|167903632|ref|ZP_02490837.1| protease, Do family protein [Burkholderia pseudomallei NCTC 13177]
 gi|237813199|ref|YP_002897650.1| putative serine protease MucD [Burkholderia pseudomallei MSHR346]
 gi|237504433|gb|ACQ96751.1| putative serine protease MucD [Burkholderia pseudomallei MSHR346]
          Length = 502

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 121/508 (23%), Positives = 219/508 (43%), Gaps = 52/508 (10%)

Query: 12  ICTVALTCVIFSSTYLVLEAK--------------LPPSSVDLPPVIARVSPSIVSVMVE 57
           +   A+T +   +      A                     D   ++ RV P++V++   
Sbjct: 10  LVAAAVTALTPLAAQSATAAPNVTTTPAATGAAPAARAGLPDFADLVERVGPAVVNIRTT 69

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL---------SDTVERL 108
                               ++  +  +FR+ F                     DT +  
Sbjct: 70  ANVPADTRGALPPGL-----DNGDMSEFFRRFFGIPLPQGPGGQKNAPSTPDAPDTEQNR 124

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+A++K+ +   
Sbjct: 125 GVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDERTDVAIVKINASSL 184

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQG 228
              V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+  D    F Q D  +N G
Sbjct: 185 -PTVAIGDSNRVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FIQTDVAVNPG 242

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G   + 
Sbjct: 243 NSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGKVTRGRIAVA 302

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
              +T+E+A  +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D    +
Sbjct: 303 IGEVTKEVADSIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMV 362

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM------HLEVGDKELLGMVLQDIN 402
               P  +  +++ ++G    + + +   P  K           +      LG+ + D++
Sbjct: 363 GDTKPGAKATVTVWRKGQSRDLPITIAEFPADKAAKADSRQTPQQKPRSSALGLTVSDLS 422

Query: 403 DGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKK 458
               K +     +       +      G+Q+G  ++ V   +++  K    +  K   ++
Sbjct: 423 PEQLKTLKLRNGVQIDAV--DGPASRAGLQRGDIVLRVGDVDITSAKQFVDVTSKLDPQR 480

Query: 459 RDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
             +VL++              ++F+ ++
Sbjct: 481 AVAVLVR----------RGENTQFIPIR 498



 Score = 70.2 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 313 SIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKAT 372

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 373 VTV----------WRKGQSRDLPITIAE 390


>gi|85710218|ref|ZP_01041283.1| trypsin-like serine protease [Erythrobacter sp. NAP1]
 gi|85688928|gb|EAQ28932.1| trypsin-like serine protease [Erythrobacter sp. NAP1]
          Length = 511

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 143/528 (27%), Positives = 234/528 (44%), Gaps = 66/528 (12%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEA-------------KLPPSSVDLPPVIARVSPS 50
           R +  + S   V    V   + Y                   +  +      +  ++ P+
Sbjct: 5   RYVYGLTSALLVGGAAVSLMTGYPAGAQVAQNDEAVMDRVVPVEGAPASFADLTQQLQPA 64

Query: 51  IVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMF 110
           +V++      +V+                 P    F +       G         E    
Sbjct: 65  VVNISTRQSIEVNRNPFA----------GTPFAELFNRR-----GGNNGQQPQRREANSL 109

Query: 111 GSGFFITDDGYILTSNHIVEDG-----ASFSVILSDDTELPAKLVGTDALFDLAVLKVQS 165
           GSGF I+ DG+++T+NH+V           +V + D TE  A+LVG DA  DLAVLK+QS
Sbjct: 110 GSGFIISADGFVVTNNHVVSPDNRARLEEITVTMPDGTEYQAELVGADAQSDLAVLKIQS 169

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR--PGTFTQIDA 223
              F  V F D++  RVGE V  IGNPF L GTV++GIVSA+ R+         + Q DA
Sbjct: 170 SETFPFVRFGDSSQTRVGEWVVAIGNPFGLGGTVTSGIVSAVYRNTGQGGAYDRYIQTDA 229

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            IN+GNSGGP F+  G+VIG+N  I +     +G+G  IP  I    +  L     ++ G
Sbjct: 230 SINRGNSGGPLFDMRGNVIGINNAIFSPSGGSVGIGFAIPAEIAAPIVDQLKQGQEIERG 289

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           + G+  + +  +LA  LGL   +G ++  V  +SPA +AG++ GDVI  ++GR + S Q 
Sbjct: 290 YLGVSLEPINDDLADSLGLERNRGEIVQIVTDDSPASRAGLRPGDVIVGVNGREVTSEQS 349

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD------------- 390
             + +A+  P E V + + +EG   +V   L   P+ +                      
Sbjct: 350 VSFIVANIEPGESVPVEVLREGRTITVNATLARRPSEEEIAQQTQTFDPESEEPMDPEAS 409

Query: 391 ----KELLGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTH 439
                E LG+ + D+     + + +       V    +   +   KG+++G  I+S N  
Sbjct: 410 DEMIAEKLGLQVLDLTPQIARSLGVPTETTGLVIGAVDPNSDAGRKGLRRGDIILSANYQ 469

Query: 440 EVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           EV+  + +   I  A+ + RD+VLL+I+            +RF+ +++
Sbjct: 470 EVASTEALREQIAAAESEGRDAVLLRIQR-------RGMPARFLPVRL 510


>gi|212703199|ref|ZP_03311327.1| hypothetical protein DESPIG_01241 [Desulfovibrio piger ATCC 29098]
 gi|212673465|gb|EEB33948.1| hypothetical protein DESPIG_01241 [Desulfovibrio piger ATCC 29098]
          Length = 480

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 140/498 (28%), Positives = 239/498 (47%), Gaps = 39/498 (7%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV-E 65
           + +K      LT V+F++      A LP        + A+  P++V++  E     +   
Sbjct: 1   MRIKHFLPAVLTLVLFTAAQFAQAASLPE----FSELAAKCGPAVVNISAERTSPAAAGP 56

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTS 125
           + F    F  +P          + F  F            +++  GSGF I+ DGYI+T+
Sbjct: 57  EEFFGEMFRGMPPGA------DRFFEFFGGPNARGKRPPQKQMSRGSGFIISPDGYIVTN 110

Query: 126 NHIVEDGASFSV--ILSDDTELP--AKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
            H+V DG S  V    S+    P  A +VGTD   DLA+LKV + +    ++F D++ + 
Sbjct: 111 YHVVADGDSIQVTLDESNGKTAPLTATVVGTDEDTDLALLKVDAKKDLPFLKFGDSDALL 170

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGH 240
           VGE +  IGNPF L  TV+AGI+SA +R+I   P   F Q DA IN GNSGGP  N  G 
Sbjct: 171 VGEWLLAIGNPFALDHTVTAGILSAKNRNIHAGPFDNFLQTDASINPGNSGGPLLNMKGE 230

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIG+N  I+ S     G+G  IP ++    +  +    +V  GW G+  Q++ +  A  L
Sbjct: 231 VIGINTAIIAS---GQGIGFAIPSNMAAGIVEQIKGGKKVSRGWIGVTIQDVDENTAKAL 287

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           G+    G+L+ +V+   PA KAG++ GDVI  ++G+ ++     +  IA+  P   V + 
Sbjct: 288 GMEHPSGALVASVLDGEPAAKAGIEAGDVITKVNGKSVEDASALLRAIAAHKPGTSVTLV 347

Query: 361 LCKEGSKHSVAVVLGSSPTA-----KNDMHLEVGDKELLGMVLQDINDGNKKLV------ 409
           + + G    + V LG   +       ++   +  ++  LG+ ++ I D  ++ +      
Sbjct: 348 VWRNGKAVDLDVTLGDRQSGVNNGKPSEAGQKQQNQGQLGLTVRPIKDEERRELKLEGKG 407

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            ++ L+ +  +     G++ G  IV  N   VS  +D+ +++   +  KR +V+LQI   
Sbjct: 408 GLLVLDVDPSKPAAEAGVRPGDVIVKANRQAVSSPEDLSKIVAG-EGSKRGAVMLQINRR 466

Query: 470 PDMQSGNDNMSRFVSLKI 487
            +        + F ++ +
Sbjct: 467 GE--------NIFRAVPV 476


>gi|117925070|ref|YP_865687.1| protease Do [Magnetococcus sp. MC-1]
 gi|117608826|gb|ABK44281.1| protease Do [Magnetococcus sp. MC-1]
          Length = 489

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 126/499 (25%), Positives = 222/499 (44%), Gaps = 37/499 (7%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
             +   V    ++      + +A       +L P++ R+ P++V++      + S +   
Sbjct: 7   FGARALVGGLSMLALVAVSLPQAYAEGGFPNLVPLVKRLKPAVVNISTTQTVENSNK--I 64

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                 N  E  P ++ FR  F +      P    + +    GSGF +   GYILT++H+
Sbjct: 65  PKKHGQNEFEGTPFEDLFRHFFDR-----LPDQDRSFKTNSLGSGFIVDAAGYILTNHHV 119

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           ++     +V L D+TE  A++VG D   DLA++++ +D+     +  D++   VG  V  
Sbjct: 120 IDKATEITVKLYDETEYRAEVVGKDKKTDLALIRIHTDKPLAVAKLGDSSKAEVGSWVMA 179

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           IGNPF L  TV+ GI+SA  R I   P   F Q DA IN GNSGGP FN  G V+G+N  
Sbjct: 180 IGNPFGLEETVTVGIISAKGRVIGAGPYDNFIQTDAAINPGNSGGPLFNLDGDVVGINTA 239

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I + G   +GVG  IP+++    +  L +KG V+ GW G+  Q +T+ELA  + L+   G
Sbjct: 240 IYSRGGGSVGVGFAIPVNLASHVMEQLKNKGFVERGWLGVRIQTITKELAEAMHLKDRVG 299

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+  V+++SPA KAG+   DVI   + + +         +A+     +V + + +EG +
Sbjct: 300 ALVAEVIEDSPAAKAGIHPEDVIISFNEKEVTKMNSLPAIVANTPVGTRVPVKVIREGKE 359

Query: 368 HSVAVVLGSSPTAKNDMHLE------------VGDKELLGMVLQDINDGNKKLV------ 409
            ++ V +      K     +               KE LG+ +  +     + +      
Sbjct: 360 RTLWVGIAKLDDDKVAADEDGRAASGEKKADSSAVKERLGLRVSQVTTELMERMKLPDDA 419

Query: 410 -RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
             +V      +      G++ G  I   +   +  + D+ +++   K      V +    
Sbjct: 420 KGVVITALEADGSAVQAGLRTGDVITQFDRKPIKDVDDLVKVLKGVKADSMALVYVL--- 476

Query: 469 DPDMQSGNDNMSRFVSLKI 487
                        FV +++
Sbjct: 477 -------RAGEPLFVPIRV 488


>gi|194290157|ref|YP_002006064.1| serine endoprotease [Cupriavidus taiwanensis LMG 19424]
 gi|193223992|emb|CAQ70001.1| serine endoprotease [Cupriavidus taiwanensis LMG 19424]
          Length = 495

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 130/501 (25%), Positives = 218/501 (43%), Gaps = 40/501 (7%)

Query: 1   MFKRQILSVKSICTVA--LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
           M  R     +++   A  L     +       A    +  D   ++ + SP++V++    
Sbjct: 1   MMFRSPALARAVVMAAMMLLGPTVAEVSHAQAAASNYNLPDFTDLVEKASPAVVNIRTTE 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF---------SGEEPILSDTVERLM 109
             +                 D  +  +FR+ F                        +   
Sbjct: 61  LVRQRGAPGS----------DDEMAEFFRRFFGVPMPGAPAPGTPPRRGQPPQQEEQSRG 110

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF I+ DGY++T+ H+V D  +  V L D  E  AKL+G+D   D+A+LKV      
Sbjct: 111 VGSGFIISQDGYVMTNAHVVADAETIYVTLPDKREFKAKLIGSDKRTDVALLKV-EATGL 169

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGN 229
             +   D+N +R GE V  IG+PF L  +V+AGIVSA  RD  D    F Q D  +N GN
Sbjct: 170 PRLPLGDSNKVRAGEWVLAIGSPFGLDNSVTAGIVSAKGRDTGDYLP-FIQTDVAVNPGN 228

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP  N  G VIG+N+ I +    +MG+   IP+    +    L S GRV  G   +  
Sbjct: 229 SGGPLINLRGEVIGINSQIYSRSGGYMGISFAIPIDEAMRVSEQLKSSGRVTRGRIAVAI 288

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
            ++T+E+A  LGL   +G+L+ +V    PA+KAG++ GD+I   +GR I+   D    + 
Sbjct: 289 GDVTKEVADSLGLGRARGALVGSVEPGGPAEKAGIEAGDIILKFNGRDIERASDLPRMVG 348

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-----------KNDMHLEVGDKELLGMVL 398
              P  +V + L ++G+   V++ +                 K+D   + G    LG+V+
Sbjct: 349 ETKPGTRVPLQLWRKGATREVSITVAELEPEGKARARSGAAPKDDSAAQAGKPNALGLVV 408

Query: 399 QDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK 455
            D+ +   K +++   V +    +      GI+ G  I+ +   +V+  +    L+    
Sbjct: 409 SDLPEARLKELKLKSGVEVEV-ADGPALRAGIRPGDIILRLGDTDVTNARQFNDLVRGLD 467

Query: 456 EKKRDSVLLQIKYDPDMQSGN 476
           + +  +V   ++     Q   
Sbjct: 468 KSRIAAVF--VRRGDATQVLT 486



 Score = 65.5 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 36/100 (36%), Gaps = 16/100 (16%)

Query: 396 MVLQDINDGNKKLVRI------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
           + + D+       + +      +  +       E  GI+ G  I+  N  ++    D+ R
Sbjct: 286 VAIGDVTKEVADSLGLGRARGALVGSVEPGGPAEKAGIEAGDIILKFNGRDIERASDLPR 345

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++G+ K   R  + L               +R VS+ + +
Sbjct: 346 MVGETKPGTRVPLQL----------WRKGATREVSITVAE 375


>gi|161525344|ref|YP_001580356.1| protease Do [Burkholderia multivorans ATCC 17616]
 gi|189349919|ref|YP_001945547.1| serine protease [Burkholderia multivorans ATCC 17616]
 gi|160342773|gb|ABX15859.1| protease Do [Burkholderia multivorans ATCC 17616]
 gi|189333941|dbj|BAG43011.1| serine protease [Burkholderia multivorans ATCC 17616]
          Length = 490

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 119/471 (25%), Positives = 217/471 (46%), Gaps = 39/471 (8%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           S  D   ++ +V P++V++                 G     ++  +  +FR+ F     
Sbjct: 35  SLPDFADLVEKVGPAVVNIRTTANV-----PSGPRGGLPPGFDNGDMSEFFRRFFGIPLP 89

Query: 96  GEEPIL---------SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELP 146
                           DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  
Sbjct: 90  QAPGNPKNAPAPDNAPDTEQNRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFK 149

Query: 147 AKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           AKL+G D   D+AV+K+Q+      V   D+N +RVGE V  IG+PF L  TV+AGIVS+
Sbjct: 150 AKLIGVDDRTDVAVVKIQASNL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSS 208

Query: 207 LDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
             R+  D    F Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+  
Sbjct: 209 KSRNTGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDE 267

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
             +    L + G+V  G   +    +T+++A  +GL   +G+L+++V    PADKAG++ 
Sbjct: 268 AMRVADQLKATGKVTRGRIAVAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGVQP 327

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN---- 382
           GD+I   +GR + +  D    +    P  +  +++ ++G    + + +  +P+       
Sbjct: 328 GDIILKFNGRAVDTASDLPRMVGDTKPGTKATVTVWRKGQARDLPITIAETPSDTTAKAD 387

Query: 383 ---DMHLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVS 435
              +   +      LG+ + D++    K +     +       +      G+Q+G  ++ 
Sbjct: 388 PRKNAPQKPRQSNALGLTVSDLSADQLKALKLKNGVQVDGV--DGPAARAGLQRGDIVLR 445

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           V   +++  K    +  +   +K  +VL++            + ++FV ++
Sbjct: 446 VGDTDITSAKQFAEVTSQLDAQKAVAVLVR----------RGDNTQFVPVR 486


>gi|221214093|ref|ZP_03587066.1| putative serine protease MucD [Burkholderia multivorans CGD1]
 gi|221166270|gb|EED98743.1| putative serine protease MucD [Burkholderia multivorans CGD1]
          Length = 490

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 119/471 (25%), Positives = 217/471 (46%), Gaps = 39/471 (8%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           S  D   ++ +V P++V++                 G     ++  +  +FR+ F     
Sbjct: 35  SLPDFADLVEKVGPAVVNIRTTANV-----PSGPRGGLPPGFDNGDMSEFFRRFFGIPLP 89

Query: 96  GEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELP 146
                           DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  
Sbjct: 90  QAPGNPKNAPAPDNPPDTEQNRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFK 149

Query: 147 AKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           AKL+G D   D+AV+K+Q+      V   D+N +RVGE V  IG+PF L  TV+AGIVS+
Sbjct: 150 AKLIGVDDRTDVAVVKIQASNL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSS 208

Query: 207 LDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
             R+  D    F Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+  
Sbjct: 209 KSRNTGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDE 267

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
             +    L + G+V  G   +    +T+++A  +GL   +G+L+++V    PADKAG++ 
Sbjct: 268 AMRVADQLKATGKVTRGRIAVAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGVQP 327

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN---- 382
           GD+I   +GR + +  D    +    P  +  +++ ++G    + + +  +P+       
Sbjct: 328 GDIILKFNGRAVDTASDLPRMVGDTKPGTKATVTVWRKGQARDLPITIAETPSDTTAKAD 387

Query: 383 ---DMHLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVS 435
              +   +      LG+ + D++    K +     +       +      G+Q+G  ++ 
Sbjct: 388 PRKNAPQKPRQSNALGLTVSDLSADQLKALKLKNGVQVDGV--DGPAARAGLQRGDIVLR 445

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           V   +++  K    +  +   +K  +VL++            + ++FV ++
Sbjct: 446 VGDTDITSAKQFAEVTSQLDAQKAVAVLVR----------RGDNTQFVPVR 486


>gi|121605998|ref|YP_983327.1| protease Do [Polaromonas naphthalenivorans CJ2]
 gi|120594967|gb|ABM38406.1| protease Do [Polaromonas naphthalenivorans CJ2]
          Length = 504

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 140/481 (29%), Positives = 225/481 (46%), Gaps = 25/481 (5%)

Query: 19  CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGF----G 74
            +   S   V  A  P +  D   +  R  PS+V++ V    KVS +      G     G
Sbjct: 36  AIAALSAPAVSTAATPMALPDFSQITERYGPSVVNISVTGSTKVSNDSPLAQGGGDDEEG 95

Query: 75  NLPEDHPLKNYFRKD---FHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVED 131
           +     PL   FR+      +          + +     GSGF ++ DG ILT+ H+V  
Sbjct: 96  DPLLGSPLGELFRRFQQGQGQRPGAGRGGAPEEMPTRGQGSGFIVSGDGIILTNAHVVRG 155

Query: 132 GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGN 191
               +V L+D  E  AK++G DA  D+AVLK+ +    +    + + +++VGE V  IG+
Sbjct: 156 AKEVTVKLTDRREFRAKVLGADARTDIAVLKIAASNLPVATLGKTS-DLKVGEWVLAIGS 214

Query: 192 PFRLRGTVSAGIVSALDRDIPDRP-GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           PF    TV+AG+VSA  R +PD     F Q D  IN GNSGGP FNA G V+G+N+ I +
Sbjct: 215 PFGFENTVTAGVVSAKGRSLPDDSAVPFIQTDVAINPGNSGGPLFNARGEVVGINSQIYS 274

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
               + GV   IP+ +  K    +++ G+V+H   G+  Q + Q  A    L   +G+L+
Sbjct: 275 RSGGYQGVSFAIPIDVATKIKNQIVATGKVEHARLGVSVQEVNQAFADSFKLDKPEGALV 334

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           + V K SPADKAG++ GDVI  ++G+ I S  D    I   +P + +K+ + ++G+   +
Sbjct: 335 SMVEKGSPADKAGLQPGDVIRQVNGQPIVSSGDLPAVIGLAAPGDSIKLDVWRQGAAKEI 394

Query: 371 AVVLGSSPT--AKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVA--LNPNREREVEAKG 426
              L ++    A+     E   +  LG+ L+ +    ++   I +  L           G
Sbjct: 395 TARLANADDKAAQVASKKEAPGQGKLGLALRPLQPDEQQEAGIDSGLLVQQASGPAALAG 454

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +Q G  ++S+N   V  I  V   + K+    + SV L I           +   FV + 
Sbjct: 455 VQAGDVLLSINGVPVKSIDQVRATVAKS----QKSVALLILRG--------DTRIFVPVN 502

Query: 487 I 487
           +
Sbjct: 503 L 503


>gi|91785079|ref|YP_560285.1| serine protease [Burkholderia xenovorans LB400]
 gi|91689033|gb|ABE32233.1| Serine protease, subfamily S1C [Burkholderia xenovorans LB400]
          Length = 503

 Score =  198 bits (503), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 128/461 (27%), Positives = 217/461 (47%), Gaps = 24/461 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG---NLPEDHPLKNYFRKDFH--K 92
            D   ++    P++V++  +   K +  +     G G    +    P   +++  F    
Sbjct: 55  PDFSGLVETYGPAVVNISAKYVVKQTALRGNPGNGGGNQLPIDPSDPFYQFYKHFFGGMP 114

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
              G +   +        GSGF +++DGYILT+ H+V+     +V L+D  E  AK+VG 
Sbjct: 115 GMQGGDGGDAPDQPSASLGSGFIVSNDGYILTNAHVVDGANVVTVKLTDKREFRAKVVGA 174

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +P
Sbjct: 175 DKQSDVAVLKIDASNL-PTVKIGDPRQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRSLP 233

Query: 213 DRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
           +   T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K  
Sbjct: 234 NENYTPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVK 293

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             ++  G V  G  G+  Q + Q LA   G++  +G+L+++V    PA K G++ GDVI 
Sbjct: 294 DDIVKTGHVSRGRLGVAVQGMNQTLADSFGMQKPQGALVSSVDPGGPAAKGGLQPGDVIL 353

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD- 390
            ++G  +    D   Q+A  +P     + + ++ +   + V +GS   AK          
Sbjct: 354 SVNGEPVGDSADLPSQVAGLAPGSSATVQVWRDKATKDLKVTIGSLSDAKVASDKADQPT 413

Query: 391 --KELLGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
             +  LG+ ++ +    K    +    L        E+ GIQ G  I++VN   +S +  
Sbjct: 414 QLQGRLGVAVRPLTPEEKSGASVSHGLLVQQSGGAAESAGIQPGDVILAVNGRPISSVDQ 473

Query: 447 VERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           ++++I  A     +S+ L I+ D        N   FV + +
Sbjct: 474 LKQMIASA----GNSIALLIQRD--------NAQIFVPVDL 502


>gi|298290745|ref|YP_003692684.1| protease Do [Starkeya novella DSM 506]
 gi|296927256|gb|ADH88065.1| protease Do [Starkeya novella DSM 506]
          Length = 522

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 148/485 (30%), Positives = 236/485 (48%), Gaps = 30/485 (6%)

Query: 21  IFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDH 80
           + +     L    P  +     ++ +VSP++VSV V  K +  V    +  G  N+P   
Sbjct: 45  VVTPAAAQLSTNQPAGTFSFADIVEKVSPAVVSVKV-KKDEDQVAANDDEDGNQNIPPQ- 102

Query: 81  PLKNYFRKDFHKFFSGEEPILS-------DTVERLMFGSGFFITDDGYILTSNHIVEDGA 133
            ++ + R+          P               +  GSGFFI+ DGY++T+NH+V+  +
Sbjct: 103 -IERFMRRFGFGPGGPGAPGGPGMGPRGGQHRAVVGQGSGFFISADGYVVTNNHVVDGAS 161

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
              V  +D     AK++GTD   D+A+LKV     F  V+       RVG+ V  +GNPF
Sbjct: 162 EVDVTTTDGKSYTAKVIGTDPRTDVALLKVNGKGDFPWVKLAA-KAPRVGDWVVAVGNPF 220

Query: 194 RLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSG 252
            L GTV+AGIVSA  RDI   P   F QIDAPIN+GNSGGP F   G VIGVN  IV+  
Sbjct: 221 GLGGTVTAGIVSARGRDIGSGPYDDFLQIDAPINRGNSGGPTFGLDGEVIGVNTAIVSPS 280

Query: 253 QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA 312
             ++G+   IP   + + + +L + G+V  G+ G+  Q ++ E+A  + L+  +G+LI  
Sbjct: 281 GGNVGIAFAIPSETVSEVVEALKAGGQVARGYVGVQIQPVSDEVAEAMDLKQAEGALIAQ 340

Query: 313 VVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAV 372
           V   +P +KAG+K GD++  +DG +IK  ++   +IA + P   VK+S+ ++G   ++ V
Sbjct: 341 VQPGTPGEKAGLKAGDIVTAIDGEVIKDSREMSREIARKKPGTTVKLSVLRDGKTTTIPV 400

Query: 373 VLGSSPTAKN---------DMHLEVGDKELLGMVLQDIND-GNKKLVRIVALNPNREREV 422
            L   PT            D   +      LG+ L             +V    +     
Sbjct: 401 TLEQLPTETAMAGDKDKGGDTEQQNHGIPRLGLSLAPAKGVAGAGDQGVVITEVDPNGPG 460

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
             +G++ G  I+ V    V    DV   I  AK+  R +VL+++K        ++  +RF
Sbjct: 461 AERGLKSGDVILDVAGKPVMTPADVRDGIAAAKKDNRKAVLMRVK--------SEQGTRF 512

Query: 483 VSLKI 487
           V++ +
Sbjct: 513 VAISL 517


>gi|110833676|ref|YP_692535.1| trypsin-like serine protease [Alcanivorax borkumensis SK2]
 gi|110646787|emb|CAL16263.1| Trypsin-like serine protease [Alcanivorax borkumensis SK2]
          Length = 467

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 138/491 (28%), Positives = 237/491 (48%), Gaps = 36/491 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M  +  LS+  +  +           L        +   L P++ + SP++V++ +E + 
Sbjct: 8   MKNKPSLSLVCVLMLLYLAFSPVHAALPAVTAEGDALPSLAPMLEKTSPAVVNIAIETRV 67

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD-D 119
           + +   + +                    F +FF+  E         +  GSG  +   +
Sbjct: 68  RAARNPLMDDP-----------------FFRRFFNIPEQQRPAERRAVSAGSGVIVDARE 110

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GY+LT+ H+V++  +  V L+D  EL A+LVG D   DLAVLK++   +   +   D+  
Sbjct: 111 GYVLTNAHVVKNADNIEVTLTDGRELSAELVGVDDEVDLAVLKLEDAERLTQIAIADSTG 170

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI--PDRPGTFTQIDAPINQGNSGGPCFNA 237
           +RVG+ V  IGNPF L  TV++GIVSAL R     +   +F Q DA IN GNSGG   N 
Sbjct: 171 LRVGDFVVAIGNPFGLGQTVTSGIVSALGRTGLGIEGYESFIQTDASINPGNSGGALVNL 230

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G ++G+N  I+     ++G+G  IP  + +  +  LI  G V  G  G+  Q+LT ELA
Sbjct: 231 NGELVGINTAILAPAGGNVGIGFAIPTEMAENVMQQLIEHGEVRRGMLGVTIQDLTAELA 290

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
              G+   +G +IT VV++S A+KAG+K GDV+  +DGR +    D   ++      E+V
Sbjct: 291 EAFGVERQRGVVITQVVEDSAAEKAGLKSGDVVTAVDGRPVNRAADLRNKVGMAPVGEKV 350

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKK--LVRIVALN 415
            +S+ +EG+K ++  V+     ++     EV  K L G  L+D+  G  +     ++   
Sbjct: 351 TLSILREGNKRNITAVISEL--SRETAGGEVVSKFLEGANLRDLRKGELQHADTGVLVDE 408

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSG 475
             R       G++KG  I++VN  +V  +  + + +    + K  ++LL++  +  +   
Sbjct: 409 VERGSPAWRAGLRKGDVIINVNRQDVETMDGLRKAV----DDKEAALLLRVNRNGGVF-- 462

Query: 476 NDNMSRFVSLK 486
                 FV ++
Sbjct: 463 ------FVVVR 467


>gi|300022657|ref|YP_003755268.1| protease Do [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524478|gb|ADJ22947.1| protease Do [Hyphomicrobium denitrificans ATCC 51888]
          Length = 530

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 155/519 (29%), Positives = 244/519 (47%), Gaps = 50/519 (9%)

Query: 5   QILSVKSICTVALTCVIFS-------STYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE 57
             +++ ++ T      I S       +    +E  +  + +    +I RV P++VSV V 
Sbjct: 21  SFVALAAVATAGFGYFIPSYTVRADTNAAQTIETPMGRAPLSFADLIERVKPAVVSVSVV 80

Query: 58  -----------PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE 106
                       K     ++    +   +LP DHPL ++F+     F   EE        
Sbjct: 81  NDGGASKLAENKKNDKFDKRGGGNFNMPDLPPDHPLHDFFKNLPKDFGQQEERPKI---- 136

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSV-ILSDDTELPAKLVGTDALFDLAVLKVQS 165
               GSGF I+ DGY++T+NH+++      +   +DDT+  AKLVG D   D+A+LK+ S
Sbjct: 137 VQGQGSGFVISPDGYVVTNNHVIDGATKIVITFDNDDTKYEAKLVGADQRTDVALLKIDS 196

Query: 166 DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPI 225
            + F  V+F      RVG+    +GNPF L GTV+AGIVSAL RDI   P  + QIDA +
Sbjct: 197 TKTFPAVKFST-KAPRVGDWALAVGNPFGLGGTVTAGIVSALARDIGSGPYDYMQIDAAV 255

Query: 226 NQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWF 285
           N+GNSGGP FN  G VIGVN  I +    ++G+   IP   + + +  L + G V  GW 
Sbjct: 256 NRGNSGGPTFNLDGDVIGVNTAIFSPSGGNVGIAFDIPAKTVSEVVTQLKATGTVKRGWL 315

Query: 286 GIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFV 345
           G+  QN+ ++ A  LGL    G+L++ V    PA  AG+K  D I  ++   +   +D  
Sbjct: 316 GVKIQNVDEDTASSLGLNEAHGALVSEVTANGPAAAAGIKTQDAILQVNDSKVADSRDLA 375

Query: 346 WQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP-----------------TAKNDMHLEV 388
            +IA  SP   V I + +  ++  + V LG  P                 + K D     
Sbjct: 376 RKIAELSPDSPVNIKVWRNNAEKVINVKLGLFPKNAEALLSGDNDQNDNNSNKEDSKPAQ 435

Query: 389 GDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
            +   LG+ L     G+ +   +V    +   +   KG++ G  I+ V+   V    DV 
Sbjct: 436 TELSQLGVTLMPARSGSNQE-GVVIAEVDPSSDAAEKGLKAGDVILEVSGETVKTPDDVS 494

Query: 449 RLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
             + KA+  +R +VLL IK        + +  RFV++++
Sbjct: 495 AGVKKAQGLQRKAVLLHIK--------SSDQKRFVAVQL 525


>gi|148555269|ref|YP_001262851.1| protease Do [Sphingomonas wittichii RW1]
 gi|148500459|gb|ABQ68713.1| protease Do [Sphingomonas wittichii RW1]
          Length = 518

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 142/502 (28%), Positives = 229/502 (45%), Gaps = 56/502 (11%)

Query: 23  SSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPL 82
           +   +   A  P + +    + A++ P++V++    K +V         G GN     P 
Sbjct: 34  APGSINATAPRPGAPMSFADLAAKLQPAVVNISTTQKIQVR--------GGGNAFSGTPF 85

Query: 83  KNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG---------A 133
           +  FR+         +     T E    GSGF I+ DGY++T+NH++            +
Sbjct: 86  EELFRRFGG---GQGDDGKPITREATSLGSGFIISPDGYVVTNNHVISASPEGGSGAVVS 142

Query: 134 SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPF 193
           S +V L D  E  A +VG D   DLA+LK+ +      V+F D+   RVG+ V  IGNPF
Sbjct: 143 SITVTLPDRKEYKATIVGRDQTSDLALLKIDAKNL-PFVQFGDSTRTRVGDWVVAIGNPF 201

Query: 194 RLRGTVSAGIVSALDRDIPDR--PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
            L GTV+AGIVSAL R I        + Q DA INQGNSGGP F+  G+VIG+N  I + 
Sbjct: 202 GLGGTVTAGIVSALHRSIGINGPYDRYIQTDASINQGNSGGPMFDLQGNVIGINTAIFSP 261

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
              ++G+G  IP    K  I  L +  RV  G+ G+  Q +T+++A  LGL   +G ++ 
Sbjct: 262 TGGNVGIGFAIPAEEAKPIIDQLRTGQRVRRGYLGVGIQPMTEDIASSLGLPKDRGEIVA 321

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            V     A +AG++ GDVI  +D + I       + +   +   ++ I L +EG + +V 
Sbjct: 322 RVEPGEAAARAGIRQGDVIVRVDNQEITPDNTLSYIVGKAAVGARLPIELIREGQRKTVT 381

Query: 372 VVLGSSPTAK-------------------NDMHLEVGDKELLGMVLQDINDGNKKLVRI- 411
           V LG  P                           +   +  +G+ LQ +     + + + 
Sbjct: 382 VTLGERPPEDQLASAGNLDEDQGDDAPGAAQSAPDQSTRTAIGLGLQTLTPDIARRLGVS 441

Query: 412 ------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                 V    +   +  A G Q    I+ +N   V+ ++     I +A++ KR +VLL 
Sbjct: 442 STLRGVVINYVDPSSDAAANGFQPRDIILQINNVPVATVQAAAAKITEAQKAKRPTVLLF 501

Query: 466 IKYDPDMQSGNDNMSRFVSLKI 487
           ++         +N  R+V ++I
Sbjct: 502 VQRG-------NNPPRYVGVQI 516


>gi|83720925|ref|YP_442261.1| serine protease, MucD [Burkholderia thailandensis E264]
 gi|83654750|gb|ABC38813.1| serine protease, MucD [Burkholderia thailandensis E264]
          Length = 485

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 123/493 (24%), Positives = 221/493 (44%), Gaps = 30/493 (6%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + +    A + V  +               D   ++ RV P++V++              
Sbjct: 4   LAAQSATAASNVTTAPAATGAAPTTRAGLPDFADLVERVGPAVVNIRTTANVPADTRGAL 63

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-----PILSDTVERLMFGSGFFITDDGYIL 123
              G  N       + +F     +   G++     P   DT +    GSGF ++ DGY++
Sbjct: 64  -PPGLDNGDMSEFFRRFFGIPLPQPPGGQKNAPSAPDAPDTEQNRGVGSGFILSPDGYVM 122

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVG 183
           T+ H+V+D  +  V L+D  E  AKL+G D   D+A++K+ +      V   D+N +RVG
Sbjct: 123 TNAHVVDDADTIYVTLTDKREFKAKLIGVDERTDVAIVKINASSL-PTVAIGDSNRVRVG 181

Query: 184 EAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIG 243
           E V  IG+PF L  TV+AGIVSA  R+  D    F Q D  +N GNSGGP  N  G VIG
Sbjct: 182 EWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIG 240

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           +N+ I +     MG+   IP+    +    L + G+V  G   +    +T+E+A  +GL 
Sbjct: 241 INSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGKVTRGRIAVAIGEVTKEVADSIGLP 300

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
             +G+L+++V    PADKAG++ GD+I   +GR +++  D    +    P  +  +++ +
Sbjct: 301 KAEGALVSSVESGGPADKAGLQPGDIILKFNGRSVETASDLPRMVGDTKPGTKATVTVWR 360

Query: 364 EGSKHSVAVVLGSSPTAK------NDMHLEVGDKELLGMVLQDINDGNKKLV----RIVA 413
           +G    + + +   P  K           +      LG+ + D++    K +     +  
Sbjct: 361 KGQSRDLPITIAEFPADKIAKASSRQAPQQKPRSSALGLAVSDLSPEQLKTLKLRNGVQI 420

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
                +      G+Q+G  ++ V   ++S  K    +  K   ++  +VL++        
Sbjct: 421 DAV--DGPAARAGLQRGDIVLRVGDVDISSAKQFVDVTSKLDPQRAVAVLVR-------- 470

Query: 474 SGNDNMSRFVSLK 486
               + ++F+ ++
Sbjct: 471 --RGDNTQFIPIR 481



 Score = 70.9 bits (171), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 33/88 (37%), Gaps = 2/88 (2%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 296 SIGLPKAEGALVSSVESGGPADKAGLQPGDIILKFNGRSVETASDLPRMVGDTKPGTKAT 355

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V   +      +     ++ F + KI K
Sbjct: 356 V--TVWRKGQSRDLPITIAEFPADKIAK 381


>gi|224825218|ref|ZP_03698324.1| protease Do [Lutiella nitroferrum 2002]
 gi|224602889|gb|EEG09066.1| protease Do [Lutiella nitroferrum 2002]
          Length = 473

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 132/497 (26%), Positives = 227/497 (45%), Gaps = 47/497 (9%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
           K I +  L  V+ S      EA++ P   D   ++ +   ++V++      + ++  +  
Sbjct: 5   KLIASAMLAAVVVSGPVYAAEARVLP---DFTQIVEQEGKAVVNISTTQTVRETINAVPE 61

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
            +         P   +FR+          P      +    GSGF ++ DGY++T++H+V
Sbjct: 62  EF------NGDPFFEFFRRF--------APPQQQERKERSLGSGFIVSADGYVMTNSHVV 107

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
                 +V L D     A+LVG+DA  D+A+LK+ +           + N++VGE V  I
Sbjct: 108 ARADEITVTLGDKRTFKARLVGSDARTDVALLKINASHL-PVAHIGSSANLKVGEWVLAI 166

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           G+PF    +V++GIVSA  R +PD     F Q DA +N GNSGGP FN  G V+G+N+ I
Sbjct: 167 GSPFGFENSVTSGIVSAKGRSLPDENYVPFIQTDAAVNPGNSGGPLFNLKGEVVGINSQI 226

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     MG+   IP+ +  K    L S+G+V  G  G+  Q L+ ELA   GL    G+
Sbjct: 227 YSRSGGFMGISFAIPIDVAVKVADQLKSEGKVSRGRIGVAIQELSPELAASFGLASPNGA 286

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           LI +V K+ PADKAG++ GD++  +DG+ ++S  D    I +  P + V + + +  ++ 
Sbjct: 287 LINSVEKDGPADKAGLRAGDIVLKIDGQPVESSADMPRLIGAMRPGKPVAVEVWRNRARR 346

Query: 369 SVAVVLGSSPTA------------KNDMHLEVGDKELLGMVLQDINDGNKKLVRI----V 412
            V VVL                  +     +  +   +G+ L ++     K + I    +
Sbjct: 347 VVTVVLAELKDEAPSIAEREFRQPQKPAEPQGENLSAIGLSLVELTPAQLKRLGIDYGLL 406

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
                     E  G+  G  IV V +  +   + +   +  A++    +V LQ+      
Sbjct: 407 VRKV--SGPAERVGMAAGDVIVGVGSEPLKNPRQLREALNAARKGG--TVALQVLRR--- 459

Query: 473 QSGNDNMSRFVSLKIDK 489
                 ++ FV L +++
Sbjct: 460 -----GVTLFVPLTVEE 471


>gi|226940143|ref|YP_002795216.1| HtrA [Laribacter hongkongensis HLHK9]
 gi|226715069|gb|ACO74207.1| HtrA [Laribacter hongkongensis HLHK9]
          Length = 497

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 142/476 (29%), Positives = 222/476 (46%), Gaps = 36/476 (7%)

Query: 26  YLVLEAKLPPSS-VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKN 84
            +V +   P     D   ++ +  P++V++     +               +PED PL  
Sbjct: 42  PVVQQTPAPGMLLADFTSLVEQEGPAVVNIAATRPESAGNPSPLPFP----IPEDDPLFE 97

Query: 85  YFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTE 144
           +F++        +EP  SD    + +GSGF ++ DG++LT+ H+V+      V L+D  E
Sbjct: 98  FFKRFMPPGGGNQEPEESD---SISYGSGFIVSPDGFVLTNAHVVQGAQQIQVKLTDKRE 154

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
           + AKLVG D   D+A+LK+ +      V+  D N ++VGE V  IG PF    TV+AGIV
Sbjct: 155 VRAKLVGLDRRTDVALLKIDAASL-PTVKIGDPNTLKVGEWVAAIGAPFGFDNTVTAGIV 213

Query: 205 SALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           SA  R +PD     F Q D  IN GNSGGP FN  G V+G+N+ I +     MG+   IP
Sbjct: 214 SAKGRSLPDDTFVPFIQTDVAINPGNSGGPLFNLKGQVVGINSQIYSRSGGFMGISFAIP 273

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
           + I       L + GRV  G  G+  Q L+QELA   GL    G+L+  V   SPA KAG
Sbjct: 274 IDIAMSVAEQLKANGRVSRGQLGVHIQELSQELARSFGLSTAAGALVVRVEPGSPAAKAG 333

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH--------SVAVVLG 375
           ++ GD+I  LDGR ++S  D    +    P   VK+ + ++G +                
Sbjct: 334 LQPGDIILNLDGRKVQSSTDLPMMVGQMKPGTTVKLGVWRKGKEVTLDATLAEMRNPGTE 393

Query: 376 SSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI----VALNPNREREVEAKGIQKGM 431
            +P  K    +     + LG+ L +++   +K + +    +             G+  G 
Sbjct: 394 EAPQQKAPSQIPSTTFDKLGLTLSELSASQRKELGVQSGLLVDKV--GGPAAKSGLMHGD 451

Query: 432 TIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            I+ VN   VS I++  +LI  A      +V L +K          + + +V L++
Sbjct: 452 IILGVNQSPVSNIEEFRKLIDAA----GSNVALLVKRM--------DNTLYVPLRL 495


>gi|83745713|ref|ZP_00942771.1| Protease Do [Ralstonia solanacearum UW551]
 gi|207738716|ref|YP_002257109.1| protease protein [Ralstonia solanacearum IPO1609]
 gi|83727790|gb|EAP74910.1| Protease Do [Ralstonia solanacearum UW551]
 gi|206592084|emb|CAQ58990.1| protease protein [Ralstonia solanacearum IPO1609]
          Length = 490

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 137/511 (26%), Positives = 225/511 (44%), Gaps = 47/511 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYL---------------------VLEAKLPPSSVDL 40
             RQ ++  ++   A+  V     YL                        A    + +D 
Sbjct: 1   MTRQTMARSAVGLAAVLAVAGGYAYLQKDVISRAVAAPTAASATAPASTAAVAVAAPMDF 60

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
             ++ R  P++V++      + +  Q         +  D P   +F+         + P 
Sbjct: 61  SGIVERYGPAVVNISTTAHAQRTSLQGLP----PGMSPDDPFAEFFKHFM-----PQMPQ 111

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++G D   D+AV
Sbjct: 112 QQGDQVVKGLGSGFIVSSDGLILTNAHVVDGAQEVNVKLTDRREFKAKVLGVDKQSDVAV 171

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFT 219
           L++ +      V+  +    +VGE V  IG+P+    TV+AGIVSA  R +PD     F 
Sbjct: 172 LRIAAGNL-PTVQIGNPAGTKVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYVPFI 230

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   +P+ +  K    L++ G+
Sbjct: 231 QTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAVPIDVAMKVEQQLVATGK 290

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  G  GI  Q + Q LA    L   +G+L+ AV K+ PA KAG++ GDVI  +    I 
Sbjct: 291 VTRGRLGISVQEVDQSLADSFNLPKPEGALVNAVEKDGPAAKAGLQPGDVILQIGNAHIG 350

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-DKELLGMVL 398
              D   Q+A   P   V + + ++G   +++V +G +  AK   +     DK  LG+ +
Sbjct: 351 HSGDLPEQVAEIKPGTTVPLQIIRQGRPATLSVTVGEAKDAKVAANASAAPDKGRLGLAV 410

Query: 399 QDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           + +    K+   +       +        GIQ G  I+S+N   VS  +++  L+ +A  
Sbjct: 411 RPLQPEEKRQSGLPGGLVVMDSSGPAAKAGIQPGDVILSLNGTPVSSAQELRTLVDRA-- 468

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
                V L ++ D        +   FV L +
Sbjct: 469 --GKHVALLVQRD--------DAKIFVPLDL 489


>gi|13471471|ref|NP_103037.1| serine protease [Mesorhizobium loti MAFF303099]
 gi|14022213|dbj|BAB48823.1| probable serine protease [Mesorhizobium loti MAFF303099]
          Length = 504

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 152/511 (29%), Positives = 230/511 (45%), Gaps = 36/511 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             R         T AL     ++   V           +  +   V  ++V++      K
Sbjct: 6   LLRAARRTLIAGTAALLVGTVAAPSFVTPVFAADGPASVADLAQGVLGAVVNISTSQTVK 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDD-G 120
               +   A     LPE  P +++F   F      ++       +    GSGF I  + G
Sbjct: 66  --GTEGPGAVPMPQLPEGSPFQDFFDDFFKNRGGDKDNSGQ---KVQSLGSGFVIDAEQG 120

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD-RKFIPVEFEDANN 179
            ++T+NH++ D     V  SD   L A LVGTD   D+AVLKV     K   V+F D+  
Sbjct: 121 IVVTNNHVIADADDIEVNFSDGVTLKATLVGTDTKTDVAVLKVDPKGHKLTAVKFGDSTK 180

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNAL 238
           +RVG+ V  +GNPF L GTV+ GIVSA +RDI   P   F Q DA IN+GNSGGP FN+ 
Sbjct: 181 MRVGDWVMAVGNPFGLGGTVTVGIVSARNRDINSGPYDDFIQTDAAINRGNSGGPLFNSA 240

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G VIG+N  I++     +G+G  IP  +    +  L   G    GW G+  Q +T ++A 
Sbjct: 241 GEVIGINTAIISPSGGSIGIGFSIPSQLASGVVDQLRQFGETRRGWLGVRIQPVTDDIAE 300

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
            LG+   KG+L+  V+K  P D   ++ GDVI   DG+ I   +D    +A     + V 
Sbjct: 301 SLGMATAKGALVAGVIKGGPVDNGTIQAGDVIIKFDGKDIHEMRDLPRVVAESPVGKAVD 360

Query: 359 ISLCKEGSKHSVAVVLGSSPT--------------AKNDMHLEVGDKELLGMVLQDINDG 404
           + + ++G + +V V LG                   K +    V    +LGM + ++ND 
Sbjct: 361 VLIVRKGVEQTVKVTLGRLEDGEKLASGGNGNTDQDKGNKAPAVSTASVLGMTVGELNDE 420

Query: 405 NKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK 457
            +K          +V  +  ++     +GIQ G  I  +    V+  KDV   IG  KE+
Sbjct: 421 TRKKFSIAADVSGVVITDVAKDSAAAERGIQPGEVITEIAQESVATPKDVMDRIGALKEQ 480

Query: 458 KRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            R + LL       M +      RFV++++D
Sbjct: 481 GRKNALL-------MLASKTGELRFVTIRMD 504


>gi|316933233|ref|YP_004108215.1| protease Do [Rhodopseudomonas palustris DX-1]
 gi|315600947|gb|ADU43482.1| protease Do [Rhodopseudomonas palustris DX-1]
          Length = 500

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 135/505 (26%), Positives = 229/505 (45%), Gaps = 33/505 (6%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           + + L ++ +       V   +      A+ P     +  V  +V  ++V++      + 
Sbjct: 10  RIRPLRIRPLLAALCLGVAVFAGPAPASARGPEG---IADVAEKVIDAVVNISTTQTVEA 66

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
                        LP   P + +F   F      +        +    GSGF I   G  
Sbjct: 67  KGSGESKGAT-PQLPPGSPFEEFFEDFFKNRRGDKGGGP---RKTNSLGSGFIIDAAGVA 122

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD--RKFIPVEFEDANNI 180
           +T+NH++ D    +VIL+D T++ A+LVG D   DLAVLK +    +    V+F D++ +
Sbjct: 123 VTNNHVIADSDEINVILNDGTKIRAELVGVDKKTDLAVLKFKPPAGKTLTAVKFGDSDKL 182

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
           R+GE V  IGNPF L GTV+AGIVSA +RDI   P   + Q DA IN+GNSGGP FN  G
Sbjct: 183 RLGEWVVAIGNPFSLGGTVTAGIVSARNRDINSGPYDSYIQTDAAINRGNSGGPLFNLAG 242

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+GVN +I++     +G+G  +P   +   +  L   G +  GW G+  Q +T E+A  
Sbjct: 243 EVVGVNTLIISPSGGSIGIGFAVPSKTVVPVVDQLRQFGELRRGWLGVRIQQVTDEIAES 302

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           L ++  +G+L+  +  + PA  AG++ GDV+   DG+ IK  +D    +A  +  + V +
Sbjct: 303 LSIKPARGALVAGIDDKGPAKPAGIEPGDVVVKFDGKDIKEPKDLSRIVADTAVGKTVDV 362

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE---------LLGMVLQDINDGNKKLV- 409
            + ++G + +  V LG               +          +LG+ L  ++   +    
Sbjct: 363 VVIRKGKEETRQVTLGRLDDDAKPQPASAKSQPEAEKPVTQKVLGLDLAALSKDLRGRYK 422

Query: 410 ------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
                  ++    +   +   K +  G  IV V    V    D+++ + + K+  + SVL
Sbjct: 423 IKDSVKGVLVTGVDDGSDAAEKRLSAGDVIVEVAQESVGSAADIKKRVDQLKKDGKKSVL 482

Query: 464 LQIKYDPDMQSGNDNMSRFVSLKID 488
           L +       +      RFV+L + 
Sbjct: 483 LLV-------ANASGELRFVALSLQ 500


>gi|207722473|ref|YP_002252909.1| protease protein [Ralstonia solanacearum MolK2]
 gi|206587653|emb|CAQ18235.1| protease protein [Ralstonia solanacearum MolK2]
          Length = 490

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 137/511 (26%), Positives = 225/511 (44%), Gaps = 47/511 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYL---------------------VLEAKLPPSSVDL 40
             RQ ++  ++   A+  V     YL                        A    + +D 
Sbjct: 1   MTRQTMTRSAVGLAAVLAVAGGYAYLQKDVISRAVAAPTAASATAPASTAAVAVAAPMDF 60

Query: 41  PPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPI 100
             ++ R  P++V++      + +  Q         +  D P   +F+         + P 
Sbjct: 61  SGIVERYGPAVVNISTTAHAQRTSLQGLP----PGMSPDDPFAEFFKHFM-----PQMPQ 111

Query: 101 LSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAV 160
                     GSGF ++ DG ILT+ H+V+     +V L+D  E  AK++G D   D+AV
Sbjct: 112 QQGDQVVKGLGSGFIVSSDGLILTNAHVVDGAQEVNVKLTDRREFKAKVLGVDKQSDVAV 171

Query: 161 LKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFT 219
           L++ +      V+  +    +VGE V  IG+P+    TV+AGIVSA  R +PD     F 
Sbjct: 172 LRIAAGNL-PTVQIGNPAGTKVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDTYVPFI 230

Query: 220 QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGR 279
           Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   +P+ +  K    L++ G+
Sbjct: 231 QTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAVPIDVAMKVEQQLVATGK 290

Query: 280 VDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIK 339
           V  G  GI  Q + Q LA    L   +G+L+ AV K+ PA KAG++ GDVI  +    I 
Sbjct: 291 VTRGRLGISVQEVDQSLADSFNLPKPEGALVNAVEKDGPAAKAGLQPGDVILQIGNAHIG 350

Query: 340 SHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-DKELLGMVL 398
              D   Q+A   P   V + + ++G   +++V +G +  AK   +     DK  LG+ +
Sbjct: 351 HSGDLPEQVAEIKPGTTVPLQIIRQGRPTTLSVTVGEAKDAKVAANASAAPDKGRLGLAV 410

Query: 399 QDINDGNKKLVRIVALNPNRER--EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
           + +    K+   +       +        GIQ G  I+S+N   VS  +++  L+ +A  
Sbjct: 411 RPLQPEEKRQSGLPGGLVVMDSSGPAAKAGIQPGDVILSLNGTPVSSAQELRTLVDRA-- 468

Query: 457 KKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
                V L ++ D        +   FV L +
Sbjct: 469 --GKHVALLVQRD--------DAKIFVPLDL 489


>gi|85375095|ref|YP_459157.1| trypsin-like serine protease [Erythrobacter litoralis HTCC2594]
 gi|84788178|gb|ABC64360.1| trypsin-like serine protease [Erythrobacter litoralis HTCC2594]
          Length = 510

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 134/511 (26%), Positives = 231/511 (45%), Gaps = 59/511 (11%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAK-----------LPPSSVDLPPVIARVSPSIVSVM 55
           L+   +   A   ++         A+              +      +  ++ P++V++ 
Sbjct: 10  LTSALLVGGATVSLLTGQPAGAQVAQNDDRVMSNVVPRAGAPESFAELTEQLQPAVVNIS 69

Query: 56  VEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFF 115
              + +V     F         +  P  + F +         +P    T E    GSGFF
Sbjct: 70  TRQRIEVQNRNPF---------QGTPFADLFNR-------RGQPQQPQTREAQSLGSGFF 113

Query: 116 ITDDGYILTSNHIVED-----GASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           I+ DGY++T+NH+V           +V L D  E  A+LVG DA  DLAVLKV     F 
Sbjct: 114 ISADGYVVTNNHVVAPNGRGTVEEITVTLPDGREYAAELVGADAASDLAVLKVSRSEPFP 173

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGN 229
            V F D++  R G+ V  IGNPF L GTV++GIVSA  R+        + Q DA IN+GN
Sbjct: 174 FVRFGDSSQARAGDWVIAIGNPFGLGGTVTSGIVSAQLRNTGGGAYDRYIQTDASINRGN 233

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F+  G+VIG+N  I +     +G+G  IP       +  L     ++ G+ G+  
Sbjct: 234 SGGPLFDMQGNVIGINNAIFSPSGGSVGIGFAIPAETAAPIVAQLQRGNAIERGYLGVQI 293

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           Q +++++A  LGL   +G ++  VV    AD++G++ GDV+  +DG+ +   Q   + IA
Sbjct: 294 QQVSEDVADSLGLPKNRGEIVQTVVDGEAADRSGIRAGDVVLKIDGKDVTPDQTLSFLIA 353

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE----------------- 392
           + SP   V + + +EGS+ ++ V +G  P+ +     ++  ++                 
Sbjct: 354 NISPGTTVPVEVFREGSRRTLNVTVGKRPSEEELRQSQIFSQDEDEDPDAAPEMDDSEML 413

Query: 393 --LLGMVLQDINDGNKKLVRIV-------ALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
              LG+ +  +     + + +            +   +   KG+++   I+S N   V  
Sbjct: 414 ADKLGLGVIPVTPEIARQLGVAADTRGLAIAVVDPNSDAARKGLRRRDIILSANYEPVES 473

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           ++D+E ++ +A+E  R SVLL+ +       
Sbjct: 474 VEDLEAIVQQAEEAGRSSVLLRFRRGGQTAF 504


>gi|116748427|ref|YP_845114.1| protease Do [Syntrophobacter fumaroxidans MPOB]
 gi|116697491|gb|ABK16679.1| protease Do [Syntrophobacter fumaroxidans MPOB]
          Length = 485

 Score =  198 bits (501), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 145/492 (29%), Positives = 224/492 (45%), Gaps = 33/492 (6%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           R I     +  +    ++  S      A           +  +V  ++V++      K S
Sbjct: 14  RWIRLFTFVVALPCFLLLSQSIPSAHGAAWQQGPPSFADLAEQVKHAVVNISTTQVLKES 73

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYIL 123
             Q F          + P +++F  DF K F GE+P      +    GSGF I   G IL
Sbjct: 74  PMQQFMG-------PNSPFRDFFDDDFMKRFFGEQPQGQ--RKGHALGSGFIIDQSGLIL 124

Query: 124 TSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEF-EDANNIRV 182
           T+NH+VE      +      E  AK+VG D+  D+A++KV  D  F       +++ IRV
Sbjct: 125 TNNHVVEKADEIKIKTLSGKEYDAKVVGRDSKTDIALIKVTPDTDFPKPAQLGNSDAIRV 184

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHV 241
           G+ V  +GNPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FN    V
Sbjct: 185 GDWVMAVGNPFALGHTVTAGIISAKGRVIGAGPYDDFLQTDAAINPGNSGGPLFNMNAEV 244

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  IV  GQ             + K I   +  G+V  GW G+M Q++T ELA   G
Sbjct: 245 VGLNTAIVAHGQGI----GFATPINVAKDILEQLKSGKVVRGWLGVMIQDITPELAESFG 300

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           ++ TKG ++  VV ++PA+ AG+K GDVI  ++G+ I +       I   +P   + + +
Sbjct: 301 IKETKGVIVADVVPDAPAEAAGIKRGDVITSVNGKEIDNAPALSRYIGFSAPGTPLSLQI 360

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVR-------IVAL 414
            ++G   S+ V  G+ P    +  +E  +  L GMV+Q+I     +          +V  
Sbjct: 361 IRDGKPMSIKVSSGTMPDEGKEAKVEKKES-LWGMVVQNITPEIAQRFGWDENERGVVIT 419

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
                       ++ G  I  VN  ++  I+D  + +   K ++  ++LL +K   +   
Sbjct: 420 EVKPGSPAGEARLRPGDLIKEVNRQKIQNIRDYNQAVQ--KPQRGQTMLLLVKRGKNTF- 476

Query: 475 GNDNMSRFVSLK 486
                  FVSLK
Sbjct: 477 -------FVSLK 481


>gi|187925238|ref|YP_001896880.1| protease Do [Burkholderia phytofirmans PsJN]
 gi|187716432|gb|ACD17656.1| protease Do [Burkholderia phytofirmans PsJN]
          Length = 504

 Score =  198 bits (501), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 128/462 (27%), Positives = 216/462 (46%), Gaps = 25/462 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG----NLPEDHPLKNYFRKDFH-- 91
            D   ++    P++V++  +   K +  +     G G     +    P   +++  F   
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKQTALRGNPGNGNGGNQLPIDPSDPFYQFYKHFFGGM 114

Query: 92  KFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVG 151
               G +   +        GSGF ++ DGYILT+ H+V+     +V L+D  E  AK+VG
Sbjct: 115 PGMQGGDGGDAPDQPSASLGSGFIVSSDGYILTNAHVVDGANVVTVKLTDKREFKAKVVG 174

Query: 152 TDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI 211
            D   D+AVLK+ +      V+  D    +VG+ V  IG+P+    TV++GI+SA  R +
Sbjct: 175 ADKQSDVAVLKIDASNL-PTVKIGDPRQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRSL 233

Query: 212 PDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKA 270
           P+   T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K 
Sbjct: 234 PNENYTPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKV 293

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
              ++  G V  G  G+  Q + Q LA   G++  +G+L+++V    PA K G++ GDVI
Sbjct: 294 KDDIVKTGHVSRGRLGVAVQGMNQTLANSFGMQKPQGALVSSVDPGGPAAKGGLQPGDVI 353

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD 390
             ++G  +    D   Q+A  +P     + + ++ +   + V +GS   AK         
Sbjct: 354 LSVNGEPVGDSADLPAQVAGLAPGTSATVQVWRDKATKDLKVTIGSLSDAKVASDKADQP 413

Query: 391 ---KELLGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIK 445
              +  LG+ ++ +    K    +    L        E+ GIQ G  I++VN   +S + 
Sbjct: 414 TQLQGRLGVAVRPLTPEEKSGASVSHGLLVQQSGGAAESAGIQPGDVILAVNGRPISSVD 473

Query: 446 DVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            ++++I  A     +S+ L I+ D        N   FV + +
Sbjct: 474 QLKQMIAGA----GNSIALLIQRD--------NAQIFVPVDL 503


>gi|94311358|ref|YP_584568.1| peptidase S1C, Do [Cupriavidus metallidurans CH34]
 gi|93355210|gb|ABF09299.1| Trypsin-like serine protease, typically periplasmic, contains
           C-terminal PDZ domain [Cupriavidus metallidurans CH34]
          Length = 501

 Score =  198 bits (501), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 129/514 (25%), Positives = 221/514 (42%), Gaps = 46/514 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYL--VLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
           M  R     + +  VA+     + + L     A    +  D   ++ +VSP++V++    
Sbjct: 1   MISRSPALARVVVMVAMLVFGPAVSELGHAQAAAQNYNLPDFTDLVEKVSPAVVNIRTTE 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE------------ 106
           + +            GN P+D  +  +FR+ F     G                      
Sbjct: 61  RVRSR---------GGNSPDDDEMAEFFRRFFGVPMPGTPGQPRRGQPPQGQGQSQGQGE 111

Query: 107 --RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
                 GSGF I+ DGY++T+ H+V +  +  V L D  E  AKL+G D   D+A+LK+ 
Sbjct: 112 EMSRGVGSGFIISQDGYVMTNAHVVAEADTIYVTLPDKREFKAKLIGADKRTDVALLKI- 170

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAP 224
                  +   D++ +R GE V  IG+PF L  +V+AGIVSA  RD  D      Q D  
Sbjct: 171 DATGLPRLPLGDSDKVRTGEWVLAIGSPFGLDSSVTAGIVSAKARDTGDYLP-LIQTDVA 229

Query: 225 INQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           +N GNSGGP  N  G VIG+N+ I +    +MG+    P+    +    L + G+V  G 
Sbjct: 230 VNPGNSGGPLINLRGEVIGINSQIYSRSGGYMGISFATPIDEAMRVTEQLKATGKVTRGR 289

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
             +   ++T+E+A  LGL  T+G+L+ +V    PA+KAG++ GD+I   +GR I+   D 
Sbjct: 290 IAVAIGDVTKEVADSLGLGRTRGALVGSVEPGGPAEKAGIEAGDIILKYNGRDIEKAADL 349

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK------------- 391
              +    P  +V + + ++G    V + +              GDK             
Sbjct: 350 PRMVGDTKPGTRVPMQVWRKGQTREVMITVAELEPDTPRATPRRGDKRGGGNEEAPAPKP 409

Query: 392 ELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDV 447
             LG+++ DI +   + +     +       +      GI+ G  I+ +   +V+  +  
Sbjct: 410 NALGLIVNDIPEARMRELKLKSGVEVDTV--DGPAARAGIRPGDIILRLGDTDVTSARQF 467

Query: 448 ERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSR 481
             L+    + K  +V ++      + +   N +R
Sbjct: 468 NDLVKGLDKNKMAAVFVRRGDATQVLTLRPNQTR 501


>gi|319898566|ref|YP_004158659.1| serine protease [Bartonella clarridgeiae 73]
 gi|319402530|emb|CBI76073.1| serine protease [Bartonella clarridgeiae 73]
          Length = 501

 Score =  198 bits (501), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 177/507 (34%), Positives = 271/507 (53%), Gaps = 34/507 (6%)

Query: 4   RQILSVKSICTVALTCVIFS------STYLVLEAKLPP-SSVDLPPVIARVSPSIVSVMV 56
           R +L+  S      + + FS      +T       +P         V+++V P++VSV V
Sbjct: 7   RTMLTTVSCSVFLASTMFFSGSNFWVTTTNANPVFVPSVQQQGFADVVSKVKPAVVSVQV 66

Query: 57  EPKKKVSVE---QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP-ILSDTVERLMFGS 112
           +   K         F++ G   LP+ HPLK +F+  ++      +P   S     + FGS
Sbjct: 67  KSNAKKEERFFSNFFSSPGIDQLPDQHPLKRFFKDFYNHTLPNNKPLNRSRKFRPIAFGS 126

Query: 113 GFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
           GFFI+ DGYI+T++H++ DG S+S+IL D  EL AKL+G D   DLAVLKV   RKF  V
Sbjct: 127 GFFISSDGYIVTNHHVIADGTSYSIILDDGAELEAKLIGADPRTDLAVLKVNDKRKFPYV 186

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR-PGTFTQIDAPINQGNSG 231
           +F D + I VG+ V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNSG
Sbjct: 187 DFADDSTIHVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGVYDDFIQIDAAVNRGNSG 246

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP FN  G V+G+N  I +    ++G+   IP +  K+ +  L+ KG V  GW G+  Q 
Sbjct: 247 GPTFNLNGQVVGINTAIFSPSGGNVGIAFAIPSATAKQVVKQLMEKGSVRRGWIGVQIQP 306

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +T+E++  +GL+  KG+LIT  +K  PA KAG+K GDVI  ++G  I   +D   +IA+ 
Sbjct: 307 VTKEISDSIGLKEAKGALITDPLK-GPAAKAGIKAGDVIIAVNGEKINDARDLAKRIANT 365

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE---------LLGMVLQDIN 402
           +P E V + + + G + S+ V L + P  +          E           G+++   +
Sbjct: 366 TPGETVTLGIWRSGKEESIKVKLDTMPADEGKRETSKYSSEHGNLDETLEDYGLIVAPSD 425

Query: 403 DGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSV 462
           D     V +V  + + + +   +GI+ G  IV+VN   V    D+   I  AK+  R+++
Sbjct: 426 D----GVGLVVTDVDSDADAADRGIRSGDVIVTVNNRSVKKASDIIDAIKDAKKLGRNAI 481

Query: 463 LLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           LLQ++         ++ +RF++L I K
Sbjct: 482 LLQVR--------TNDQNRFIALPILK 500


>gi|257093148|ref|YP_003166789.1| protease Do [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045672|gb|ACV34860.1| protease Do [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 479

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 124/485 (25%), Positives = 224/485 (46%), Gaps = 32/485 (6%)

Query: 17  LTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNL 76
           L  V+F + + +L         D   ++ +  P++V++      + +     +       
Sbjct: 4   LLAVVFFTCFSLLANAQTRGLPDFTELVEKQGPAVVNISTTQSARGNGRGAQSLP----F 59

Query: 77  PEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFS 136
            E+ P+  +FR+   +             E    GSGF ++ DGYILT+ H+VE      
Sbjct: 60  DENDPMYEFFRRFVPRQPGVPGFGQPREFESRSLGSGFIVSPDGYILTNAHVVESADEIL 119

Query: 137 VILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLR 196
           + L+D  E  A+++G D   D+A++K+        V   D + ++VGE V  IG+PF   
Sbjct: 120 IRLTDKREFKARVIGADKRTDVALIKI-EATALPTVRLGDPSVLKVGEWVIAIGSPFGFD 178

Query: 197 GTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFH 255
            +V+AGIVSA  R +P      F Q D  +N GNSGGP FN  G V+G+N+ I +     
Sbjct: 179 NSVTAGIVSAKGRSLPQENYVPFIQTDVAVNPGNSGGPLFNMKGEVVGINSQIYSRSGGF 238

Query: 256 MGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVK 315
           MG+   IP+ +       L + G+V  G  G++ Q+LT++LA   GL   +G+++ AV K
Sbjct: 239 MGISFAIPIDVAMDVQTQLRATGKVSRGRIGVVIQDLTKDLAESFGLSKAQGAVVNAVEK 298

Query: 316 ESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLG 375
             PA+KAG++ GDVI   DG+ I    D    + +  P  +V + + ++G+   +A+V+ 
Sbjct: 299 GGPAEKAGIEPGDVILKFDGKAITGSGDLPRMVGATRPGARVTVQVWRKGTTKDLALVVA 358

Query: 376 SSPTAKNDMHLEVGDKE------LLGMVLQDINDGNKKLV----RIVALNPNREREVEAK 425
             P  K         K        LG+V+ ++    K+ +     +V             
Sbjct: 359 EIPDEKLAAGSSRAAKPVEKVANRLGLVVSELTAEQKRELKVNGGLVIQEVRSNS--ARA 416

Query: 426 GIQKGMTIVSV----NTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSR 481
            ++ G  I+++     + E+  ++    L+ +  +    ++L++            ++  
Sbjct: 417 DLRPGDVILALFARGESTEIRSVQQFNSLLAQFDKAANVTLLVR----------RGDVQT 466

Query: 482 FVSLK 486
           FV++K
Sbjct: 467 FVTVK 471


>gi|86356762|ref|YP_468654.1| serine protease DO-like protein [Rhizobium etli CFN 42]
 gi|86280864|gb|ABC89927.1| serine protease DO-like protein [Rhizobium etli CFN 42]
          Length = 500

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 147/492 (29%), Positives = 240/492 (48%), Gaps = 40/492 (8%)

Query: 16  ALTCVIFSSTYLVLEA---KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
            L   I SST L   +    +  +S     V+    P++V                    
Sbjct: 24  CLPLAINSSTALAAPSDTGGILAASGSFASVVDADKPAVV-----------TITTTMKTT 72

Query: 73  FGNLPEDHPLKNYFRKDFHKFF---SGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
             +  +  P+   FR+ F           P    +   +  GSGF I+ DG I+T+NH++
Sbjct: 73  DVSADQQSPMDEQFRQFFEDQGIPLPRPAPQQRGSQHAMALGSGFIISPDGVIVTNNHVI 132

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
           ++     V L D TELPAKL+GTD   D+AVLK+Q+ +    + + D++ +++G+ +  I
Sbjct: 133 DNALDIKVTLDDGTELPAKLIGTDPKSDVAVLKIQAGKPLQTIAWGDSDKLKLGDQILAI 192

Query: 190 GNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           GNPF +  TV+AGIVSA  RD+   P   F QIDAPIN GNSGGP  +  G V+G+N  I
Sbjct: 193 GNPFGIGTTVTAGIVSARGRDLHSGPYDDFIQIDAPINHGNSGGPLVDREGKVVGINTAI 252

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
            +     +GVG  IP    K  +  L   G ++HG+ G+  Q +T+++A  +GL  T G+
Sbjct: 253 YSPNGGSVGVGFAIPSDEAKAIVAKLEKDGSINHGYLGVQIQPVTKDVADAVGLDKTGGA 312

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           L+ AV  ++PA  AG+K GD++  + G  +K+ +D    +A  SP  Q  + + ++G   
Sbjct: 313 LVAAVSADTPAAHAGLKPGDIVTSVGGETVKTPKDLSRLVADLSPGTQKSLGVWRDGKTI 372

Query: 369 SVAVVLGSSPTAK-------NDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVAL 414
            + V +G++   +        +       +  LG+ L ++    ++ +         V  
Sbjct: 373 DLNVTVGANADGQKQAAATSPEAPGRASGQPSLGIGLAELTPDVRQQINLPRSVSGAVVA 432

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
           + N ++   A GIQ G  IVSVN   V   +DV+  I +A +  R SVLL ++ D +   
Sbjct: 433 SVNPDKSAAAAGIQSGDVIVSVNDRPVHNARDVKAAIAEAGKAGRKSVLLLVERDGNKT- 491

Query: 475 GNDNMSRFVSLK 486
                  F+++ 
Sbjct: 492 -------FIAVP 496


>gi|291613745|ref|YP_003523902.1| protease Do [Sideroxydans lithotrophicus ES-1]
 gi|291583857|gb|ADE11515.1| protease Do [Sideroxydans lithotrophicus ES-1]
          Length = 465

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 135/482 (28%), Positives = 224/482 (46%), Gaps = 35/482 (7%)

Query: 19  CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
            V F+   L        +  D   ++ +   ++V+V                 G  +LPE
Sbjct: 5   LVFFAFFGLFAHFAAANTLPDFTVLVEQQGAAVVNVSTTQII----HNPQTFQGIPSLPE 60

Query: 79  DHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
           + P   +F            P      E    GSGF I+ DGYILT+ H+++     +V 
Sbjct: 61  NDPFNEFFHHF--------APQAPSEQESQSLGSGFIISSDGYILTNAHVIDHADKITVR 112

Query: 139 LSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGT 198
           L+D  EL A+++G D   D+A+LK+        V     + ++VGE V  IG+PF    +
Sbjct: 113 LTDKRELKARVIGADKRTDVALLKID-ATGLPKVTLGSPDQLKVGEWVVAIGSPFGFDSS 171

Query: 199 VSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           V+AGIVSA  R +P      F Q D PIN GNSGGP FN  G V+G+N+ I +    +MG
Sbjct: 172 VTAGIVSAKGRSLPQENYVPFIQTDVPINPGNSGGPLFNMKGEVVGINSQIYSRSGGYMG 231

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +   IP+ +    +  L S G+V  G  G+  Q +T+ELA   GL    G+LI++V K S
Sbjct: 232 LSFSIPIDVAMDVVNQLRSTGKVTRGRIGVTIQEVTRELADSFGLTKAGGALISSVDKGS 291

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           PA+KAG++  DVI   D +++ S       +A+  P  +VK+ L ++GS   V++V+G  
Sbjct: 292 PAEKAGIRASDVILKFDDKVVTSSAYLPRIVAATKPGSKVKVQLWRKGSTLDVSLVVGEM 351

Query: 378 PTA---------KNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRE--REVEAKG 426
                       +         +  LG+V+ ++ND  K  +++       E         
Sbjct: 352 RDEGAAVQRGGNRGSAEGSSESEARLGLVVSELNDQQKAELQVAGGLIVEELKGPAARSQ 411

Query: 427 IQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           +Q+G  I++V   E+  +     ++ K    +  ++L++            + + +V +K
Sbjct: 412 LQRGDVILAVGNIEIHSVDQFNEVLKKVPHGRNIALLVR----------RSDGTVYVPIK 461

Query: 487 ID 488
           +D
Sbjct: 462 MD 463


>gi|294340989|emb|CAZ89384.1| Peptidase S1 [Thiomonas sp. 3As]
          Length = 488

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 128/495 (25%), Positives = 221/495 (44%), Gaps = 36/495 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYL---VLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
            K+ +LS  S   +A + +   +        ++ +     D   ++ +  PS+V++    
Sbjct: 1   MKKVLLSCLSAGLLAFSGIAVPAQAADSAPQQSCVACGLPDFTGLVEKAGPSVVNIRTYK 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFH--------KFFSGEEPILSDTVERLMF 110
           K  V                D   +   R+ F                P   +       
Sbjct: 61  KVPVGSGDQM----------DEQTRELLRRFFGVPIPAPDSPKGGKNGPQEEEEERPTGV 110

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF ++ DGYI+T+ H+V+      V L+D  E  AKL+G D   D+A++K+ + +   
Sbjct: 111 GSGFIVSPDGYIMTNAHVVDGADEIMVTLTDKREFKAKLIGADKRTDVALVKIDAKQALP 170

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNS 230
            V   D++ ++VGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D  +N GNS
Sbjct: 171 AVHIGDSSKVKVGEWVVAIGSPFGLENTVTAGIVSAKGRDTGDYTP-FIQTDVAVNPGNS 229

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP  +  G+VIG+N+ I +     MG+   IP+    + +  L  +G V  G  G+   
Sbjct: 230 GGPLIDMRGNVIGINSQIYSRTGGFMGISFAIPIDEAMRVVEQLKKQGYVVRGKIGVQID 289

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
           +++++LA  LGL   +G+L+  V K+  ADKAG++VGD++   +G+ ++   D    +  
Sbjct: 290 SVSRDLAESLGLGQARGALVRVVEKDGAADKAGVQVGDIVTSFNGKPVERANDLPRLVGE 349

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSS--------PTAKNDMHLEVGDKELLGMVLQDIN 402
             P   V + + + G   ++ V +G            A+      V     LG+ + D+N
Sbjct: 350 TKPDSTVPMQVLRMGKTLTLNVKVGEWVMDKKPGAKPAEEQKPEAVSKANALGVKVIDLN 409

Query: 403 DGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
           D  K+ + +   V +   RE      G++ G  +++V    VS       +  +    K+
Sbjct: 410 DAQKRQLGVSSGVLVEAVREG-AARDGLRVGDVVLAVGNTAVSSAAQFNAISAQLPVGKQ 468

Query: 460 DSVLLQIKYDPDMQS 474
            +VL  ++       
Sbjct: 469 VAVL--VRRGESGLY 481


>gi|167563533|ref|ZP_02356449.1| serine protease, MucD [Burkholderia oklahomensis EO147]
          Length = 502

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 118/466 (25%), Positives = 215/466 (46%), Gaps = 30/466 (6%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
              D   ++ +V P++V++                 G  N       + +F     +   
Sbjct: 48  GLPDFADLVEKVGPAVVNIRTTANVPADTRGAL-PPGLDNGDMSEFFRRFFGIPLPQPPG 106

Query: 96  GEE-----PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLV 150
           G++     P   DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+
Sbjct: 107 GQKNAPSTPDAPDTEQNRGVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDKREFKAKLI 166

Query: 151 GTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD 210
           G D   D+A++K+ +      V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+
Sbjct: 167 GVDERTDVAIVKISASNL-PTVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRN 225

Query: 211 IPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKA 270
             D    F Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    + 
Sbjct: 226 TGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRV 284

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
              L + G+V  G   +    +T+E+A  +GL   +G+L+++V    PAD+AG++ GD+I
Sbjct: 285 ADQLKASGKVTRGRIAVAIGEVTKEVADSIGLPKAEGALVSSVEPGGPADRAGLQPGDII 344

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP------TAKNDM 384
              +GR +++  D    +    P  +  +++ ++G    + + +   P      T     
Sbjct: 345 LKFNGRPVETASDLPRMVGDTKPGAKATVTVWRKGQSRDLPITIAEFPVDKAAKTDSRQT 404

Query: 385 HLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
             +      LG+ + D++    K +     +       +      G+Q+G  ++ V   +
Sbjct: 405 PQQKPRSSALGLTVSDLSPDQLKTLKLRNGVQIDAV--DGPAARAGLQRGDIVLRVGDVD 462

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           ++  K    +  K   ++  +VL++            + ++F+ ++
Sbjct: 463 IASAKQFVDVTSKLDPQRAVAVLVR----------RGDNTQFIPIR 498



 Score = 74.0 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 313 SIGLPKAEGALVSSVEPGGPADRAGLQPGDIILKFNGRPVETASDLPRMVGDTKPGAKAT 372

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 373 VTV----------WRKGQSRDLPITIAE 390


>gi|167570691|ref|ZP_02363565.1| serine protease, MucD [Burkholderia oklahomensis C6786]
          Length = 502

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 118/466 (25%), Positives = 215/466 (46%), Gaps = 30/466 (6%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
              D   ++ +V P++V++                 G  N       + +F     +   
Sbjct: 48  GLPDFADLVEKVGPAVVNIRTTANVPADTRGAL-PPGLDNGDMSEFFRRFFGIPLPQPPG 106

Query: 96  GEE-----PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLV 150
           G++     P   DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+
Sbjct: 107 GQKNAPSTPDAPDTEQNRGVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDKREFKAKLI 166

Query: 151 GTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD 210
           G D   D+A++K+ +      V   D+N +RVGE V  IG+PF L  TV+AGIVSA  R+
Sbjct: 167 GVDERTDVAIVKISASNL-PTVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSAKGRN 225

Query: 211 IPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKA 270
             D    F Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    + 
Sbjct: 226 TGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRV 284

Query: 271 IPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVI 330
              L + G+V  G   +    +T+E+A  +GL   +G+L+++V    PAD+AG++ GD+I
Sbjct: 285 ADQLKASGKVTRGRIAVAIGEVTKEVADSIGLPKAEGALVSSVEPGGPADRAGLQPGDII 344

Query: 331 CMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP------TAKNDM 384
              +GR +++  D    +    P  +  +++ ++G    + + +   P      T     
Sbjct: 345 LKFNGRPVETASDLPRMVGDTKPGAKATVTVWRKGQSRDLPITIAEFPVDKAAKTDSRQT 404

Query: 385 HLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHE 440
             +      LG+ + D++    K +     +       +      G+Q+G  ++ V   +
Sbjct: 405 PQQKPRSSALGLTVSDLSPDQLKTLKLRNGVQIDAV--DGPAARAGLQRGDIVLRVGDVD 462

Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           ++  K    +  K   ++  +VL++            + ++F+ ++
Sbjct: 463 IASAKQFVDVTSKLDPQRAVAVLVR----------RGDNTQFIPIR 498



 Score = 74.0 bits (179), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 313 SIGLPKAEGALVSSVEPGGPADRAGLQPGDIILKFNGRPVETASDLPRMVGDTKPGAKAT 372

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 373 VTV----------WRKGQSRDLPITIAE 390


>gi|283853053|ref|ZP_06370309.1| protease Do [Desulfovibrio sp. FW1012B]
 gi|283571520|gb|EFC19524.1| protease Do [Desulfovibrio sp. FW1012B]
          Length = 486

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 140/503 (27%), Positives = 243/503 (48%), Gaps = 39/503 (7%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           ++ + +  ++ T ++ + T L   A++P    D+  ++ +  P++V++      K     
Sbjct: 1   MAKRFLIPLSATLMLLAWTGLAA-ARIP--LPDITELVDKDGPAVVNISTTKTIKAQENM 57

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSN 126
                 F       P+ ++F + F KFF  +        +R   GSGF I+ DGYI+T+N
Sbjct: 58  RDLFEQFHK--RGGPMDDFFDQ-FEKFFGPQGRGGKPHKQR-SMGSGFVISADGYIVTNN 113

Query: 127 HIVEDGASFSVIL-SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
           H++++     V   +++  L AK+VG D   DLA+LK++       +EF D++ ++VG  
Sbjct: 114 HVIDNADEVKVQFRNNEKPLSAKIVGRDQETDLALLKIEGRTNLPFLEFGDSSKVKVGAW 173

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGV 244
           V  IGNPF L  TV+ GIVSA  R I   P   F Q DA IN GNSGGP  +  G V+G+
Sbjct: 174 VLAIGNPFGLENTVTLGIVSAKGRIIGAGPFDNFIQTDASINPGNSGGPLIDLDGKVVGI 233

Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRG 304
           N  IV S     G+G  IP  + +  I  L     V  GW G+  Q++    A  LG+  
Sbjct: 234 NTAIVAS---GQGIGFAIPSDMARDVIAQLREGKSVRRGWIGVTIQDIDDNTAKALGMEN 290

Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKE 364
           TKG+L+T+V++  PA KAG+K GDVI  + G  +      + ++A+  P E  +++L ++
Sbjct: 291 TKGALVTSVLEGQPAAKAGVKTGDVITSVSGEKVDDSNQLLRRVATLKPGESAEMTLLRK 350

Query: 365 GSKHSVAVVLGSSPTAKNDMHLEVGDKE------------LLGMVLQDINDGNKKLVR-- 410
           G   +V+V LG     K       GD+             ++G+ ++ +     K +   
Sbjct: 351 GQPMTVSVTLGERDAKKLAQQGAPGDENGEDDAAPDKAATVIGLAVRSVTAKEAKALGMD 410

Query: 411 ----IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQI 466
               ++        E E   ++ G  ++ VN   V+   + ++++ +   K++  V+LQI
Sbjct: 411 KARGVLITEVGDGTEAEQSDVRPGDVVLEVNQRAVNTPDEFKKVVAE-DGKQKGVVMLQI 469

Query: 467 KYDPDMQSGNDNMSRFVSLKIDK 489
           K            + F ++ + +
Sbjct: 470 KR--------QRQTIFRTVPLAE 484


>gi|330989036|gb|EGH87139.1| protease Do [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 479

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 132/499 (26%), Positives = 222/499 (44%), Gaps = 30/499 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L  V  ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLVQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDD 119
                          LP    L+ +  +                  E    GSGF I+ D
Sbjct: 54  PDRAIANQQMPDLEGLPPM--LREFLERSMPPGSRPPGAGKGDRQREAQSLGSGFIISPD 111

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GYILT+NH+++      V LSD +EL AKL+GTD+  D+AVLK+         +  ++N 
Sbjct: 112 GYILTNNHVIDGADEILVRLSDRSELKAKLIGTDSRTDVAVLKIDGKDL-PTAKLGNSNT 170

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  
Sbjct: 171 LKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMA 230

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA 
Sbjct: 231 GEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKASGKVSRGWLGVVIQEVNKDLAE 290

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     + +
Sbjct: 291 SFGLDKPAGALVAQVLEDGPAAKGGLQVGDVILSANGQPIIMSADLPHLIGNLKDGSKAE 350

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---R 410
           + + ++G +  + V +G+ P    +M    G         LG+ + ++    KK +    
Sbjct: 351 LEVIRDGKRQKLTVTVGALPDEGQEMGDVAGTGAERSSNRLGVSVIELTAEQKKSLDLKG 410

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            VA+           G+Q G  I  +N   ++  K    +     + +  S+ +      
Sbjct: 411 GVAIKEVTGGPASLIGLQPGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL----- 465

Query: 471 DMQSGNDNMSRFVSLKIDK 489
                    + F++ K+ +
Sbjct: 466 -----RQGRATFITFKLSE 479


>gi|306843269|ref|ZP_07475878.1| protease Do [Brucella sp. BO2]
 gi|306286535|gb|EFM58118.1| protease Do [Brucella sp. BO2]
          Length = 497

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 141/503 (28%), Positives = 226/503 (44%), Gaps = 54/503 (10%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
             A        +  +   +  ++V++      K    +         +PE  P + +F+ 
Sbjct: 6   PPALAAQGPASVADLAEGLLDAVVNISTSQTVKDDG-EGDGPVPMPQVPEGSPFQEFFKD 64

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFIT-DDGYILTSNHIVEDGASFSVILSDDTELPA 147
            F+     +     D+ +    GSGF I  + GYI+T+NH++ D     V  +D ++L A
Sbjct: 65  FFNDKDGAQG---DDSRKVQSLGSGFIIDAEKGYIVTNNHVIADADEIEVNFNDGSKLKA 121

Query: 148 KLVGTDALFDLAVLKVQS-DRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           +LVG D   DLA+LKV     K   V F ++   R+G+ V  IGNPF L GTV+AGI+SA
Sbjct: 122 ELVGKDTKTDLAILKVDPSKHKLKAVHFGNSEKARIGDWVLAIGNPFGLGGTVTAGIISA 181

Query: 207 LDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLS 265
             RDI   P   F Q DA IN+GNSGGP F+  G VIG+N  I++     +G+G  IP  
Sbjct: 182 RKRDINSGPYDDFIQTDAAINRGNSGGPLFDMDGKVIGINTAIISPSGGSIGIGFAIPAE 241

Query: 266 IIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMK 325
           +    I  L   G V  GW G+  Q +T+++A  LGL+ TKG+LI  +++ S  D   ++
Sbjct: 242 MAAGVIDQLKEFGEVRRGWLGVRLQPVTEDIAQSLGLKETKGALIAGLIENSGVDNKAIE 301

Query: 326 VGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH 385
            GDV+   DG+ + + +D    +A     ++V+I + ++G++ ++ V LG          
Sbjct: 302 AGDVVIRFDGKPVDTARDLPRLVAESPVGKEVEIVVIRQGAEKTLKVKLGRLVEDDKSTE 361

Query: 386 LEVGD---------------------------------KELLGMVLQDINDGNKKLV--- 409
             V D                                   +LGM L  ++D  +      
Sbjct: 362 PAVEDQVPAPDDGEQPGARQETPDKSDKPKKEHKSDAAPSVLGMKLSTLDDDIRGEFGIA 421

Query: 410 ----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
                +  L          K I+ G  IV +    V   +DV++ I   + + R + LL 
Sbjct: 422 EDVEGVAILYVAPGTAAGEKRIETGDVIVDIGQVTVKTPEDVKKRIDALRREGRKNALL- 480

Query: 466 IKYDPDMQSGNDNMSRFVSLKID 488
                 M +      RFV+++ID
Sbjct: 481 ------MLASRSGELRFVTIRID 497


>gi|240850127|ref|YP_002971520.1| serine protease [Bartonella grahamii as4aup]
 gi|240267250|gb|ACS50838.1| serine protease [Bartonella grahamii as4aup]
          Length = 503

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 178/517 (34%), Positives = 275/517 (53%), Gaps = 43/517 (8%)

Query: 1   MFKRQI------LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD------LPPVIARVS 48
           M K+        +S  +I   AL     +S+ L+ +A                 ++A+V 
Sbjct: 1   MVKKAFFKTFVAVSFSAILESALFFSGCTSSLLITKAHASSVFTSLMQQQGFADIVAQVK 60

Query: 49  PSIVSVMVEPKKKVSVE---QMFNAYGFGNLPEDHPLKNYFRKDF-HKFFSGEEPILSDT 104
           P++V+V V+  KK         F+  GF  LP+ HPLK +F++ +       + P  S  
Sbjct: 61  PAVVAVQVKSNKKKEDRFFSNFFSGPGFDQLPDQHPLKRFFKEFYDFDKPKNKFPHQSRR 120

Query: 105 VERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
           +  + FGSGFFI+ DGYI+T++H++ DG S++V+L D TEL AKL+G D   DLAVLKV 
Sbjct: 121 LRPIAFGSGFFISSDGYIVTNDHVISDGTSYTVVLDDGTELNAKLIGKDPKTDLAVLKVS 180

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR-PGTFTQIDA 223
             RKF  V+F D + +RVG+ V  IGNPF L GTV+AGIVSA  RDI       F QIDA
Sbjct: 181 DKRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGTGVYDDFIQIDA 240

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N+GNSGGP F+  G V+GVN  I +    ++G+   IP + +K+ +  LI KG V  G
Sbjct: 241 AVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAATVKQVVQQLIEKGSVQRG 300

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           W G+  Q +T+E++  +GL+  KG+L+T  +K  PA+KAG+K GDVI  ++   +   +D
Sbjct: 301 WLGVQIQPVTKEISDSIGLKEAKGALVTDPLK-GPAEKAGIKAGDVIISVNNEKVADARD 359

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIND 403
              +IA+  P E V I + + G + S+ V L S    ++         E   +      D
Sbjct: 360 LAKRIANIKPGETVTIGIWRSGKEESIKVKLASMSEDESKKEASKHSNERGDL------D 413

Query: 404 GNKKLVRIVAL-----------NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
              +   ++ +           + + + +   KGI+ G  IV+VN   V  + D+   I 
Sbjct: 414 ETLEDYGLIVIPSDDGVGVVVTDVDTDSDAADKGIRPGDIIVTVNNKPVKKVSDIVSTIK 473

Query: 453 KAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            A++  R ++LLQ++         ++ +RFV+L I K
Sbjct: 474 NAQQLGRKAILLQVR--------TNDQNRFVALPILK 502


>gi|330957811|gb|EGH58071.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 477

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 134/498 (26%), Positives = 221/498 (44%), Gaps = 30/498 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L           + A    +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLG-------QVAAAQAENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
                          LP   P+   F +      S          E    GSGF I+ DG
Sbjct: 54  PDRAVANQQMPDMEGLP---PMLREFLERSMPPGSRAPGKGDRQREAQSLGSGFIISSDG 110

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           Y+LT+NH+++      V LSD +EL AKLVGTD   D+AVLK++        +  ++N +
Sbjct: 111 YVLTNNHVIDGADEILVRLSDRSELKAKLVGTDPRTDVAVLKIEGKDL-PTAKLGNSNTL 169

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALG 239
           +VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  G
Sbjct: 170 KVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMAG 229

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA  
Sbjct: 230 EVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKANGKVSRGWLGVVIQEVNKDLAES 289

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     + ++
Sbjct: 290 FGLDKPAGALVAQVLEDGPAAKGGLQVGDVILSANGQPIIMSADLPHLIGNLKDGSKAEL 349

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---RI 411
            + ++G +  + V +G+ P    +M    G         LG+ + ++    KK +     
Sbjct: 350 EVIRDGKRQKLTVTVGALPDEGQEMGDISGSGAERSSNRLGVSVIELTAEQKKTLDIKGG 409

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           VA+           G+Q G  I  +N   +   K    +     + +  S+ +       
Sbjct: 410 VAIKEVSGGPAALIGLQPGDVITHLNNQAIISGKQFTEVAKSLPKDRSVSMRVL------ 463

Query: 472 MQSGNDNMSRFVSLKIDK 489
                   + F++ K+ +
Sbjct: 464 ----RQGRATFITFKLSE 477


>gi|146279171|ref|YP_001169329.1| hypothetical protein Rsph17025_3140 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557412|gb|ABP72024.1| hypothetical protein Rsph17025_3140 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 483

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 134/483 (27%), Positives = 228/483 (47%), Gaps = 26/483 (5%)

Query: 4   RQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVS 63
           R  L    I +  L      +   V  A           ++ARVSP++V + V  K +  
Sbjct: 7   RSSLKAVLIASTLLAGGAVGTALPVAPAHAEVPMQGYADLVARVSPAVVFIEVTAKSQEP 66

Query: 64  VEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILS-DTVERLMFGSGFFITDDGYI 122
             +              PL+ + R+          P            GSGF I+ DG I
Sbjct: 67  APRAA-----------SPLEEFLRRFGEIDPQFRMPAPPERDRVMHGLGSGFLISQDGVI 115

Query: 123 LTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRV 182
           +T+NH+VE+    +V L D  E  A++VG D + D+AV++++       VEF D++ +RV
Sbjct: 116 VTNNHVVENATDMTVKLEDGREFKAEMVGADPMTDIAVIRLRDASDLPFVEFGDSDRLRV 175

Query: 183 GEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHV 241
           G+AV  +GNPF L GTV++GIVSA+ R+I   P   + Q DA IN+GNSGGP F+  G V
Sbjct: 176 GDAVVAVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTSGTV 235

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +G+N  I +     +G+G  IP + ++  +  L   G V  GW G+  Q LT E+A  LG
Sbjct: 236 VGMNTAIFSPTGGSVGIGFSIPANTVRDVVAQLQETGSVSRGWLGVTIQPLTPEIAQALG 295

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
           L G++G+L+  V  +SPA+  G++ GDVI  ++G+ I         IA+    E+ ++++
Sbjct: 296 LEGSRGALVAEVQPDSPAEAGGVESGDVITAVNGQEIGERSSLPRLIAAIPNGEEARLTV 355

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL---LGMVLQDINDGNKKLV-------RI 411
            ++G +  + V +G     + +       + L   LG+ +Q +     + +        +
Sbjct: 356 QRDGREREMTVTIGELSADRLEPAAAAAPEGLGAPLGLEVQPLEPALARQLGLPEDASGV 415

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V    +       + +  G  I       ++  +D+   + +A+   R  +LL++    +
Sbjct: 416 VVTAVDPAGPNADR-LAPGDVIEEAGGRAIATPRDLASAVAEAR--GRGVLLLKVLRQGN 472

Query: 472 MQS 474
              
Sbjct: 473 PVY 475


>gi|269958486|ref|YP_003328273.1| putative serine protease [Anaplasma centrale str. Israel]
 gi|269848315|gb|ACZ48959.1| putative serine protease [Anaplasma centrale str. Israel]
          Length = 484

 Score =  197 bits (499), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 138/495 (27%), Positives = 247/495 (49%), Gaps = 21/495 (4%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
            ++ LS+  +     +  +   +    +  +P S      + AR+ P++V++  E     
Sbjct: 1   MKRFLSLFLLIASLYSWAL--PSAAQSKVVVPDSRKGFSELAARLLPAVVNISTEQTVDG 58

Query: 63  SVEQMFN-AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
               M    + F  +P+    + +F                   + +  GSGF +   G 
Sbjct: 59  DASSMGGQGFRFPGIPKGI-FEEFF-----NNLEPLLVDPPKPRKVVSLGSGFIVDKSGL 112

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+ H++ +     V  SD++   A ++G D   DLAVLKV++ +   PV   +++++ 
Sbjct: 113 IVTNYHVIANAKEIHVKFSDNSTAKATVLGKDPKTDLAVLKVKTKKDLQPVTLGNSDDVL 172

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGH 240
           VGE V  IGNPF L G+VS GI+S   RDI     + F Q DA IN+G+SGGP FNA G 
Sbjct: 173 VGEWVLAIGNPFGLGGSVSVGIISGRARDINIGTASEFLQTDAAINRGHSGGPLFNADGE 232

Query: 241 VIGVNAMIVTSG-QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
           VIG+N  I++     ++GV   IP +   + I  L   GRV+HGW G++ Q++T ++   
Sbjct: 233 VIGINTAIMSPQGGGNVGVAFAIPSNNAARVISVLSKGGRVEHGWLGVVIQHVTDDMTDS 292

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           LGL   +G+LI+ V K+SPA+KAG+KVGDVI   +G+ I++       I   +  E+ K+
Sbjct: 293 LGLERARGALISGVAKDSPAEKAGLKVGDVILEFNGQKIENMPQLTHLITKAAVNEKAKV 352

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHL-EVGDKELLGMVLQDINDGNKK--LVRIVALNP 416
           ++ ++G   +V V +G  P         +    + +G+ +  +   +KK     ++ L  
Sbjct: 353 TVQRDGRTLNVVVTIGKLPDDAVPGGADQEATDDSIGITVGSLPKSSKKQQQEGVLILRV 412

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAK--EKKRDSVLLQIKYDPDMQS 474
           +   +  ++G++KG  ++ +N+  ++ + D  + +GK K     + S+LL +K       
Sbjct: 413 DHRSDAFSEGVRKGDILLGINSTTINSVSDFSKEMGKIKGSSGGKGSLLLLVKKGGGDAP 472

Query: 475 GNDNMSRFVSLKIDK 489
                  ++ +K +K
Sbjct: 473 -----PIYIPVKFNK 482


>gi|257092798|ref|YP_003166439.1| protease Do [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045322|gb|ACV34510.1| protease Do [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 480

 Score =  197 bits (499), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 143/506 (28%), Positives = 230/506 (45%), Gaps = 52/506 (10%)

Query: 2   FKRQILSVKSICTVALTCVIFSS--------------TYLVLEAKLPPSSVDLPPVIARV 47
           FKR +L+V  I  +                              +   +  D   ++ R 
Sbjct: 6   FKRSLLAVTLIAALGAGYAKLGGHAISPADALPAAAAAAPAPAPRSASALPDFTSIVERS 65

Query: 48  SPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVER 107
            P+IV++      K +            +  + P+  +FR+          P        
Sbjct: 66  GPAIVNISSTGPSKTAAT----------IDPNDPMFEFFRRF-------GLPSPHGGAPA 108

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSGF ++ +G ILT+ H+V+     +V L+D  E  AK+VG D L D+AVL++ +  
Sbjct: 109 RGMGSGFIVSAEGLILTNAHVVDGADEVTVKLTDKREFKAKVVGLDKLTDVAVLRINAGN 168

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PDRPGTFTQIDAPIN 226
               V   D +  RVGE V  IG+PF    +V+AGIVSA  R +  D    F Q D  +N
Sbjct: 169 L-PVVRLGDPSRTRVGEWVVAIGSPFGFENSVTAGIVSAKSRSLASDSYVPFIQTDVAVN 227

Query: 227 QGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFG 286
            GNSGGP  N  G VIG+N+ I +    + GV   IP+++       L+  G+V HG  G
Sbjct: 228 PGNSGGPLLNLDGEVIGINSQIYSRSGGYQGVSFAIPINVALNVQEQLLQHGKVRHGRLG 287

Query: 287 IMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW 346
           +  Q ++Q LA   GL+ + G+L+++V K SPA  AG++ GD+I  L+   I    D   
Sbjct: 288 VAIQEVSQSLAESFGLKSSAGALVSSVEKGSPAAAAGLEAGDIILKLNDTEIGRSSDLPP 347

Query: 347 QIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE-VGDKELLGMVLQDINDGN 405
            +++  P  Q+K+ + ++G+   +A+ +G  PTAK         DK  LG+ L+ +    
Sbjct: 348 LVSAIKPGTQIKLQIWRKGATRELALSVGEIPTAKVAAERSGDADKSRLGLALRSLTPQE 407

Query: 406 KKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           ++ V     ++  +          GI+ G  IVSVN   V  +  +  L+ KA +K    
Sbjct: 408 RREVESPDGLLVESV--SGPAARAGIRPGDVIVSVNGQPVRDVPQLRALLDKAGKK---- 461

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKI 487
           V L I+         +N   FV +++
Sbjct: 462 VALLIER--------ENAKIFVPVEL 479


>gi|254429264|ref|ZP_05042971.1| protease Do subfamily [Alcanivorax sp. DG881]
 gi|196195433|gb|EDX90392.1| protease Do subfamily [Alcanivorax sp. DG881]
          Length = 478

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 139/489 (28%), Positives = 234/489 (47%), Gaps = 36/489 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           K+ IL V  + T+           L        +   L P++ + SP++V++ +E + + 
Sbjct: 21  KKPILPVVWVLTLLCVAFSPVQAALPAVTAEGDALPSLAPMLEKTSPAVVNIAIETRVRA 80

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD-DGY 121
           +   + N                    F +FF   E            GSG  +   +GY
Sbjct: 81  ARNPLMNDP-----------------FFRRFFDMPERQRPSERRAASAGSGVIVDAAEGY 123

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           +LT+ H+V++  +  V L+D  EL A+LVG D   DLAVLK++   +   +   D+  +R
Sbjct: 124 VLTNAHVVKNADNIEVTLTDGRELSAELVGVDEEVDLAVLKLEESDRLTQIAIADSTGLR 183

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDI--PDRPGTFTQIDAPINQGNSGGPCFNALG 239
           VG+ V  IGNPF L  TV++GIVSAL R     +   +F Q DA IN GNSGG   N  G
Sbjct: 184 VGDFVVAIGNPFGLGQTVTSGIVSALGRTGLGIEGYESFIQTDASINPGNSGGALVNLRG 243

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            ++G+N  I+     ++G+G  IP  + +  +  LI  G V  G  G+  Q+LT ELA  
Sbjct: 244 ELVGINTAILAPAGGNVGIGFAIPTEMAENVMQQLIEHGEVRRGMLGVTIQDLTAELAEA 303

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            G+   +G +IT VV++S A+KAG+K GDV+  +DGR +    D   ++      E+V++
Sbjct: 304 FGVERQRGVVITQVVEDSAAEKAGLKSGDVVTAVDGRPVNRAADLRNKVGMAPVGEKVEL 363

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKK--LVRIVALNPN 417
           S+ ++G K  V  V+    +++     E   K L G  L+D+  G  +     ++     
Sbjct: 364 SILRDGKKKDVTAVISE--SSRETAGGEAVSKFLEGANLRDLRKGELQHADAGVLVDEVE 421

Query: 418 REREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGND 477
           R       G++ G  I++VN  +V  + ++ + +      K  ++LL++  +  +     
Sbjct: 422 RGSPAWRAGLRNGDVIINVNRQDVDTMDELRKAV----NDKEAALLLRVNRNGGVF---- 473

Query: 478 NMSRFVSLK 486
               FV ++
Sbjct: 474 ----FVVVR 478


>gi|163867921|ref|YP_001609125.1| serine protease [Bartonella tribocorum CIP 105476]
 gi|161017572|emb|CAK01130.1| serine protease [Bartonella tribocorum CIP 105476]
          Length = 503

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 178/515 (34%), Positives = 275/515 (53%), Gaps = 39/515 (7%)

Query: 1   MFKRQI------LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD------LPPVIARVS 48
           M K+        +S  ++   AL     +S+  + +A                 ++A+V 
Sbjct: 1   MLKKTFFKTFVAVSFSAVLESALFFSGCASSLWMTKAHASSVFTSLVQQQGFADIVAQVK 60

Query: 49  PSIVSVMVEPKKKVSV---EQMFNAYGFGNLPEDHPLKNYFRKDF-HKFFSGEEPILSDT 104
           P++V+V V+  KK         F+  G   LP+ HPLK  F++ +       + P  S  
Sbjct: 61  PAVVAVQVKSNKKKEDWFFSNFFSGPGIDQLPDQHPLKRLFKEFYDFDKPKNKFPNHSQR 120

Query: 105 VERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
           +  + FGSGFFI+ DGYI+T++H++ DG S++V+L D TEL AKL+G D   DLAVLKV 
Sbjct: 121 LRPVAFGSGFFISSDGYIVTNDHVISDGTSYTVVLDDGTELNAKLIGKDPKTDLAVLKVN 180

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR-PGTFTQIDA 223
             RKF  V+F D + +RVG+ V  IGNPF L GTV+AGIVSA  RDI       F QIDA
Sbjct: 181 DTRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGTGVYDDFIQIDA 240

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N+GNSGGP F+  G V+GVN  I +    ++G+   IP    K+ +  LI KG V  G
Sbjct: 241 AVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAGTAKQVVQQLIEKGSVQRG 300

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
           W G+M Q +T+E++  +GL+  KG+L+T  +K  PA KAG+K GDVI  ++   +   +D
Sbjct: 301 WLGVMIQPVTKEISDSIGLKDAKGALVTDPLK-GPAAKAGIKAGDVIISVNDEKVNDSRD 359

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK---------NDMHLEVGDKELL 394
              +IA+ SP++ V + + + G +  + V L + P  +         N+        E  
Sbjct: 360 LAKRIANMSPEDTVTLGILRSGKEEKIKVKLAAMPEDEGKKENSKYLNERGDSDETLEDY 419

Query: 395 GMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           G+++   +D     + +V  + + + +   KGI+ G  IV+VN   V    D+   I  A
Sbjct: 420 GLIVSPSDD----GLGLVVTDVDSDSDAADKGIRPGDVIVTVNNKSVKKTSDITDAIKNA 475

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++  R ++LLQI+         ++ +RFV+L I K
Sbjct: 476 QKLGRKAILLQIR--------TNDQNRFVALPIFK 502


>gi|120602655|ref|YP_967055.1| protease Do [Desulfovibrio vulgaris DP4]
 gi|120562884|gb|ABM28628.1| protease Do [Desulfovibrio vulgaris DP4]
          Length = 482

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 138/480 (28%), Positives = 229/480 (47%), Gaps = 40/480 (8%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
                  S  D   +      ++V++  E   +       +     N P+  P   +F +
Sbjct: 20  SSTAQAASLPDFRELAKNAGAAVVNISTEKTVQAPENPFGDM--LRNAPQGTPFDRFFEQ 77

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT----E 144
            F +F     P      ++   GSGF I+ DGYI+T+NH++ D     V + ++T     
Sbjct: 78  -FERFHGKMRPQ-----KQRSLGSGFIISADGYIVTNNHVIADADVIHVNIENETGKSAS 131

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
             AK++GTD   DLA+LK+ + R+   + F D++++ VGE +  IGNPF L  +V+AGI+
Sbjct: 132 YDAKVIGTDEETDLALLKIDAKRQLPVLRFGDSDSLEVGEWLMAIGNPFGLDHSVTAGIL 191

Query: 205 SALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           SA  RDI   P   F Q DA IN GNSGGP  N  G VIG+N  IV S     G+G  IP
Sbjct: 192 SAKGRDIRSGPFDNFLQTDASINPGNSGGPLINMKGEVIGINTAIVAS---GQGIGFAIP 248

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
            ++  + I  L S  +V  GW G+  Q++ +  A  LGL   +G+L+ +V+   PADKAG
Sbjct: 249 SNMAARIIDQLKSDKKVRRGWIGVTIQDVDENTARALGLGEPRGALVGSVMPGEPADKAG 308

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA--- 380
           +K GD++  ++G  I      + ++A+  P E  KI+L + G   +V + LG        
Sbjct: 309 IKAGDILLKVEGEDIADSGRLLRRVAALKPGETAKITLWRNGQTKTVNLTLGERTAEHLA 368

Query: 381 ------KNDMHLEVGDKELLGMVLQDINDGNKKLV------RIVALNPNREREVEAKGIQ 428
                 +     +      LG+ ++  N    + +       ++ +     R      I+
Sbjct: 369 AQGGTPRQTPESKQQASSSLGLTVRPPNAEEARALKLDRPQGLLVIAVEEGRPAADADIR 428

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            G  ++S N H V+   D+ +++ +   K+R +V+LQI+            + F ++ I+
Sbjct: 429 AGDVVLSANLHPVNSTADLAKVVQE-DAKRRGAVMLQIQRR--------GQTFFRTVPIE 479


>gi|220934261|ref|YP_002513160.1| protease Do [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995571|gb|ACL72173.1| protease Do [Thioalkalivibrio sp. HL-EbGR7]
          Length = 477

 Score =  196 bits (498), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 127/483 (26%), Positives = 224/483 (46%), Gaps = 31/483 (6%)

Query: 19  CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
            ++F +      A+   +  D  P++   SP++V++           +        ++P+
Sbjct: 12  ALLFLTLVFSAAAQGRAALPDFVPLVEDNSPAVVNISTTRNI-ARGGREPPQLRIPDMPD 70

Query: 79  DHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
           D  L +  R+ F     GE   + +  +    GSGF I+ DGY++T++H++ED     V 
Sbjct: 71  DGVLGDLLRRFF-----GEGGQMPEQFDTSSLGSGFIISRDGYVVTNHHVIEDADEIIVR 125

Query: 139 LSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGT 198
           LSD    PA +VG+D   D+A+LK+++      ++  ++  ++VGE V  IG+PF    +
Sbjct: 126 LSDRRSFPATVVGSDPKSDVALLKIEASDL-PTLKLGNSEQLKVGEWVLAIGSPFGFDHS 184

Query: 199 VSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
           V+AGIVSA  R +P      F Q D  IN GNSGGP FN  G V+G+N+ I +     MG
Sbjct: 185 VTAGIVSAKGRSLPTENYVPFIQTDVAINPGNSGGPLFNMKGEVVGINSQIYSRTGGFMG 244

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +   IP+ +  + +  L ++G V  GW G++ Q +T+ELA   G+    G+L+  V+ +S
Sbjct: 245 LSFAIPIEMAMEVVEQLKTQGYVSRGWLGVLIQEVTRELADSFGMSRPTGALVARVLPDS 304

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           PA+KAG++VGDVI   +G  +         +      +  ++ + ++G K ++ + +   
Sbjct: 305 PAEKAGVRVGDVILTFNGEEVTRSSALPPLVGRAPVGKDARVEILRDGRKQTLRIRIAEL 364

Query: 378 P-------TAKNDMHLEVGDKELLGMVLQDINDGNKKLV-----RIVALNPNREREVEAK 425
           P        A  +       +   GM L+ +    ++ +      ++             
Sbjct: 365 PPDDELASRAPAESVAPSAAENRFGMTLEPVPAELREALDLEQGGVLVAGVGEG-AARDA 423

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
            IQ+G  +V +N   +        L GK     R  VL+Q                F++L
Sbjct: 424 RIQRGDVLVMINNQRIESPAHFAELAGKLTPGSRVPVLVQ----------RPQGPVFLAL 473

Query: 486 KID 488
           K+ 
Sbjct: 474 KVP 476


>gi|296136820|ref|YP_003644062.1| protease Do [Thiomonas intermedia K12]
 gi|295796942|gb|ADG31732.1| protease Do [Thiomonas intermedia K12]
          Length = 488

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 128/495 (25%), Positives = 219/495 (44%), Gaps = 36/495 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPP---SSVDLPPVIARVSPSIVSVMVEP 58
            K+ +LS  S   +A + +   +       + P       D   ++ +  PS+V++    
Sbjct: 1   MKKVLLSCLSAGLLAFSGIAVPAQAAGSAPQQPCVACGLPDFTGLVEKAGPSVVNIRTYK 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFH--------KFFSGEEPILSDTVERLMF 110
           K  V                D   +   R+ F                P   +       
Sbjct: 61  KVPVGSGDQM----------DEQTRELLRRFFGVPIPAPDSPKGGKNGPQNEEEERPTGV 110

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSGF ++ DGYI+T+ H+V+      V L+D  E  AKL+G D   D+A++K+ + +   
Sbjct: 111 GSGFIVSPDGYIMTNAHVVDGADEIMVTLTDKREFKAKLIGADKRTDVALVKIDAKQALP 170

Query: 171 PVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNS 230
            V   D++ ++VGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D  +N GNS
Sbjct: 171 AVHIGDSSKVKVGEWVVAIGSPFGLENTVTAGIVSAKGRDTGDYTP-FIQTDVAVNPGNS 229

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GGP  +  G+VIG+N+ I +     MG+   IP+    + +  L  +G V  G  G+   
Sbjct: 230 GGPLIDMRGNVIGINSQIYSRTGGFMGISFAIPIDEAMRVVEQLKKQGYVVRGKIGVQID 289

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
           +++++LA  LGL   +G+L+  V K+  ADKAG++VGD++   +G+ ++   D    +  
Sbjct: 290 SVSRDLAESLGLGQARGALVRVVEKDGAADKAGVQVGDIVTSFNGKPVERANDLPRLVGE 349

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSS--------PTAKNDMHLEVGDKELLGMVLQDIN 402
             P   V + + + G   ++ V +G             +      V     LG+ + D+N
Sbjct: 350 TKPDSTVPMQVLRMGKTLTLNVKVGEWVMDKKPGSKPTEEQKPEAVSKANALGVKVIDLN 409

Query: 403 DGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
           D  K+ + +   V +   RE      G++ G  +++V    VS       +  +    K+
Sbjct: 410 DAQKRQLGVSSGVLVEAVREG-AARDGLRVGDVVLAVGNTAVSSATQFNAISAQLPVGKQ 468

Query: 460 DSVLLQIKYDPDMQS 474
            +VL  ++       
Sbjct: 469 VAVL--VRRGESGLY 481


>gi|156935321|ref|YP_001439237.1| serine endoprotease [Cronobacter sakazakii ATCC BAA-894]
 gi|156533575|gb|ABU78401.1| hypothetical protein ESA_03179 [Cronobacter sakazakii ATCC BAA-894]
          Length = 475

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 132/481 (27%), Positives = 228/481 (47%), Gaps = 18/481 (3%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYL-VLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
            K+  L++ ++       +  +S       A    +   L P++ +V PS+VS+ VE   
Sbjct: 1   MKKTTLAMSALALSLGLALSPASFAAETASAVTSQAMPSLAPMLEKVMPSVVSISVEGST 60

Query: 61  KVSVEQMFNAYGFGNLPEDHPLK----NYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI 116
            V+  +M   +      +D P       +    F +   G         + +  GSG  I
Sbjct: 61  TVNTPRMPRNFQ-QFFGDDSPFCQEGSPFQSSPFCQGGPGGADDGGQQQKFMALGSGVII 119

Query: 117 T-DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
               GY++T+NH+V++  +  V LSD  +L AK+VG D   D+A++++Q  +    ++  
Sbjct: 120 DAAKGYVVTNNHVVDNATTIKVQLSDGRKLDAKIVGKDPRSDIALIQIQDPKNLTAIKLA 179

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGGP 233
           D++++RVG+    IGNPF L  TV++GIVSAL R   +      F Q DA IN+GNSGG 
Sbjct: 180 DSDSLRVGDYAVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGA 239

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
             N  G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   L 
Sbjct: 240 LVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKSLTSQMVEYGQVKRGELGIMGTELN 299

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
            ELA  + +   +G+ ++ V+  S A KAG+K GDVI  L+G+ I S      Q+ +   
Sbjct: 300 SELAKAMKVDAQRGAFVSQVLANSSAAKAGVKAGDVIVSLNGKPISSFAALRAQVGTMPV 359

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVA 413
             ++ + L ++G   +V +VL  S   + D           G+   ++++   K   +V 
Sbjct: 360 GTKLTLGLLRDGKPVNVDLVLQQSSQTQVD-----SSSIFSGIEGAEMSNRAGKEKGVVV 414

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
            +          G++KG  IV  N   VS I ++ +++    + K   + L I+      
Sbjct: 415 NSVKAGSPAARIGLKKGDVIVGANQQPVSNIAELRKIL----DSKPSVLALNIQRGDSSI 470

Query: 474 S 474
            
Sbjct: 471 Y 471


>gi|221201347|ref|ZP_03574386.1| putative serine protease MucD [Burkholderia multivorans CGD2M]
 gi|221208827|ref|ZP_03581825.1| putative serine protease MucD [Burkholderia multivorans CGD2]
 gi|221171283|gb|EEE03732.1| putative serine protease MucD [Burkholderia multivorans CGD2]
 gi|221178615|gb|EEE11023.1| putative serine protease MucD [Burkholderia multivorans CGD2M]
          Length = 490

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 119/471 (25%), Positives = 216/471 (45%), Gaps = 39/471 (8%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           S  D   ++ +V P++V++                 G     ++  +  +FR+ F     
Sbjct: 35  SLPDFADLVEKVGPAVVNIRTTANV-----PSGPRGGLPPGFDNGDMSEFFRRFFGIPLP 89

Query: 96  GEEP---------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELP 146
                           DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  
Sbjct: 90  QAPGNPKNAPAPDNPPDTEQNRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFK 149

Query: 147 AKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           AKL+G D   D+AV+K+Q+      V   D+N +RVGE V  IG+PF L  TV+AGIVS+
Sbjct: 150 AKLIGVDDRTDVAVVKIQASNL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSS 208

Query: 207 LDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
             R+  D    F Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+  
Sbjct: 209 KSRNTGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDE 267

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
             +    L + G+V  G   +    +T+++A  +GL   +G+L+++V    PADKAG++ 
Sbjct: 268 AMRVADQLKATGKVTRGRIAVAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGVQP 327

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN---- 382
           GD+I   +GR + +  D    +    P  +  +++ ++G    + + +  +P+       
Sbjct: 328 GDIILKFNGRAVDTASDLPRMVGDTKPGTKATVTVWRKGQARDLPITIAETPSDTTAKAD 387

Query: 383 ---DMHLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVS 435
              +   +      LG+ + D++    K +     +       +      G+Q+G  ++ 
Sbjct: 388 PRKNAPQKPRQSNALGLTVSDLSADQLKALKLKNGVQVDGV--DGPAARAGLQRGDIVLR 445

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           V   ++   K    +  +   +K  +VL++            + ++FV ++
Sbjct: 446 VGDTDIISAKQFAEVTSQLDAQKAVAVLVR----------RGDNTQFVPVR 486


>gi|227822568|ref|YP_002826540.1| serine protease [Sinorhizobium fredii NGR234]
 gi|227341569|gb|ACP25787.1| serine protease [Sinorhizobium fredii NGR234]
          Length = 502

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 132/497 (26%), Positives = 219/497 (44%), Gaps = 45/497 (9%)

Query: 22  FSSTYLVLEA--KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPED 79
           FS+T L   A  +       +  +   +  ++V++ +    K       +      +PE 
Sbjct: 21  FSNTALAETALPRPAAGPPSVADLAESLLDAVVNISISQNVK----GEDDNAPMPQVPEG 76

Query: 80  HPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
            P + +F + F     G+             GSGF I   GYI+T+NH+++D     + L
Sbjct: 77  SPHQEFFDEFFK----GQGGEGGRPRTVNSLGSGFIIDPSGYIVTNNHVIQDADDIEINL 132

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
           S+ T L AKLVGTD   DLAVLKV+       V F D+  IR+G+ V  +GNPF L  +V
Sbjct: 133 SNGTRLKAKLVGTDTKTDLAVLKVEPKTPLKAVSFGDSRKIRIGDWVMVVGNPFGLGVSV 192

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           S G+VSA  R+I   P   F Q DA IN+GNSGGP FN  G VIG+N  I++     +G+
Sbjct: 193 SVGVVSARGRNINAGPYDSFIQTDAAINRGNSGGPLFNMQGEVIGINTAILSQTGMSVGI 252

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  +P  +    +  L   G    GW G+  Q +T ++A  L +   +G+L++ +++  P
Sbjct: 253 GFAVPTELAMNVVNQLKDFGETRRGWLGVRIQPVTDDIAESLKMDVPRGALVSGIIEGGP 312

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
                +K GD+I   DG  +   +D +  +      + V + + ++G + +V V LG   
Sbjct: 313 ISHGEIKAGDIIIRFDGTEVGEMRDLMRAVGESPVGKAVDVVIIRDGKEQTVRVTLGRLE 372

Query: 379 T--------------------AKNDMHLEVGDKELLGMVLQDINDGNKKLV-------RI 411
                                ++           +LGM L  ++   +K          +
Sbjct: 373 DGEHLASAGSGGELKKESPKPSEPPAATLPATDVVLGMKLAVLDADRRKAFGIAESVNGV 432

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           +            + ++ G  IV V    +   +DV   +G+ K   R + LL I     
Sbjct: 433 IVTEVQANSPAAERRVEAGDVIVEVGQEAMDSPEDVTSRVGELKADGRRNALLMI----- 487

Query: 472 MQSGNDNMSRFVSLKID 488
             +      RFV+++++
Sbjct: 488 --ANKSGELRFVTVRME 502


>gi|192973058|gb|ACF06957.1| perplasmic serine protease DO/DeqQ family protein [uncultured
           Roseobacter sp.]
          Length = 491

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 132/502 (26%), Positives = 232/502 (46%), Gaps = 32/502 (6%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
            ++   + ++    A    +     L   A++ P++     +   +SPS+V++       
Sbjct: 8   KRKDFAAYRATWVFAAALCLLILQALQATAQMLPNT--FADLADEISPSVVNITTTTVIA 65

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
              +QM      G +P+  P + +FR+   +   G              GSGF I+ DG+
Sbjct: 66  GRADQM----PRGIVPKGSPFEEFFREFEDRRRGGNGGAS----RSSALGSGFVISADGF 117

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH++E      V       L AK++GTD   D+AVLKV SD     V F D++  R
Sbjct: 118 IVTNNHVIEGADEIEVEFFSGERLAAKVIGTDKNTDIAVLKVASDAPLPFVSFGDSDTAR 177

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHV 241
           VG+ V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G V
Sbjct: 178 VGDWVVAMGNPLGQGFSVSAGIVSARNRALSGIYDDYIQTDAAINRGNSGGPLFNLDGEV 237

Query: 242 IGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLG 301
           +GVN  I++     +G+G  +  +++ + +  L   G +  GW G+  Q++ +++A  + 
Sbjct: 238 VGVNTAILSPNGGSIGIGFSMASNVVSRVVDQLTEYGEIRRGWLGVRIQDVDEDIAESID 297

Query: 302 LRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISL 361
                   +   V E P+  AG+  GDVI + DG  ++  +D V  + +    + V + +
Sbjct: 298 GLDRAAGAVVTGVPEGPSKDAGILQGDVIVIFDGHEVEDVRDLVQTVGNTEVGKAVDVVV 357

Query: 362 CKEGSKHSVAVVLGSSPTAKNDMHLEVG-------DKELLGMVLQDINDGNKKLVRIVAL 414
            ++G++ +++V LG     K     E         D E LG+ L ++ D  ++ + +   
Sbjct: 358 VRDGAQVTLSVTLGLRDDEKLARADEPAVNEDAPKDYEDLGITLSNLTDEIREGLDLAVG 417

Query: 415 NPNRE-------REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
                        E   KG++ G  IV     +V+ + + E  +    E  R ++LL ++
Sbjct: 418 LEGVVVVDVVETSEAFEKGLKSGDVIVEAGQEKVTSLAEFEEQVSATIESGRKTMLLLVR 477

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
              D         RF++L + +
Sbjct: 478 RGGD--------PRFLALTVQQ 491


>gi|256828482|ref|YP_003157210.1| protease Do [Desulfomicrobium baculatum DSM 4028]
 gi|256577658|gb|ACU88794.1| protease Do [Desulfomicrobium baculatum DSM 4028]
          Length = 473

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 136/500 (27%), Positives = 228/500 (45%), Gaps = 43/500 (8%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
            +  L + +I  V L             A +     D   +  +   ++V++      K 
Sbjct: 1   MKYALRLFTIMFVFL-----------ASASMAAQLPDFTELAEKSGQAVVNISTVKLVKN 49

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYI 122
                            HP  ++F + F +FF  +        E+   GSGF  + DGYI
Sbjct: 50  QGNMQQFFPRGPQ--GQHPFGDFFDQ-FERFFGEQGQGTP--REQRSLGSGFVFSADGYI 104

Query: 123 LTSNHIVEDGA----SFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
           +T+NH++E       +  V  + D    A+++GTD   DLA+LK+++D+    + F D++
Sbjct: 105 VTNNHVIEGADSIKVNLQVDKNGDRSYDAEVIGTDKETDLALLKIKADKPLPYLAFGDSD 164

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNA 237
            ++VG+ V  IGNPF L  TV+AGIVSA  R I   P   F Q DA IN GNSGGP  + 
Sbjct: 165 VLKVGQWVMAIGNPFGLDHTVTAGIVSAKGRTIGAGPYDNFIQTDASINPGNSGGPLIDL 224

Query: 238 LGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELA 297
            G VIG+N  IV S     G+G  IP  + ++ I  L     V  GW G+  QN+ +  A
Sbjct: 225 DGKVIGINTAIVAS---GQGIGFAIPSDLARQVIEQLKEYKSVKRGWLGVSIQNVDENSA 281

Query: 298 IPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQV 357
             LGL    G+L+++V    PA+KAG+K GDVI  +DG  +    D   +I    P  ++
Sbjct: 282 KALGLDQASGALVSSVTVGDPAEKAGIKAGDVIVAVDGVSVADAGDLTRKIGDLLPGVKI 341

Query: 358 KISLCKEGSKHSVAVVLGSSPTAKNDMHLE----VGDKELLGMVLQDINDGNKKLV---- 409
            +S+ +EG   ++ +VLG     K             +++LG+ ++ + +   K +    
Sbjct: 342 TLSVWREGKTVTIPLVLGERSAEKVAQGRPGAPGSQGEDVLGLSVRPVAEAEAKALELDR 401

Query: 410 --RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              ++ +  +         +  G  I+  N   V+ +K ++ +I     K++  V+L +K
Sbjct: 402 AQGLLVVEVSEGSPAAQNDLSAGDVILEANGKAVNTVKALKDVIEG-DGKEKGVVMLLVK 460

Query: 468 YDPDMQSGNDNMSRFVSLKI 487
                       + F ++ +
Sbjct: 461 R--------QGRNVFRTVPL 472


>gi|257486559|ref|ZP_05640600.1| protease Do [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331010042|gb|EGH90098.1| protease Do [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 479

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 131/499 (26%), Positives = 221/499 (44%), Gaps = 30/499 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDD 119
                          LP    L+ +  +                  E    GSGF I+ D
Sbjct: 54  PDRAVANQQMPDLEGLPPM--LREFLERSMPPGSRPPGAGKGDRQREAQSLGSGFIISPD 111

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GYILT+NH+++      V LSD +EL AKL+GTD+  D+AVLK+         +  ++N 
Sbjct: 112 GYILTNNHVIDGADEILVRLSDRSELKAKLIGTDSRTDVAVLKIDGKDL-PTAKLGNSNT 170

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  
Sbjct: 171 LKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMA 230

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA 
Sbjct: 231 GEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKASGKVSRGWLGVVIQEVNKDLAE 290

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     + +
Sbjct: 291 SFGLDKPAGALVAQVLEDGPAAKGGLQVGDVILSANGQPIIMSADLPHLIGNLKDGSKAE 350

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---R 410
           + + ++G +  + V +G+ P    +M    G         LG+ + ++    KK +    
Sbjct: 351 LEVIRDGKRQKLTVTVGALPDEGQEMGDVAGTGAERSSNRLGVSVIELTAEQKKSLDLKG 410

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            VA+           G+Q G  I  +N   ++  K    +     + +  S+ +      
Sbjct: 411 GVAIKEVTGGPASLIGLQPGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL----- 465

Query: 471 DMQSGNDNMSRFVSLKIDK 489
                    + F++ K+ +
Sbjct: 466 -----RQGRATFITFKLSE 479


>gi|330973028|gb|EGH73094.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 481

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 130/501 (25%), Positives = 221/501 (44%), Gaps = 32/501 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRK---DFHKFFSGEEPILSDTVERLMFGSGFFIT 117
                          LP    L+ +  +      +             E    GSGF I+
Sbjct: 54  PDRAVANQQMPDLEGLPPM--LREFLERSMPPGSRPPGSGAGKGDRQREAQSLGSGFIIS 111

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGY+LT+NH+++      V LSD +EL AKLVGTD   D+AVLK++        +  ++
Sbjct: 112 PDGYVLTNNHVIDGADEILVRLSDRSELKAKLVGTDPRTDVAVLKIEGKDL-PTAKLGNS 170

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFN 236
           N ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN
Sbjct: 171 NTLKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFN 230

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++L
Sbjct: 231 MAGEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKANGKVSRGWLGVVIQEVNKDL 290

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     +
Sbjct: 291 AESFGLDKPAGALVAQVLEDGPAAKGGVQVGDVILSANGQPIVMSADLPHLIGNLKDGSK 350

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDM-----HLEVGDKELLGMVLQDINDGNKKLV-- 409
            ++ + ++G +  + V +G+ P    +M              LG+ + ++    KK +  
Sbjct: 351 AELEVIRDGKRQKLTVTVGALPDEGQEMGDVGGTGAERSSNRLGVSVIELTAEQKKSLDI 410

Query: 410 -RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
              VA+           G+Q G  I  +N   ++  K    +     + +  S+ +    
Sbjct: 411 KGGVAIKEVTGGPASLIGLQPGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL--- 467

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
                      + F++ K+ +
Sbjct: 468 -------RQGRATFITFKLSE 481


>gi|73541943|ref|YP_296463.1| peptidase S1C, Do [Ralstonia eutropha JMP134]
 gi|72119356|gb|AAZ61619.1| Peptidase S1C, Do [Ralstonia eutropha JMP134]
          Length = 498

 Score =  196 bits (497), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 127/507 (25%), Positives = 226/507 (44%), Gaps = 39/507 (7%)

Query: 1   MFKRQILSVKSICTVALTCV--IFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
           M  R     +++   A+  +    +       A    +  D   ++ + SP++V++    
Sbjct: 1   MTFRSPALARAVVMAAILILGPAVAEVGHAQAAASNYNLPDFTDLVEKASPAVVNIRTTE 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-----------EEPILSDTVER 107
           + +                +D  +  +FR+ F     G                    + 
Sbjct: 61  RIRSRGGSGG---------DDDEMAEFFRRFFGVPMPGAPTPGAPNAPRRGQPPQGEEQS 111

Query: 108 LMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDR 167
              GSGF I+ DGY++T+ H+V D  +  V L D  E  AKL+G+D   D+A++K+    
Sbjct: 112 RGVGSGFIISQDGYVMTNAHVVADAETIYVTLPDKREFKAKLIGSDKRTDVALIKI-EAT 170

Query: 168 KFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQ 227
               +   D++ +R GE V  IG+PF L  +V+AGIVSA  RD  D    F Q D  +N 
Sbjct: 171 GLPKLVLGDSDKVRAGEWVLAIGSPFGLDNSVTAGIVSAKGRDTGDYLP-FIQTDVAVNP 229

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP  N  G VIG+N+ I +    +MG+   IP+    +    L + GRV  G   +
Sbjct: 230 GNSGGPLINLRGEVIGINSQIYSRSGGYMGISFAIPIDEAMRVTEQLKTSGRVTRGRIAV 289

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
              ++T+E+A  LGL   +G+L+ +V    PA+KAG++ GD+I   +GR I+   D    
Sbjct: 290 AIGDVTKEVADSLGLGRARGALVGSVEPGGPAEKAGIEPGDIILKFNGREIEKASDLPRM 349

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSS-----------PTAKNDMHLEVGDKELLGM 396
           +    P  +V I L ++G+   V++ +              P++K+D   +      LG+
Sbjct: 350 VGDTKPGTRVPIQLWRKGATRDVSITVTELEPEARAKARNAPSSKDDASAQAPKPNALGL 409

Query: 397 VLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK 453
           ++ DI D   K +++   V +    +      GI+ G  I+ +   +V+  +    L+  
Sbjct: 410 IVNDIPDARLKELKVRSGVEVEV-ADGPAMRAGIRPGDIILRLGDTDVTGARQFNDLVKG 468

Query: 454 AKEKKRDSVLLQIKYDPDMQSGNDNMS 480
             + +  +V ++      + +     +
Sbjct: 469 LDKSRIAAVFVRRGDATQVLTLRPGAT 495


>gi|289628140|ref|ZP_06461094.1| protease Do [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289649894|ref|ZP_06481237.1| protease Do [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330871245|gb|EGH05954.1| protease Do [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 479

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 131/499 (26%), Positives = 221/499 (44%), Gaps = 30/499 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDD 119
                          LP    L+ +  +                  E    GSGF I+ D
Sbjct: 54  PDRAIANQQMPDLEGLPPM--LREFLERSMPPGSRPPGAGKGDRQREAQSLGSGFIISPD 111

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GYILT+NH+++      V LSD +EL AKL+GTD+  D+AVLK+         +  ++N 
Sbjct: 112 GYILTNNHVIDGADEILVRLSDRSELKAKLIGTDSRTDVAVLKIDGKDL-PTAKLGNSNT 170

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  
Sbjct: 171 LKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMG 230

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA 
Sbjct: 231 GEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKASGKVSRGWLGVVIQEVNKDLAE 290

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     + +
Sbjct: 291 SFGLDKPAGALVAQVLEDGPAAKGGLQVGDVILSANGQPIIMSADLPHLIGNLKDGSKAE 350

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---R 410
           + + ++G +  + V +G+ P    +M    G         LG+ + ++    KK +    
Sbjct: 351 LEVIRDGKRQKLTVTVGALPDEGQEMGDVAGTGAERSSNRLGVSVIELTAEQKKSLDLKG 410

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            VA+           G+Q G  I  +N   ++  K    +     + +  S+ +      
Sbjct: 411 GVAIKEVTGGPASLIGLQPGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL----- 465

Query: 471 DMQSGNDNMSRFVSLKIDK 489
                    + F++ K+ +
Sbjct: 466 -----RQGRATFITFKLSE 479


>gi|71733724|ref|YP_276088.1| protease Do [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71554277|gb|AAZ33488.1| S1C (protease Do) subfamily peptidase MucD [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 479

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 131/499 (26%), Positives = 221/499 (44%), Gaps = 30/499 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDD 119
                          LP    L+ +  +                  E    GSGF I+ D
Sbjct: 54  PDRAIANQQMPDLEGLPPM--LREFLERSMPPGSRPPGAGKGDRQRETQSLGSGFIISPD 111

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GYILT+NH+++      V LSD +EL AKL+GTD+  D+AVLK+         +  ++N 
Sbjct: 112 GYILTNNHVIDGADEILVRLSDRSELKAKLIGTDSRTDVAVLKIDGKDL-PTAKLGNSNT 170

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  
Sbjct: 171 LKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMA 230

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA 
Sbjct: 231 GEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKASGKVSRGWLGVVIQEVNKDLAE 290

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     + +
Sbjct: 291 SFGLDKPAGALVAQVLEDGPAAKGGLQVGDVILSANGQPIIMSADLPHLIGNLKDGSKAE 350

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---R 410
           + + ++G +  + V +G+ P    +M    G         LG+ + ++    KK +    
Sbjct: 351 LEVIRDGKRQKLTVTVGALPDEGQEMGDVAGTGAERSSNRLGVSVIELTAEQKKSLDLKG 410

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            VA+           G+Q G  I  +N   ++  K    +     + +  S+ +      
Sbjct: 411 GVAIKEVTGGPASLIGLQPGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL----- 465

Query: 471 DMQSGNDNMSRFVSLKIDK 489
                    + F++ K+ +
Sbjct: 466 -----RQGRATFITFKLSE 479


>gi|301064760|ref|ZP_07205140.1| peptidase Do [delta proteobacterium NaphS2]
 gi|300441135|gb|EFK05520.1| peptidase Do [delta proteobacterium NaphS2]
          Length = 492

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 140/502 (27%), Positives = 229/502 (45%), Gaps = 37/502 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPS------SVDLPPVIARVSPSIVSVMV 56
           K   L +  +           S  +   A                 +  + SP++V++  
Sbjct: 13  KPSALRLVFLMAALFAVTSVYSLPVTRAATDTDQSHVKWVPQSFSELAQKYSPAVVNIRS 72

Query: 57  EPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI 116
           E   K    +M   +  G    + P +++F K F               ++   GSGF I
Sbjct: 73  EKNGK-RHLEMDPHFKGGPFQNNDPFRDFFEKFFG-------GRPGQGFKQRSLGSGFII 124

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
             DG+I+T+NH+VE      VIL D+ E  A + G D   DLA++K++SD     +EF +
Sbjct: 125 DHDGFIVTNNHVVEGADKIKVILKDEREFDAVVKGRDPNTDLALIKIESDGNLPVIEFGN 184

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCF 235
           ++N+++GE V  IGNPF L  TV+ GI+SA  R I   P   F Q DA IN GNSGGP  
Sbjct: 185 SDNVKIGEWVMAIGNPFGLEHTVTVGIISAKGRVIGSGPYDDFIQTDASINPGNSGGPLI 244

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           +  G V+G+N  I+       G+G  IP+++ K  I  L SKG V  GW G+  Q+LT+E
Sbjct: 245 DMSGKVVGINTAIIAG---GQGIGFAIPVNMAKGIIEQLQSKGEVTRGWLGVAIQDLTKE 301

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           L    G++G  G L+T V    PA+KAG++  D+I  ++G+ + S ++    IA     +
Sbjct: 302 LKAYYGVKGNAGVLVTKVFPGDPAEKAGIEAKDIILSVNGKEVDSSRELSRTIAESPVGQ 361

Query: 356 QVKISLCKEGSKHSVAVVLGSSPT--AKNDMHLEVGDKELLGMVLQDINDGNKKLV---- 409
           + K+ + + G +    + LG  P          EV  K   G+ + ++     +      
Sbjct: 362 KAKLLVLRGGDEKGFTIELGKRPETMEAAAQSPEVQQKNPFGIAVSNLTPEIIQQFQLQA 421

Query: 410 --RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIK 467
              ++ +    + + +  G+  G  I  +N H+V+ +    + IGK K+ +  S    I 
Sbjct: 422 ENGVMVVGVEPDSKGDEAGVLPGDLIKEINHHDVTDVNQYMKEIGKYKKGEPIS--FYIL 479

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
                         FV++ + K
Sbjct: 480 RSNRG---------FVAITLTK 492


>gi|317152597|ref|YP_004120645.1| protease Do [Desulfovibrio aespoeensis Aspo-2]
 gi|316942848|gb|ADU61899.1| protease Do [Desulfovibrio aespoeensis Aspo-2]
          Length = 471

 Score =  196 bits (496), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 144/498 (28%), Positives = 235/498 (47%), Gaps = 40/498 (8%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
             R +  +  +  + L   + +                   + AR   S+V +  E   +
Sbjct: 1   MHRHLAKIIIVTGLVLALPLMA---------RANGLPVFTELAARGGKSVVFISTEKTTQ 51

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
            +            +PE HP + +F +     F G++P      +++  GSGF I+ +G 
Sbjct: 52  AA---PGGQQFRQQVPEGHPFREFFDRF--DQFFGQQPGQP--RKQMGQGSGFVISANGL 104

Query: 122 ILTSNHIVEDGASFSVILSDD-TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           I+T+NH++ED    +V   DD  E  AK+VG D   DLAV+K+ +DR    + F D++ +
Sbjct: 105 IVTNNHVIEDADKVTVRFQDDAKEYVAKVVGRDKETDLAVIKIDTDRTLPVLAFGDSDAL 164

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALG 239
           +VGE V  IGNPF L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP  N  G
Sbjct: 165 QVGEWVLAIGNPFGLDNTVTAGIISAKHRIIGAGPFDNFLQTDASINPGNSGGPLLNMRG 224

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+G+N  I         +G  IP +  +K I  L     V  GW G+  Q+L +  A  
Sbjct: 225 EVVGINTAINA---AADNIGFAIPSTQAEKIIAQLKEGKAVKRGWIGVTIQSLDENQAKA 281

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           LGL   KG+LI++V +  PADKAG++ GDV+  +DG  +   ++ + +IA   P ++ ++
Sbjct: 282 LGLPEAKGALISSVGQGHPADKAGIRQGDVVLEVDGNPVNDSKELLARIAGLKPGDKARL 341

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE---LLGMVLQDINDGNKKLVRI----- 411
           +L +   + +  V LG                    +LGM LQ +       + +     
Sbjct: 342 TLWRGNKRITKTVTLGERGEKIMAAMQPPQPGAQAHVLGMALQPVGQREANALGLDQPQG 401

Query: 412 -VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            + +    +     +G+++G  I+  N  +V+   ++E +I   ++K R +V+L IK   
Sbjct: 402 LIVVEIKPDSPAANEGVRQGDVILQANQQDVNSPAELEGVIS--RDKARGAVMLLIKR-- 457

Query: 471 DMQSGNDNMSRFVSLKID 488
                    + FV+L +D
Sbjct: 458 ------QGQNLFVALPLD 469


>gi|198283245|ref|YP_002219566.1| protease Do [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|198247766|gb|ACH83359.1| protease Do [Acidithiobacillus ferrooxidans ATCC 53993]
          Length = 491

 Score =  196 bits (496), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 121/486 (24%), Positives = 224/486 (46%), Gaps = 24/486 (4%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKV 62
           +R ++++     +++  +  +        +      D  P++ +  P++V++     +  
Sbjct: 9   QRLVMALCMGLGLSIGAMTPAWADSGASGQALVGLPDFTPIVKQYGPAVVNISTTETRVA 68

Query: 63  SVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV--ERLMFGSGFFITDDG 120
                         P + PL  +F   F        P        +    GSGF I+ DG
Sbjct: 69  RGVTSP-------FPPNSPLNQFFAPFFGAPGQPGAPGGGAGQKYQVQSLGSGFVISSDG 121

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YI+T+ H+V+      V L++  +  A LVG  A  D+A+LK+ +      V+  D++ +
Sbjct: 122 YIVTAAHVVKGAQKIIVSLTNHHQYAAHLVGLSARMDVALLKIDAKNL-PVVQIGDSSKL 180

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALG 239
            VG+ V  +G+PF    +V+ G++SA  R +PD P   F Q D PIN GNSGGP FN  G
Sbjct: 181 EVGQWVLAVGSPFGFENSVTQGVISATSRPLPDDPYIPFVQTDVPINPGNSGGPLFNMRG 240

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIG+N  I T+   +MG+   IP+++   A+  L    +V  GW G+M Q+++ +LA  
Sbjct: 241 QVIGINDQIYTNSGGYMGLSFSIPINVAMDAVKQLKLHQKVHFGWLGVMIQDVSMDLAKS 300

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
             ++   G+L++ VV + PA KAG++ GDVI   DG+ I +       +       + K+
Sbjct: 301 FHMKEPVGALVSQVVPDGPAAKAGLRPGDVIVSFDGQAIYNSGQLPPLVGVLPAGFKAKL 360

Query: 360 SLCKEGSKHSVAVVLGSSP--------TAKNDMHLEVGDKELLGMVLQDINDGNKKLVRI 411
            + ++G   S+ +V+ S P        +A +    + G+ + L + +  +    +K + +
Sbjct: 361 GVIRDGKPMSLNIVVESLPGNLENTVESAASGGPAQEGEVKRLNVQVGPLTAEARKQLHV 420

Query: 412 ---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
              V +           GI+ G  I+ V   +++   D+++L+      +   VL  ++ 
Sbjct: 421 NTGVLVLGVGVGPAAEAGIRPGDVILQVAQQQITNAADLQKLVAALPAGQPIPVL--VRR 478

Query: 469 DPDMQS 474
                 
Sbjct: 479 GEGSFY 484


>gi|298488673|ref|ZP_07006702.1| Serine protease precursor MucD/AlgY associated with sigma factor
           RpoE [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|117380748|gb|ABK34461.1| MucD [Pseudomonas syringae pv. glycinea]
 gi|298156746|gb|EFH97837.1| Serine protease precursor MucD/AlgY associated with sigma factor
           RpoE [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320325564|gb|EFW81626.1| protease Do [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327150|gb|EFW83164.1| protease Do [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 479

 Score =  196 bits (496), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 131/499 (26%), Positives = 221/499 (44%), Gaps = 30/499 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFGSGFFITDD 119
                          LP    L+ +  +                  E    GSGF I+ D
Sbjct: 54  PDRAIANQQMPDLEGLPPM--LREFLERSMPPGSRPPGAGKGDRQREAQSLGSGFIISPD 111

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GYILT+NH+++      V LSD +EL AKL+GTD+  D+AVLK+         +  ++N 
Sbjct: 112 GYILTNNHVIDGADEILVRLSDRSELKAKLIGTDSRTDVAVLKIDGKDL-PTAKLGNSNT 170

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  
Sbjct: 171 LKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMA 230

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA 
Sbjct: 231 GEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKASGKVSRGWLGVVIQEVNKDLAE 290

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     + +
Sbjct: 291 SFGLDKPAGALVAQVLEDGPAAKGGLQVGDVILSANGQPIIMSADLPHLIGNLKDGSKAE 350

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---R 410
           + + ++G +  + V +G+ P    +M    G         LG+ + ++    KK +    
Sbjct: 351 LEVIRDGKRQKLTVTVGALPDEGQEMGDVAGTGAERSSNRLGVSVIELTAEQKKSLDLKG 410

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            VA+           G+Q G  I  +N   ++  K    +     + +  S+ +      
Sbjct: 411 GVAIKEVTGGPASLIGLQPGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL----- 465

Query: 471 DMQSGNDNMSRFVSLKIDK 489
                    + F++ K+ +
Sbjct: 466 -----RQGRATFITFKLSE 479


>gi|323527234|ref|YP_004229387.1| protease Do [Burkholderia sp. CCGE1001]
 gi|323384236|gb|ADX56327.1| protease Do [Burkholderia sp. CCGE1001]
          Length = 503

 Score =  196 bits (496), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 127/461 (27%), Positives = 216/461 (46%), Gaps = 24/461 (5%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG---NLPEDHPLKNYFRKDFH--K 92
            D   ++    P++V++  +   K +  +       G    +    P   +++  F    
Sbjct: 55  PDFSGLVETYGPAVVNISAKHVVKRTALRGNGGGMGGNQLPIDPSDPFYQFYKHFFGGMP 114

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
              G +   +        GSGF ++ DGYILT+ H+V+     +V L+D  E  AK+VG 
Sbjct: 115 GMQGGDGGDAPDQPSASLGSGFIVSSDGYILTNAHVVDGANVVTVKLTDKREFKAKVVGA 174

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   D+AVLK+ +         + + + +VG+ V  IG+P+    TV++GI+SA  R +P
Sbjct: 175 DKQSDVAVLKIDASNLPTVKIGDPSRS-KVGQWVVAIGSPYGFDNTVTSGIISAKSRSLP 233

Query: 213 DRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
           +   T F Q D P+N GNSGGP FN  G VIG+N+MI +      G+   IP++   K  
Sbjct: 234 NENYTPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVK 293

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             ++  G V  G  G+  Q + Q LA   G++  +G+L+++V    PA KAG++ GDVI 
Sbjct: 294 DEIVKTGHVSRGRLGVAVQGMNQTLANSFGMQKPQGALVSSVDPGGPAAKAGLQPGDVIL 353

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK---NDMHLEV 388
            ++G  +        QIAS +P     + + ++     + V +GS   +K   +      
Sbjct: 354 SVNGEPVADSSALPSQIASLAPGSTATVQVWRDKGTKDLKVTIGSLSDSKLASDKADQPT 413

Query: 389 GDKELLGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
             +  LG+ ++ +    K    I    L        E+ GIQ G  I++VN   V+ +  
Sbjct: 414 QLQGRLGVAVRPLTPEEKSSASISHGLLVQQSGGAAESAGIQPGDVILAVNGRPVTSVDQ 473

Query: 447 VERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           ++++I  A     +S+ L I+ D        N   FV + +
Sbjct: 474 LKQMIAGA----GNSIALLIQRD--------NAQIFVPVDL 502


>gi|88607445|ref|YP_505690.1| protease DO family protein [Anaplasma phagocytophilum HZ]
 gi|88598508|gb|ABD43978.1| protease DO family protein [Anaplasma phagocytophilum HZ]
          Length = 490

 Score =  196 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 151/502 (30%), Positives = 251/502 (50%), Gaps = 27/502 (5%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLP----PSSVDLPPVIARVSPSIVSVMVEP 58
            R+ LS    C +      F+S       ++     PS+     + +++ PS+V++  E 
Sbjct: 1   MRRFLSFFFFCALVWGHCAFASEVASSALRVSENNGPSTRGFSDLASKLLPSVVNISTEQ 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEP---ILSDTVERLMFGSGFF 115
             +          G        P     R  F  FF+  EP         + +  GSGF 
Sbjct: 61  TVEGDDLAGDGGGGSIFGFPGIP-----RGFFEGFFNSIEPLFVEPPKPRKVISLGSGFI 115

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
           I + G I+T+ H++ +     V  SD T   AK++G D   DLAVLKV   ++ + V+  
Sbjct: 116 IDESGLIVTNYHVIANSQEIQVKFSDGTTAKAKVLGQDPKTDLAVLKVDVAKELVSVKLG 175

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPC 234
           ++++  VGE V  IGNPF L G+VS GI+S   RDI     + F Q DA IN+G+SGGP 
Sbjct: 176 NSDDALVGEWVLAIGNPFGLGGSVSVGIISGRARDINIGTASEFLQTDAAINRGHSGGPL 235

Query: 235 FNALGHVIGVNAMIVTSG-QFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
           FNA G VIG+N  I++     ++GV   IP +   + I  L    +V+HGW G++ Q++T
Sbjct: 236 FNADGEVIGINTAIISPQGGGNVGVAFAIPSNNAARVISILSKGEKVEHGWLGVIVQHVT 295

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
           + +  PLGL    G+L++ VVK SPA+K G++VGDVI   +G+ ++        IA  + 
Sbjct: 296 EGMVEPLGLDSAHGALVSNVVKGSPAEKGGLRVGDVILEYNGKRVEDMSQLTNLIAKTAV 355

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGD----KELLGMVLQDINDGN-KKL 408
            E+V++ + + G + ++ + +G      +    + G      E LG+ + D+ +G+ KK 
Sbjct: 356 NEKVRLLVLRGGKQVTLKITIGKLEEGADGASGKNGSLETGTESLGITVGDMPEGDGKKR 415

Query: 409 VRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGK-AKEKKRDSVLLQIK 467
             +V L  +      A+GI++G  IV ++   V  + D    + K  +  K+DSVLL ++
Sbjct: 416 DGVVVLRVDNRGAAFAEGIRRGDVIVGIDAVLVRNVADFTSELEKILQSTKKDSVLLLVQ 475

Query: 468 YDPDMQSGNDNMSRFVSLKIDK 489
                    D+   +V++K+ +
Sbjct: 476 RG-------DSPPIYVAVKLKR 490


>gi|187928018|ref|YP_001898505.1| protease Do [Ralstonia pickettii 12J]
 gi|187724908|gb|ACD26073.1| protease Do [Ralstonia pickettii 12J]
          Length = 503

 Score =  196 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 135/512 (26%), Positives = 230/512 (44%), Gaps = 52/512 (10%)

Query: 4   RQILSVKSICTV------ALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE 57
           R I +++ +C        +      +       A       D   ++ +VSP++V++   
Sbjct: 5   RSIYALRLLCVAAAVAVGSALVPAHAQNATGSVATATYGLPDFADLVEKVSPAVVNIRTT 64

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE---------PILSDTVERL 108
            K ++              P D  +  +FR+ F     G           P   +  +  
Sbjct: 65  EKVRMQQ----------GGPNDDDMAEFFRRFFGVPMPGMPGQGQKRRNAPPQQEEEQSR 114

Query: 109 MFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRK 168
             GSGF I+ DGYILT+ H+VE   +  V L D  E  AKL+G D   D+A++KV++   
Sbjct: 115 GVGSGFIISGDGYILTNAHVVEGAETIYVTLIDKREYKAKLIGLDKRTDVALVKVEASAL 174

Query: 169 FIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQG 228
              ++  D++ +RVGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D  +N G
Sbjct: 175 -PSLKLGDSDKVRVGEWVLAIGSPFGLDNTVTAGIVSAKGRDTGDYLP-FIQSDVAVNPG 232

Query: 229 NSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIM 288
           NSGGP  N  G VIG+N  I +    +MG+   IP+    +    L + GRV  G  G+ 
Sbjct: 233 NSGGPLINLRGEVIGINNQIYSQSGGYMGISFSIPIDEAMRVAEQLKATGRVTRGRIGVA 292

Query: 289 TQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348
             N+ ++ A  LGL   +G+ +  V    PADKAG++ GD++   +GR ++   D   Q+
Sbjct: 293 IDNVPKDAAESLGLGRARGAYVGNVESGGPADKAGIEAGDIVLKYNGRDVEKAGDLQRQV 352

Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA-----------KNDMHLEVGDKELLGMV 397
               P  +  + + ++G+   +AV +                  ++     G    LG+V
Sbjct: 353 GETKPGTRATVQVWRKGATRDLAVTVAELQADTKVAQRTKGAQPDNSQQGPGKPNALGLV 412

Query: 398 LQDINDGNKKLVR---IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKA 454
           + D++DG ++  +    V +  +        GI+ G  I+ V   +V+  K    ++ K 
Sbjct: 413 VADLSDGARREFKTKSGVEVQVSEG-PAARVGIRPGDLILRVGDTDVTNAKQFNEVVAKL 471

Query: 455 KEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
            + +  +V ++            + ++ V+L+
Sbjct: 472 DKNRMVAVFVR----------RGDATQVVTLR 493


>gi|237747705|ref|ZP_04578185.1| periplasmic serine protease [Oxalobacter formigenes OXCC13]
 gi|229379067|gb|EEO29158.1| periplasmic serine protease [Oxalobacter formigenes OXCC13]
          Length = 488

 Score =  196 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 132/501 (26%), Positives = 223/501 (44%), Gaps = 35/501 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYL---VLEAKLPPSSVDLPPVIARVSPSIVSVMVE 57
           M K  I   +    V LT    S   +      A +     DL  ++ +V P++V++   
Sbjct: 4   MQKTVIFFARRFLLVFLTVGFISFPLMPGEAAPATMVNGLPDLTSLVEKVGPAVVNIRTI 63

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE--PILSDTVERLMFGSGFF 115
            K +       +         D   + Y  + F       +          R   GSGF 
Sbjct: 64  EKIQSRRNPAMDM--------DRDFQEYLFRFFGIPAPDGQLSGTQPQEQVRRGMGSGFI 115

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
           IT DGYILT++H++++     V L+D+ E  AK++G+D   D+A+LK++       ++  
Sbjct: 116 ITADGYILTNHHVIDNADEVFVRLTDNREFKAKIIGSDKRTDVALLKIEGKNL-PVLKTG 174

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCF 235
           ++ NI+VGE V  IG+PF L  TV+AGI+SA  RD  D      Q D  +N GNSGGP  
Sbjct: 175 NSANIKVGEWVLAIGSPFALENTVTAGIISAKARDTGDYLP-LIQTDVAVNPGNSGGPLI 233

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G  IG+N+ I +    +MG+   IP+    +    L   G+V  G  GI    ++ E
Sbjct: 234 NMAGEAIGINSQIYSRSGGYMGISFAIPIDEALRVSEQLKKTGKVTRGQIGIQVAEVSVE 293

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
            A  + L   +G ++  V K S A+KAG++ GD+I   + + I+   +    +    P  
Sbjct: 294 TAKAMNLPNDRGVMVARVEKGSAAEKAGVEAGDIILKFNSQSIEKLSELPRLVGDSIPGT 353

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK--------ELLGMVLQDINDGNKK 407
           +V +++ ++G    + V +  +   K     E             +LG+ + D+    KK
Sbjct: 354 KVSLTVLRKGKSLVLPVTISKAELDKPARKDESSSSRQGESLSSSILGLQVADLTAPQKK 413

Query: 408 LVRI--VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
            + I    +           GI+KG  I+ +N  +V+  +D +  +   K  K   V+L 
Sbjct: 414 RLGINHGVVVTASASPAFESGIRKGDIILRLNNGDVTSQQDFQNQL--VKAGKAKMVVLL 471

Query: 466 IKYDPDMQSGNDNMSRFVSLK 486
           +  +        N+ R+V +K
Sbjct: 472 VARN--------NLIRYVPVK 484


>gi|116624862|ref|YP_827018.1| protease Do [Candidatus Solibacter usitatus Ellin6076]
 gi|116228024|gb|ABJ86733.1| protease Do [Candidatus Solibacter usitatus Ellin6076]
          Length = 492

 Score =  196 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 139/515 (26%), Positives = 226/515 (43%), Gaps = 56/515 (10%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAK------------LPPSSVDLPPVIARVS 48
           M  R +L   ++  VAL      ++     +              P   +    V+   S
Sbjct: 1   MSTRTMLIAPAVVLVALAACGRQTSSSSKNSANREETSSSAIVSRPGPPLSYADVVDHAS 60

Query: 49  PSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPL--KNYFRKDFHKFFSGEEPILSDTVE 106
           P++V++  E + +               PE  P      FR+ F     G     + +  
Sbjct: 61  PAVVTIRSERRVRA--------------PEQFPFAEDPSFRQFFGNPLPGRGGQSAPSQV 106

Query: 107 RLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSD 166
               GSG  +  DG+ILT++H+V+      V L+D   L AK+VG D   DLAVLK+   
Sbjct: 107 EHALGSGVIVRADGHILTNHHVVDGAEDIKVDLNDHRTLSAKVVGVDPPSDLAVLKID-A 165

Query: 167 RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP---DRPGTFTQIDA 223
           +    +   D++ +RVG+    +GNP  +  TV+AGI+SA  R           F Q DA
Sbjct: 166 QDLPVLALADSDRVRVGDICLAVGNPLGVGQTVTAGIISARSRSTDLSTGSFEDFLQTDA 225

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
           PINQGNSGG   N    +IG+N+ I++    ++G+G  IP ++ K  +  LI+ G+V  G
Sbjct: 226 PINQGNSGGALINTNAALIGINSQILSPTGGNIGIGFAIPSNLAKNVMDQLITTGKVHRG 285

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
             G+  Q LT +LA  LGL+  +G L+  V   SPAD+AG++ GDVI  +DG  +     
Sbjct: 286 QLGVGVQPLTSDLASGLGLKEVRGVLVNLVKPGSPADRAGIRNGDVITAIDGHPVDEPNA 345

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE------LLGMV 397
              ++A+ +P  Q K+S  ++G +  V V LG        M    G          LG+ 
Sbjct: 346 LRNRVATTAPDSQAKLSFIRDGKEQQVTVKLGELTAESAAMERPNGMPGNAPTDRRLGVS 405

Query: 398 LQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERL 450
           ++ ++    + + +          +   +      G+Q G  I+++N   V    DV   
Sbjct: 406 VEPLSPALAQELGVRRDMQGLAVRDVQPDGPAARAGVQPGDVIIALNRQAVRSAADVAAA 465

Query: 451 IGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           +  A    R S+LL               + F+++
Sbjct: 466 LRSA--SSRPSLLL---------INRAGQNVFLTV 489


>gi|62178779|ref|YP_215196.1| serine endoprotease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62126412|gb|AAX64115.1| periplasmic serine protease Do, heat shock protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322713233|gb|EFZ04804.1| serine endoprotease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 478

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 132/482 (27%), Positives = 225/482 (46%), Gaps = 20/482 (4%)

Query: 2   FKRQILSVKSICT-VALTCVIFSSTYL--VLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
            K+  L++ ++   + LT    S+T       A        L P++ +V PS+VS+ VE 
Sbjct: 4   MKKTTLAMSALALSLGLTLSPLSATAAETSSSAMTAQQMPSLAPMLEKVMPSVVSINVEG 63

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF---SGEEPILSDTVERLMFGSGFF 115
              V+  +M   +      +D P         +  F    G         + +  GSG  
Sbjct: 64  STTVNTPRMPRNFQ-QFFGDDSPFCQDGSPFQNSPFCQGGGNGGNGGQQQKFMALGSGVI 122

Query: 116 ITD-DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEF 174
           I    GY++T+NH+V++ +   V LSD  +  AK+VG D   D+A++++Q+ +    ++ 
Sbjct: 123 IDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDIALIQIQNPKNLTAIKL 182

Query: 175 EDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGG 232
            D++ +RVG+    IGNPF L  TV++GIVSAL R   +      F Q DA IN+GNSGG
Sbjct: 183 ADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGG 242

Query: 233 PCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNL 292
              N  G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   L
Sbjct: 243 ALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTEL 302

Query: 293 TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRS 352
             ELA  + +   +G+ ++ V+  S A KAG+K GDVI  L+G+ I S      Q+ +  
Sbjct: 303 NSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMP 362

Query: 353 PKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIV 412
              ++ + L +EG   +V + L  S  ++ D        E  G  + +      +   +V
Sbjct: 363 VGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIE--GAEMSN----KGQDKGVV 416

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
             +          G++KG  I+  N   V  I ++ +++    + K   + L I+     
Sbjct: 417 VSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKIL----DSKPSVLALNIQRGDSS 472

Query: 473 QS 474
             
Sbjct: 473 IY 474


>gi|224582057|ref|YP_002635855.1| serine endoprotease [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224466584|gb|ACN44414.1| protease DO precursor; heat shock protein HtrA [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
          Length = 475

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 132/482 (27%), Positives = 225/482 (46%), Gaps = 20/482 (4%)

Query: 2   FKRQILSVKSICT-VALTCVIFSSTYL--VLEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
            K+  L++ ++   + LT    S+T       A        L P++ +V PS+VS+ VE 
Sbjct: 1   MKKTTLAMSALALSLGLTLSPLSATAAETSSSAMTAQQMPSLAPMLEKVMPSVVSINVEG 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF---SGEEPILSDTVERLMFGSGFF 115
              V+  +M   +      +D P         +  F    G         + +  GSG  
Sbjct: 61  STTVNTPRMPRNFQ-QFFGDDSPFCQDGSPFQNSPFCQGGGNGGNGGQQQKFMALGSGVI 119

Query: 116 ITD-DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEF 174
           I    GY++T+NH+V++ +   V LSD  +  AK+VG D   D+A++++Q+ +    ++ 
Sbjct: 120 IDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDIALIQIQNPKNLTAIKL 179

Query: 175 EDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGG 232
            D++ +RVG+    IGNPF L  TV++GIVSAL R   +      F Q DA IN+GNSGG
Sbjct: 180 ADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGG 239

Query: 233 PCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNL 292
              N  G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   L
Sbjct: 240 ALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTEL 299

Query: 293 TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRS 352
             ELA  + +   +G+ ++ V+  S A KAG+K GDVI  L+G+ I S      Q+ +  
Sbjct: 300 NSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMP 359

Query: 353 PKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIV 412
              ++ + L +EG   +V + L  S  ++ D        E  G  + +      +   +V
Sbjct: 360 VGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIE--GAEMSN----KGQDKGVV 413

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
             +          G++KG  I+  N   V  I ++ +++    + K   + L I+     
Sbjct: 414 VSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKIL----DSKPSVLALNIQRGDSS 469

Query: 473 QS 474
             
Sbjct: 470 IY 471


>gi|71907529|ref|YP_285116.1| peptidase S1C, Do [Dechloromonas aromatica RCB]
 gi|71847150|gb|AAZ46646.1| Peptidase S1C, Do [Dechloromonas aromatica RCB]
          Length = 489

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 136/459 (29%), Positives = 222/459 (48%), Gaps = 28/459 (6%)

Query: 33  LPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHK 92
            P    D+  ++A  + ++V++ V   +K       N  G   L  D PL  +FR+   +
Sbjct: 54  TPNGLPDMRSIVANNAQAVVNISVTGTRKTGA----NLPGMPQLDPDDPLYQFFRRFGGQ 109

Query: 93  FFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGT 152
                EP           GSGF +T DG +LT+ H+V+     +V L+D  E  AK++G 
Sbjct: 110 MPQDNEP-------THGLGSGFIVTPDGTVLTNAHVVDGAEEVTVKLNDKREFKAKVLGL 162

Query: 153 DALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP 212
           D   D+AVL++ +      V+   +    VGE V  IG+PF    + SAGIVSA  R++P
Sbjct: 163 DKASDVAVLRIDAKNL-PTVKIGSSTQTAVGEWVLAIGSPFGFESSASAGIVSAKSRNLP 221

Query: 213 DRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAI 271
           D     F Q D  +N GNSGGP FN  G VIG+N+ I +    + G+   IP+ +     
Sbjct: 222 DGSYVPFIQTDVAVNPGNSGGPLFNMNGEVIGINSQIYSRSGGYQGLSFAIPIEVAMNVE 281

Query: 272 PSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVIC 331
             +++ G+V  G  G+  Q + Q LA   GL    G+L+ AV K SPA KAG++ GDVI 
Sbjct: 282 KQIVTHGKVQRGKLGVTIQEVNQSLADSFGLPKPAGALVAAVEKGSPAAKAGLEPGDVIL 341

Query: 332 MLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMH-LEVGD 390
            +DG+ +++  +    IA++ P E  ++ + ++G   ++ V +GS    K   +  +   
Sbjct: 342 GIDGKTVETPGELPAAIATKLPGESARLQIWRKGGTQNIDVKVGSFGDEKVAANDTQPAT 401

Query: 391 KELLGMVLQDINDGNKKLVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
           K  LG+ ++ +    ++   I    L    +      GI+ G  IVSVN   +  ++ + 
Sbjct: 402 KGRLGVAVRPLTPEERRQAEIKGGVLVEQADGAAGRAGIRPGDIIVSVNGQPIGDVEQLR 461

Query: 449 RLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            LI  AK  K+ ++L+             +   FV + +
Sbjct: 462 SLI--AKSGKKAAILI----------ERGDSRLFVPVDL 488


>gi|158424196|ref|YP_001525488.1| serine protease DO-like protein [Azorhizobium caulinodans ORS 571]
 gi|158331085|dbj|BAF88570.1| serine protease DO-like protein [Azorhizobium caulinodans ORS 571]
          Length = 523

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 140/487 (28%), Positives = 231/487 (47%), Gaps = 35/487 (7%)

Query: 25  TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKN 84
               + A        +  V  +V  ++V++        S            LP   P ++
Sbjct: 49  VSGPVHAAASKGPDTVADVAEKVMDAVVNISTSQNVAPSRS-----VPAPQLPPGSPFED 103

Query: 85  YF----RKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
           +F    ++   +    +E            GSGF I   GYI+T+NH++ D        +
Sbjct: 104 FFDEFFKRRQQQDDGDQEQSNRRPRRVSSLGSGFVIDPTGYIVTNNHVIADADEIYANFN 163

Query: 141 DDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVS 200
           D T+L A+LVG D   DLA+LKV+ ++  + V+F D++ +RVG+ V  IGNPF L GT++
Sbjct: 164 DGTKLKAELVGRDTKTDLALLKVKPEKPLVSVKFGDSDKMRVGDWVMAIGNPFGLGGTLT 223

Query: 201 AGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVG 259
            G++SA +RDI   P   F Q DA IN+GNSGGP FN  G VIGVN  I++     +G+G
Sbjct: 224 VGVISARNRDINSGPYDNFLQTDAAINRGNSGGPLFNMEGDVIGVNTAIISPSGGSIGIG 283

Query: 260 LIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITA-VVKESP 318
             +P S     I  L     V  GW G+  QN++ E+A  LG+   +G+L+       SP
Sbjct: 284 FAVPSSTAGPVIAQLQQFKEVRRGWIGVRIQNVSDEIAESLGIGKARGALVGGLNDDNSP 343

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+K GDVI   DG+ +K  +D    +A     ++V I + ++G + ++ + +  +P
Sbjct: 344 AAKAGVKAGDVIVKFDGKDVKDVRDLPRIVADTPVGKEVDIVVLRKGKEETLKITVARAP 403

Query: 379 TAKNDMHLEVGD----------KELLGMVLQDINDGNKKLV-------RIVALNPNRERE 421
             +     +             K++LG+ +  I D  ++          +V  + +R   
Sbjct: 404 EEEKTAADKSKPQSADADKPVVKKVLGLEVASITDDLRRRFKIKDTVKGVVITSVDRNSA 463

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSR 481
              KG++ G  IV V    VS   D+++ +   K+  + S LL I       S  +   +
Sbjct: 464 AADKGLKAGQVIVEVGQEPVSAPADLQKRVDALKKDNKKSALLLI-------SDGEGQVQ 516

Query: 482 FVSLKID 488
           F ++ ++
Sbjct: 517 FAAVPLN 523


>gi|317401883|gb|EFV82490.1| serine protease [Achromobacter xylosoxidans C54]
          Length = 496

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 129/508 (25%), Positives = 229/508 (45%), Gaps = 45/508 (8%)

Query: 4   RQILSVK---SICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           R+ L+      + + A   V  +            +  D   +I +  P++V++      
Sbjct: 12  RRFLAAATAGLLMSAAFAPVSLAQAPAADTPTPTVALPDFTGIIEKADPAVVNIRTTATV 71

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVE-----------RLM 109
            +           G  P  +     FR  F   F                          
Sbjct: 72  PIR----------GVGPGGNDPAELFRWFFGPDFQPPGQAPGPRQRPQPQQPEERTVPRG 121

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGFFI+DDGYI+T+NH+V D     V L+D  E  AK++GTD   D+A++K+++    
Sbjct: 122 VGSGFFISDDGYIMTNNHVVSDATDIYVTLTDGREFKAKVIGTDERTDVALIKIEAKDMT 181

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGN 229
             V   D   ++ G+ V  IG+PF L  TV++GIVSA+ RD  +    F Q D  +N GN
Sbjct: 182 PLV-IGDPKKLKKGQWVLAIGSPFGLDSTVTSGIVSAIGRDTGEYLP-FIQTDVAVNPGN 239

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP  N  G V+G+N+ I++     MG+ L IP+    + +  L + G+V  G  G+  
Sbjct: 240 SGGPLINLAGEVVGINSQIISRSGGFMGISLAIPIDEAMRVVDQLRATGKVTRGRVGVQI 299

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
             + +++A  +GL   +G+L+++V  + PA++AG++ GDVI   +   IK   D    + 
Sbjct: 300 GEVGKDVAEAIGLPKAEGALVSSVEVDGPAEQAGVQPGDVILTFNKEPIKRWTDLPRIVG 359

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-----ELLGMVLQDINDG 404
              P  +  + + ++G K +++V +G  P  K     +           LG+ + D+   
Sbjct: 360 ETKPGTRADMEVWRKGKKMTLSVKVGEIPVDKAVPGKKGATPAPEVTNALGLGVVDVPAD 419

Query: 405 NKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
            +K +RI   V +           G+Q+G  ++++N  +V+  K    L+GK  + +   
Sbjct: 420 VQKKLRIKGGVQVKVAEG-AAAKAGLQEGDIVLALNDTDVTGAKQFAELVGKLDKGRAVG 478

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           +L++              +++V++   K
Sbjct: 479 LLVR----------RGEQTQWVAVPASK 496


>gi|319792221|ref|YP_004153861.1| protease do [Variovorax paradoxus EPS]
 gi|315594684|gb|ADU35750.1| protease Do [Variovorax paradoxus EPS]
          Length = 494

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 142/489 (29%), Positives = 232/489 (47%), Gaps = 34/489 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPS--SVDLPPVIARVSPSIVSVMVEP 58
           MFK +   ++S        +   +T+L +E     +    D   ++ +V PS+V++    
Sbjct: 2   MFKVEGHKLRSGVLAFALALTAGATFLPVEPVHAQTRTLPDFTDLVDQVGPSVVNIRTVE 61

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSG---------EEPILSDTVERLM 109
           K            G GN   D  ++ +FR+ F +   G               +      
Sbjct: 62  KVAQR--------GAGNGEMDEEMQEFFRRFFGQPAPGTPRQGPRPNRPQQPQEEERPRG 113

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            GSGF +T DGY++T+ H+VED +   V L D  E  AK+VG D   D+AV+K++     
Sbjct: 114 VGSGFILTADGYVMTNAHVVEDASEVLVTLPDKREFKAKIVGADKRTDVAVVKIE-ATGL 172

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGN 229
             V+  D + +RVGE V  IG+PF L  TV+AGIVSA  RD  +    F Q D  IN GN
Sbjct: 173 PAVKVGDISKLRVGEWVMAIGSPFGLENTVTAGIVSAKQRDTGEYLP-FIQTDVAINPGN 231

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP  N  G V+G+N+ I +     MG+   IP+    +    L + GRV  G  G+  
Sbjct: 232 SGGPLINMRGEVVGINSQIYSRSGGFMGISFSIPIDEAIRVSEQLRTSGRVSRGRIGVQI 291

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
             +T+++A  +GL   +G+L+  V   SP +KAG++ GDVI   DG+ I+   D    + 
Sbjct: 292 DQVTKDVAEAIGLSKAQGALVRGVEAGSPGEKAGVEPGDVITKFDGKAIEKPSDLPRLVG 351

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL-----------LGMVL 398
           +  P  +  +++ + GS   ++V +      K        D+             +G+ +
Sbjct: 352 NTKPGTKSTLTVFRRGSSRDLSVTIAEIEPDKPAKRASDRDEPAPKPSASAAAKSIGLAV 411

Query: 399 QDINDGNKKLVRIVA-LNPNRERE-VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456
            D+ND  KK +++   +  +   E     G+++G  I++V   EV+  ++ E  + KA +
Sbjct: 412 SDLNDAQKKELKLKGGVKVDAASEGAARAGLREGDIILAVGNIEVANTREFEAALAKADK 471

Query: 457 KKRDSVLLQ 465
            K  SVL +
Sbjct: 472 SKALSVLFR 480


>gi|148266305|ref|YP_001233011.1| protease Do [Geobacter uraniireducens Rf4]
 gi|146399805|gb|ABQ28438.1| protease Do [Geobacter uraniireducens Rf4]
          Length = 466

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 150/494 (30%), Positives = 228/494 (46%), Gaps = 35/494 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
            ++Q   + ++    +T     S     +A  P    D   +  ++ P++V++      K
Sbjct: 1   MRKQSTKILALVICCVTLSGLFSESAPAKAVTP----DFVELAKKLKPTVVNISTAKTIK 56

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
                          P   P  N   +DF   F  E        +    GSGF I+D+GY
Sbjct: 57  PQRR--------FQRPFGTPFGNDPFQDFFDRFFDESQQHPYKQK--SLGSGFIISDEGY 106

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+V       V LSD  E   ++ G+D   DLA++K+ +          D++ I 
Sbjct: 107 IITNNHVVSGADEIKVKLSDGREFKGEIKGSDEKLDLALVKISAKDHLPVATLGDSDTIE 166

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGH 240
           VGE V  IGNPF L  TV+AGIVSA  R I   P   F Q DA IN GNSGGP FNA G 
Sbjct: 167 VGEWVMAIGNPFGLAQTVTAGIVSAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNAHGE 226

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIG+N  I+       G+G  IP+++ K  I  L   G+V  GW G+  Q +T ELA   
Sbjct: 227 VIGINTAIIAG---GQGIGFAIPVNMAKNIITQLKETGKVTRGWIGVSIQPITPELAQSF 283

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
            L G KG+L+  +VK+SPA+KAG+K GD+I   +G++I    +    +A+    ++V + 
Sbjct: 284 DLEGEKGALVAEIVKDSPAEKAGIKTGDIILEFNGKMIHEMNELPRLVAATPVGKKVTVK 343

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDIND------GNKKLVRIVAL 414
           + +EG    V V +      +      +G ++ LGM ++ +N       G K+   +V  
Sbjct: 344 ILREGKSEDVPVTVERLKDGEAGGQPGIG-QDRLGMTVRALNKDLAARMGIKEQSGVVVT 402

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
                   E  GI  G  I  +N   +  I D E+ +   K+     +LL+         
Sbjct: 403 EIKAGGSAEQAGISIGDIIREINGARIDSIGDYEKAVTAHKKGGVIRLLLR--------- 453

Query: 475 GNDNMSRFVSLKID 488
                S FV+ K++
Sbjct: 454 -RGESSLFVAFKVE 466


>gi|328543002|ref|YP_004303111.1| serine protease DO-like protein [polymorphum gilvum SL003B-26A1]
 gi|326412748|gb|ADZ69811.1| Serine protease DO-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 493

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 145/482 (30%), Positives = 228/482 (47%), Gaps = 35/482 (7%)

Query: 27  LVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYF 86
           + L   L      +  +   ++ ++V++      K              +PE  P + +F
Sbjct: 28  MPLPPALAQGPASVADLAEGLADAVVNISTAQTVKAQRS-----VPLPKVPEGSPFQEFF 82

Query: 87  RKDFHKFFSGEEPILSDTVERLMFGSGFFITD-DGYILTSNHIVEDGASFSVILSDDTEL 145
            + F++    +        +    GSGF I   DG I+T+ H++E     +   +D T+L
Sbjct: 83  EEFFNR----QNRDRDQPRQVQSLGSGFVIDGVDGIIITNYHVIEGADEITANFNDGTKL 138

Query: 146 PAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVS 205
            A+++G+D   DLAVLKV+  +    V+F D++ IRVG+ V  IGNPF L GTV+ GIVS
Sbjct: 139 VAEVLGSDEKTDLAVLKVKPTKPLKAVDFGDSDAIRVGDWVMAIGNPFGLGGTVTVGIVS 198

Query: 206 ALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPL 264
           A +RDI   P   F Q DA IN+GNSGGP F+  G V+G+N  I++     +G+G  IP 
Sbjct: 199 ARNRDINAGPYDNFIQTDASINRGNSGGPLFDMDGKVVGINTAIISPSGGSIGIGFAIPA 258

Query: 265 SIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGM 324
                 I  L   G    GW G+  Q +T E+A  LG+   KG+L+  V ++ PA +A +
Sbjct: 259 KTAVNVIAQLREFGETRRGWLGVRIQEVTDEIAESLGMDEAKGALVAGVSEDGPAAQADI 318

Query: 325 KVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDM 384
           + GDVI   DGR + + +D    +A  +  + V + + ++G + ++ V LG    A+   
Sbjct: 319 QPGDVIVSFDGRPVPAMRDLPRMVADTAIGKAVDVVVLRKGEEVTLQVTLGRLEDAEAAE 378

Query: 385 H----------LEVGDKELLGMVLQDINDGNKKLV-------RIVALNPNREREVEAKGI 427
           +           +    E LGM+L D++D  ++          +V            K +
Sbjct: 379 NGGGAAPKQETEQAPQSEALGMILADLDDALREKFQIDAEIEGVVVTEVAPGSVAADKRV 438

Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           Q G  I  V    V+  KDV   I   K +KR S LL         S      RFV L+I
Sbjct: 439 QAGDVIKEVGQEPVATPKDVLDRIAALKAEKRKSALLL-------LSNPTGELRFVPLRI 491

Query: 488 DK 489
           ++
Sbjct: 492 EE 493


>gi|319793241|ref|YP_004154881.1| protease do [Variovorax paradoxus EPS]
 gi|315595704|gb|ADU36770.1| protease Do [Variovorax paradoxus EPS]
          Length = 493

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 129/486 (26%), Positives = 225/486 (46%), Gaps = 21/486 (4%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPP--SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
           + ++   A T  + + T     A  P   +  D   + +R  P++V++ V    K S ++
Sbjct: 21  IGAVGAGAYTSAVSAPTNATPVAATPAMVTLPDFSTITSRDGPAVVNISVTGTMKASDDE 80

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSN 126
                    +  + P+  +FR+   +     +      V     GSGF +   G I+T+ 
Sbjct: 81  AAAE--IQGVDPEDPMFQFFRRFQGQINPRGQQQQQRDVPVRAQGSGFIVDPSGIIITNA 138

Query: 127 HIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAV 186
           H+V+D    +V L+D  E  AK++G DA  D+AVLK+ +      +   +  +++VGE V
Sbjct: 139 HVVKDAKEVTVKLTDRREYRAKVLGADAKTDIAVLKIDAKNL-PVLALGNTKDLKVGEWV 197

Query: 187 FTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVN 245
             IG+PF    TV+AG+VSA  R +PD     F Q D  +N GNSGGP  N  G V+G+N
Sbjct: 198 LAIGSPFGFENTVTAGVVSAKGRSLPDDSYVPFIQTDVAVNPGNSGGPLLNTRGEVVGIN 257

Query: 246 AMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGT 305
           + I +    + GV   IP+ +  +    +++ G+  H   G+  Q + Q  A    L   
Sbjct: 258 SQIYSRSGGYQGVSFAIPIDVAVQVKDQIVATGKASHARLGVAVQEVNQAFADSFKLDKP 317

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           +G+L++ + K  P DKAG+K GDVI  +DG+ I S  D    I  ++P ++V + + ++G
Sbjct: 318 EGALVSNIEKGGPGDKAGLKAGDVIRKVDGQAIVSSGDLPAVIGQQAPGKKVTLEVWRQG 377

Query: 366 SKHSVAVVLGSSPTAKNDMHLEV--GDKELLGMVLQDINDGNKKLVRIV--ALNPNRERE 421
            +  +   LG +      +        +  LG+ L+ +    K+   +    L  +    
Sbjct: 378 ERQELQAKLGDAGDKPTQVAKADTGAGQGKLGLALRPLQPQEKREAGVDTGLLIEDAAGP 437

Query: 422 VEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSR 481
               G+Q G  ++++N      ++ V  ++ KA      SV L I+   D          
Sbjct: 438 SAQAGVQAGDVLLAINGTPAQSLEQVREVVAKATN---KSVALLIQRGED--------KI 486

Query: 482 FVSLKI 487
           FV ++I
Sbjct: 487 FVPVRI 492


>gi|110633255|ref|YP_673463.1| protease Do [Mesorhizobium sp. BNC1]
 gi|110284239|gb|ABG62298.1| protease Do [Chelativorans sp. BNC1]
          Length = 509

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 159/484 (32%), Positives = 249/484 (51%), Gaps = 24/484 (4%)

Query: 16  ALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSI--VSVMVEP-KKKVSVEQMFNAYG 72
           A++          ++   P  +     V+  V+P++  V +  E  +        F+  G
Sbjct: 37  AISSGTVPVFAEPVKLDRPVQAPSFADVVDVVTPAVVSVRISGEAPETGTVATPFFDMPG 96

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
           F NLP +HPL+ +F +   +      P        +  GSGFFI+ DGYI+T+NH+VE G
Sbjct: 97  FDNLPPNHPLRRFFDEFQRRDEQPRGPQQRRRTRPVAQGSGFFISGDGYIVTNNHVVEGG 156

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
             ++V+L D TEL A L+G D   DLAVLKV++DR+F  V + + +  RVG+ V  +GNP
Sbjct: 157 NQYTVVLEDGTELQADLIGKDPRTDLAVLKVKADREFTYVTWANDDAARVGDWVVAVGNP 216

Query: 193 FRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L GTV+AGIVSA  R+I       F QIDA +NQGNSGGP FN  G V+GVN  I + 
Sbjct: 217 FGLGGTVTAGIVSARGREIGAGNYDDFLQIDAAVNQGNSGGPTFNLAGEVVGVNTAIFSP 276

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
              ++G+   IP S+ K  +  LI  G V+ G+ G+  Q +T ++A  LGL+  +G+LI 
Sbjct: 277 SGGNVGIAFAIPASLAKTVVEQLIEDGSVERGYMGVSIQEVTPQIAESLGLQDARGALIN 336

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
           +     PA +AG++ GDV+  ++G+ I + ++    +A+  P  ++ +++ + G     +
Sbjct: 337 SANSGDPAARAGIQAGDVVIAVNGKTIATPRELARTVAAIQPGTEIDVTVWRNGKSQDFS 396

Query: 372 VVLGSSPTAKNDM--------HLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVE 423
           V L   P                E G     G+ +   +DGN     +V  +       E
Sbjct: 397 VTLTEMPDTDQVASAAPSAPSQDEGGQPASFGLTVAPADDGN----GLVVTDVEPGSVAE 452

Query: 424 AKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFV 483
             GIQ G  I ++N+  V+   D+++    A    R +VLLQ+  D        + +RFV
Sbjct: 453 ENGIQPGDVIRAINSQPVTTAGDLKKAADAASSAGRGAVLLQVVRD--------DANRFV 504

Query: 484 SLKI 487
           +L I
Sbjct: 505 ALPI 508


>gi|330937659|gb|EGH41563.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 481

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 130/501 (25%), Positives = 221/501 (44%), Gaps = 32/501 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRK---DFHKFFSGEEPILSDTVERLMFGSGFFIT 117
                          LP    L+ +  +      +             E    GSGF I+
Sbjct: 54  PDRAVANQQMPDLEGLPPM--LREFLERSMPPGSRPPGSGAGKGDRQREAQSLGSGFIIS 111

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGY+LT+NH+++      V LSD +EL AKLVGTD   D+AVLK++        +  ++
Sbjct: 112 PDGYVLTNNHVIDGADEILVRLSDRSELKAKLVGTDPRTDVAVLKIEGKDL-PTAKLGNS 170

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFN 236
           N ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN
Sbjct: 171 NTLKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFN 230

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++L
Sbjct: 231 MAGEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKANGKVSRGWLGVVIQEVNKDL 290

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     +
Sbjct: 291 AESFGLDKPAGALVAQVLEDGPAAKGGVQVGDVILSANGQPIVMSADLPHLIGNLKDGSK 350

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDM-----HLEVGDKELLGMVLQDINDGNKKLV-- 409
            ++ + ++G +  + V +G+ P    +M              LG+ + ++    KK +  
Sbjct: 351 AELEVIRDGKRQKLTVTVGALPDEGQEMGDVGGTGAERSSNRLGVSVIELTAEQKKSLDL 410

Query: 410 -RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
              VA+           G+Q G  I  +N   ++  K    +     + +  S+ +    
Sbjct: 411 KGGVAIKEVTGGPASLIGLQAGDVITHLNNQAITSSKQFTEVAKNLPKDRSVSMRVL--- 467

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
                      + F++ K+ +
Sbjct: 468 -------RQGRATFITFKLSE 481


>gi|53725361|ref|YP_102335.1| serine protease, MucD [Burkholderia mallei ATCC 23344]
 gi|52428784|gb|AAU49377.1| serine protease, MucD [Burkholderia mallei ATCC 23344]
          Length = 461

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 118/474 (24%), Positives = 212/474 (44%), Gaps = 38/474 (8%)

Query: 32  KLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFH 91
                  D   ++ RV P++V++                       ++  +  +FR+ F 
Sbjct: 3   AARAGLPDFADLVERVGPAVVNIRTTANVPADTRGALPPGL-----DNGDMSEFFRRFFG 57

Query: 92  KFFSGEEPIL---------SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDD 142
                               DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D 
Sbjct: 58  IPLPQGPGGQKNAPSTPDAPDTEQNRGVGSGFILSPDGYVMTNAHVVDDADTIYVTLTDK 117

Query: 143 TELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAG 202
            E  AKL+G D   D+A++K+ +      V   D+N +RVGE V  IG+PF L  TV+AG
Sbjct: 118 REFKAKLIGVDERTDVAIVKINASSL-PTVAIGDSNRVRVGEWVVAIGSPFGLDNTVTAG 176

Query: 203 IVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLII 262
           IVSA  R+  D    F Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   I
Sbjct: 177 IVSAKGRNTGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAI 235

Query: 263 PLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKA 322
           P+    +    L + G+V  G   +    +T+E+A  +GL   +G+L+++V    PADKA
Sbjct: 236 PIDEAMRVAEQLKASGKVTRGRIAVAIGEVTKEVADSIGLPKAEGALVSSVEPGGPADKA 295

Query: 323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN 382
           G++ GD+I   +GR +++  D    +    P  +  +++ ++G    + + +   P  K 
Sbjct: 296 GLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKATVTVWRKGQSRDLPITIAEFPADKA 355

Query: 383 ------DMHLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMT 432
                     +      LG+ + D++    K +     +       +      G+Q+G  
Sbjct: 356 AKADSRQAPQQKPRSSALGLTVSDLSPEQLKTLKLRNGVQIDAV--DGPASRAGLQRGDI 413

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           ++ V   +++  K    +  K   ++  +VL++              ++F+ ++
Sbjct: 414 VLRVGDVDITSAKQFVDVTSKLDPQRAVAVLVR----------RGENTQFIPIR 457



 Score = 70.2 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 272 SIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKAT 331

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 332 VTV----------WRKGQSRDLPITIAE 349


>gi|330981449|gb|EGH79552.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 481

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 130/501 (25%), Positives = 220/501 (43%), Gaps = 32/501 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRK---DFHKFFSGEEPILSDTVERLMFGSGFFIT 117
                          LP    L+ +  +      +             E    GSGF I+
Sbjct: 54  PDRAVANQQMPDLEGLPPM--LREFLERSMPPGSRPPGSGAGKGDRQREAQSLGSGFIIS 111

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGY+LT+NH+++      V LSD +EL AKLVGTD   D+AVLK+         +  ++
Sbjct: 112 PDGYVLTNNHVIDGADEILVRLSDRSELKAKLVGTDPRTDVAVLKIDGKDL-PTAKLGNS 170

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFN 236
           N ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN
Sbjct: 171 NTLKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFN 230

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++L
Sbjct: 231 MAGEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKANGKVSRGWLGVVIQEVNKDL 290

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     +
Sbjct: 291 AESFGLDKPAGALVAQVLEDGPAAKGGVQVGDVILSANGQPIVMSADLPHLIGNLKDGSK 350

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDM-----HLEVGDKELLGMVLQDINDGNKKLV-- 409
            ++ + ++G +  + V +G+ P    +M              LG+ + ++    KK +  
Sbjct: 351 AELEVIRDGKRQKLTVTVGALPDEGQEMGDVGGTGAERSSNRLGVSVIELTAEQKKSLDL 410

Query: 410 -RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
              VA+           G+Q G  I  +N   ++  K    +     + +  S+ +    
Sbjct: 411 KGGVAIKEVTGGPASLIGLQAGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL--- 467

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
                      + F++ K+ +
Sbjct: 468 -------RQGRATFITFKLSE 481


>gi|223934838|ref|ZP_03626757.1| protease Do [bacterium Ellin514]
 gi|223896291|gb|EEF62733.1| protease Do [bacterium Ellin514]
          Length = 517

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 138/524 (26%), Positives = 238/524 (45%), Gaps = 54/524 (10%)

Query: 2   FKRQILSVKS---ICTVALTCVIFSSTYLVLEAKLPPSSV-------------------- 38
            KR  L + S   +  +A   V+  S+  V    +   +                     
Sbjct: 1   MKRSFLKLCSNLRVSLLAGALVVAGSSLAVNHLVMANDAPKVTTVALNVNDTPVQRDGRF 60

Query: 39  --DLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS- 95
                PV+ +V+PS+V V V  K K               P++  L+ +F   F+     
Sbjct: 61  GTSFAPVVKKVAPSVVKVEVTSKSKN------MDLPNSPYPDEDFLRRFFGDQFNPRGGA 114

Query: 96  --GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
                     + ++   GSG  +  DGYILT+NH+VED     V L+D  E  AK++G D
Sbjct: 115 GPNRGGRTMRSPKQYGLGSGVIVNKDGYILTNNHVVEDADEIKVSLNDGREFTAKVIGRD 174

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDR-DIP 212
              D+AV+K+ +      +   D++ I VG+    IGNPF +  +V+ GI+SA  R ++ 
Sbjct: 175 PKTDIAVIKIDAKDLPP-ITIADSDKIEVGDISLAIGNPFGIGQSVTMGIISATGRGNVG 233

Query: 213 DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
                F Q DA IN GNSGG   +A G +IG+N  I++    + GVG  +P+++ +  + 
Sbjct: 234 VDYEDFLQTDAAINPGNSGGALVDADGRLIGINTAILSRSGGYQGVGFAVPINLARNVME 293

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
           SLI  GRV  G+ G+  Q+L   L+    L   KG+L+  V  +SPA KAG+K GDVI  
Sbjct: 294 SLIKNGRVVRGFLGVSIQDLNPSLSKTFKLPDEKGALVGDVSPDSPALKAGIKSGDVILT 353

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE 392
            + + +   +    Q+A  +P   V + + +EG + ++ V+L   P ++     + G+  
Sbjct: 354 FNNKPVSDSRHLKLQVAQTTPGSSVPVKVLREGKEQTLKVLLKELPGSEKTERADNGNSN 413

Query: 393 ----LLGMVLQDINDGNKKLVRI-------VALNPNREREVEAKGIQKGMTIVSVNTHEV 441
               L G+ + D+++  +  + +          + +++      G++ G  I  +N   V
Sbjct: 414 DNDALHGVAVADLDNQARNQLGVPKNLEGAAVSDVDQDSAAYEAGLRPGDIIQEINRQPV 473

Query: 442 SCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
               +  +L    K+    ++LL++       SG    SR+V +
Sbjct: 474 HNADEAVKLTENLKD---KAILLKVWSKRGEASG----SRYVVV 510


>gi|322418239|ref|YP_004197462.1| protease Do [Geobacter sp. M18]
 gi|320124626|gb|ADW12186.1| protease Do [Geobacter sp. M18]
          Length = 477

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 136/473 (28%), Positives = 225/473 (47%), Gaps = 38/473 (8%)

Query: 21  IFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDH 80
              +    +   +  +      ++  V+PS+V++    KKK+               E  
Sbjct: 36  TAPAPVQEVPKDILNTQQAFTTLVKSVTPSVVNISTVGKKKLVRP----------FFEGS 85

Query: 81  PLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILS 140
           P   +F   F                    GSGF +  +GYI+T++H+V D  +  V LS
Sbjct: 86  P---FFDDFFGDRG------RPQYRRETSLGSGFILNPEGYIVTNDHVVRDAETIQVKLS 136

Query: 141 DDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVS 200
           +++    K++G+D   D+AV+K+ +          D+  ++VG+    IGNPF L  TV+
Sbjct: 137 NESVYTGKVIGSDPKTDIAVIKINAKEPLPAAVLGDSTKLQVGQWAIAIGNPFGLDRTVT 196

Query: 201 AGIVSALDRDIP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
            G+VSA  R     +    F Q DA IN GNSGGP  N  G VIG+N  IV       G+
Sbjct: 197 VGVVSATGRSNMGIETYEDFIQTDASINPGNSGGPLLNIYGEVIGINTAIVA---AGQGI 253

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  IP+++ K+ +  LISKG V  GW G+  Q++T+E+A   GL    G+L+  VV   P
Sbjct: 254 GFAIPVNMAKQVVTQLISKGNVTRGWLGVSIQSVTEEMAKSFGLPKASGALVNDVVPGGP 313

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+  GD+I   +G  +K  +     +   +  ++V++ L ++G K  V V    + 
Sbjct: 314 AAKAGIMQGDIITGFNGANVKDVRQLQRLVGETAIGKKVEVELYRDGKKLKVYVTTAPAE 373

Query: 379 TAKNDMHLEVGDKE--LLGMVLQDINDGNKKL--VRIVALNPNREREVEAKGIQKGMTIV 434
           +A+    ++  ++E  LLG+ ++++    ++     +V  +       E  GIQ+G  IV
Sbjct: 374 SAQAQSQMQRPEREAGLLGLSVEELGPEMRRSGMAGVVVSDLEPGGIAEQSGIQRGDIIV 433

Query: 435 SVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           SVN  +V  + + +R +  A    R +V L IK          N S + +LK+
Sbjct: 434 SVNQKKVRNLAEYQRAMKDA--ANRGAVALLIKRG--------NASIYFALKL 476


>gi|124516215|gb|EAY57723.1| Peptidase S1C, Do [Leptospirillum rubarum]
          Length = 500

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 141/508 (27%), Positives = 238/508 (46%), Gaps = 49/508 (9%)

Query: 2   FKRQILSVKSICTVALTCVIFSS-----TYLVLEAKLPPS------------SVDLPPVI 44
            KR  + + ++ ++A    +  S     T +   A  PP                   V 
Sbjct: 6   LKRFFVGIATLTSLAFVFSLAFSLDEKKTAMADPAPDPPVIHKKDIEAGLALQKAFVTVS 65

Query: 45  ARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDT 104
             V PS+V++            +FN               +FR+ F   F+         
Sbjct: 66  NAVIPSVVNISTTSLITTHQNPIFN-------------DPFFRQFFGTPFNHGGGPPQKH 112

Query: 105 VERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
           VER   GSGF I+ DGYI+T+ H+++     +V+LSD T   AK+VG D + D+AV+++ 
Sbjct: 113 VER-SLGSGFIISKDGYIVTNYHVIKHATKVTVVLSDKTSYRAKVVGKDPMTDVAVIRIH 171

Query: 165 SDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIP--DRPGTFTQID 222
                  + +  + ++ VG  V  +G+PF L  +++ GIVSAL R     ++   F Q D
Sbjct: 172 PKHDLPVIRWGSSRDVSVGTIVLAMGSPFGLTQSITMGIVSALKRSNMGIEQYENFIQTD 231

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
           A IN GNSGGP  N  G VIG+N  I T+   + G+G  IP+ ++++ +  L++KG+V  
Sbjct: 232 AAINPGNSGGPLVNLKGEVIGMNTAIYTTNGGYEGIGFAIPVDMVRRVLKDLMTKGKVVR 291

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           GW G+  QN+T  +A    L G +G L++ V+  SPA KAGMK GDVI  L+G+ +    
Sbjct: 292 GWLGVSIQNVTPVIAKQFRLPGHRGVLVSDVLPNSPAKKAGMKRGDVILGLNGQDVMDAN 351

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT-------AKNDMHLEVGDKELLG 395
           D   +++  +P     +S+ ++G + ++ V +G  P+       A+ +      D  L G
Sbjct: 352 DLRLRVSQIAPGTDATLSIIRDGRRRNITVRVGELPSKLSMMGGAEPEKSPSHFDNVLNG 411

Query: 396 MVLQDINDGNKKLV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVE 448
           +++ D+N   +  +        +V          EA G+++G  I  +N   V+ +    
Sbjct: 412 IMVMDLNRDIRGQLNLPDNTRGVVISAIAPGSLAEASGLKRGDVIQEINRRPVTSVHAYI 471

Query: 449 RLIGKAKEKKRDSVLLQIKYDPDMQSGN 476
           R+       K ++VLL +  D      +
Sbjct: 472 RVARHI--GKSENVLLTVLRDGHHSYVS 497



 Score = 70.9 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 12/105 (11%), Positives = 38/105 (36%), Gaps = 16/105 (15%)

Query: 391 KELLGMVLQDINDGNKKLV------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
           +  LG+ +Q++     K         ++  +       +  G+++G  I+ +N  +V   
Sbjct: 291 RGWLGVSIQNVTPVIAKQFRLPGHRGVLVSDVLPNSPAKKAGMKRGDVILGLNGQDVMDA 350

Query: 445 KDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            D+   + +       ++              D   R +++++ +
Sbjct: 351 NDLRLRVSQIAPGTDATL----------SIIRDGRRRNITVRVGE 385


>gi|66047182|ref|YP_237023.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae pv.
           syringae B728a]
 gi|12661187|gb|AAK01318.1| MucD [Pseudomonas syringae pv. syringae FF5]
 gi|63257889|gb|AAY38985.1| Peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae pv.
           syringae B728a]
 gi|330898511|gb|EGH29930.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330950061|gb|EGH50321.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae Cit
           7]
          Length = 481

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 130/501 (25%), Positives = 221/501 (44%), Gaps = 32/501 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRK---DFHKFFSGEEPILSDTVERLMFGSGFFIT 117
                          LP    L+ +  +      +             E    GSGF I+
Sbjct: 54  PDRAVANQQMPDLEGLPPM--LREFLERSMPPGSRPPGSGAGKGDRQREAQSLGSGFIIS 111

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGY+LT+NH+++      V LSD +EL AKLVGTD   D+AVLK++        +  ++
Sbjct: 112 PDGYVLTNNHVIDGADEILVRLSDRSELKAKLVGTDPRTDVAVLKIEGKDL-PTAKLGNS 170

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFN 236
           N ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN
Sbjct: 171 NTLKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFN 230

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++L
Sbjct: 231 MAGEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKANGKVSRGWLGVVIQEVNKDL 290

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     +
Sbjct: 291 AESFGLDKPAGALVAQVLEDGPAAKGGVQVGDVILSANGQPIVMSADLPHLIGNLKDGSK 350

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDM-----HLEVGDKELLGMVLQDINDGNKKLV-- 409
            ++ + ++G +  + V +G+ P    +M              LG+ + ++    KK +  
Sbjct: 351 AELEVIRDGKRQKLTVTVGALPDEGQEMGDVGGTGAERSSNRLGVSVIELTAEQKKSLDL 410

Query: 410 -RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
              VA+           G+Q G  I  +N   ++  K    +     + +  S+ +    
Sbjct: 411 KGGVAIKEVTGGPASLIGLQAGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL--- 467

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
                      + F++ K+ +
Sbjct: 468 -------RQGRATFITFKLSE 481


>gi|237729469|ref|ZP_04559950.1| serine endoprotease [Citrobacter sp. 30_2]
 gi|226909198|gb|EEH95116.1| serine endoprotease [Citrobacter sp. 30_2]
          Length = 477

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 125/484 (25%), Positives = 221/484 (45%), Gaps = 22/484 (4%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLV---LEAKLPPSSVDLPPVIARVSPSIVSVMVEP 58
            K+  L++ ++       +   S         A        L P++ +V PS+VS+ VE 
Sbjct: 1   MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAPMLEKVMPSVVSINVEG 60

Query: 59  KKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF-----SGEEPILSDTVERLMFGSG 113
              V+  +M   +      ++ P            F      G +       + +  GSG
Sbjct: 61  STTVNTPRMPRNFQ-QFFGDNSPFCQDGSPFQSSPFCQGGAPGADNGGGQQQKFMALGSG 119

Query: 114 FFITD-DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
             I    GY++T+NH+V++     V LSD  +  AK+VG D   D+A++++Q  +    +
Sbjct: 120 VIIDAAKGYVVTNNHVVDNATVIKVQLSDGRKFDAKIVGKDPRSDIALIQIQDPKNLTAI 179

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNS 230
           +  D++ +RVG+    IGNPF L  TV++GIVSAL R   +      F Q DA IN+GNS
Sbjct: 180 KLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNS 239

Query: 231 GGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQ 290
           GG   N  G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM  
Sbjct: 240 GGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEFGQVKRGELGIMGT 299

Query: 291 NLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIAS 350
            L+ ELA  + +   +G+ ++ V+  S A KAG+K GDVI  L+G+ I S      Q+ +
Sbjct: 300 ELSSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGT 359

Query: 351 RSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVR 410
                ++ + L ++G   +V + L    +++  +      K + G  + +      +   
Sbjct: 360 MPVGSKITLGLLRDGKPVTVNLELQQ--SSQTQVDSSSIFKGIEGADMSN----KGQDKG 413

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
           +V  +          G++KG  I+  N   V  I ++ +++    + K   + L I+   
Sbjct: 414 VVVSDVKPNSPAAQIGLKKGDVIIGANQQPVKNIAELRKIL----DSKPAVLALNIQRGD 469

Query: 471 DMQS 474
               
Sbjct: 470 SSIY 473


>gi|323526863|ref|YP_004229016.1| protease Do [Burkholderia sp. CCGE1001]
 gi|323383865|gb|ADX55956.1| protease Do [Burkholderia sp. CCGE1001]
          Length = 506

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 126/514 (24%), Positives = 219/514 (42%), Gaps = 51/514 (9%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
            SV+     A+             A    +  D   ++ +V P++V++    +   S   
Sbjct: 4   FSVRKFLAAAVVAACLPFAPHTASAASAANLPDFTDLVDKVGPAVVNIRTTTRVTSSGGP 63

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-----------------------PILSD 103
                      +D  +  +FR+ F                               P  +D
Sbjct: 64  RGALPPGM---DDGDMSEFFRRFFGIPMPQSPQSPGAPRGGDNGGSGGSGGSQDGPDSND 120

Query: 104 TVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKV 163
             +    GSGF ++ DGY++T+ H+++D  +  V L+D  E  AKL+G D   D+AV+K+
Sbjct: 121 PEQNSGVGSGFILSADGYVMTNAHVIDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKI 180

Query: 164 QSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDA 223
            +      +   D+N +RVGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D 
Sbjct: 181 SAANL-PTITIGDSNKVRVGEWVVAIGSPFGLENTVTAGIVSAKGRDTGDYLP-FIQTDV 238

Query: 224 PINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG 283
            +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L + G+V  G
Sbjct: 239 AVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKASGKVVRG 298

Query: 284 WFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQD 343
              +    +T+++A  LGL   +G+L+++V    PADKAG++ GD+I   +G  + +  D
Sbjct: 299 RIAVAIGEVTKDVADSLGLPKAQGALVSSVEPGGPADKAGVQPGDIILKFNGHSVDTATD 358

Query: 344 FVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-------ELLGM 396
               +    P  +  I++ ++G    + V +      K     +   +         LG+
Sbjct: 359 LPRMVGDTKPGTKATITVWRKGQTRDLPVTIAEMQPDKTSKADQKKPQAPKQRATNALGL 418

Query: 397 VLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
            + DI     + +     +       +      G+QKG  I+ V   +++  K  + L  
Sbjct: 419 AVSDIPADQLRTLKLRNGVQIDAV--DGPAARVGLQKGDIILRVGDTDITSAKQFDELTA 476

Query: 453 KAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
               +K  ++L++              ++FV ++
Sbjct: 477 HLDSQKMVALLVR----------RGENTQFVPIR 500


>gi|77165920|ref|YP_344445.1| peptidase S1C, Do [Nitrosococcus oceani ATCC 19707]
 gi|254433307|ref|ZP_05046815.1| protease Do subfamily [Nitrosococcus oceani AFC27]
 gi|76884234|gb|ABA58915.1| Peptidase S1C, Do [Nitrosococcus oceani ATCC 19707]
 gi|207089640|gb|EDZ66911.1| protease Do subfamily [Nitrosococcus oceani AFC27]
          Length = 471

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 138/497 (27%), Positives = 232/497 (46%), Gaps = 37/497 (7%)

Query: 2   FKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKK 61
            KR +    ++  ++L   +                 D   ++   SP++V++    K  
Sbjct: 1   MKRFLNKQWALLAISLLIAVTGQAA---------GLPDFTELVKNNSPAVVNISTTQKIT 51

Query: 62  VSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGY 121
               ++   +G   LPE  P ++     F + F  E      + E    GSGF I+ DGY
Sbjct: 52  QGGSRL--PHGLHQLPEGSPFED-----FFRRFFDEGTGEPRSFETHSLGSGFVISSDGY 104

Query: 122 ILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIR 181
           I+T+NH+++D     V  SD  EL A++VG+D   DLA+LKV++       +   +  ++
Sbjct: 105 IITNNHVIQDADEIIVRFSDRRELEAEVVGSDESSDLALLKVEAKDLPTLRQSNAS-QLK 163

Query: 182 VGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGH 240
           VGE V  IG+PF    + +AGIVSAL R +P+     F Q D  IN GNSGGP FN +G 
Sbjct: 164 VGEWVLAIGSPFGFEHSATAGIVSALGRSLPEESYVPFIQTDVAINPGNSGGPLFNLMGE 223

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           V+G+N+ I +     MG+   IP+ +  + +  L  KGRV  GW G++ Q++T+ELA   
Sbjct: 224 VVGINSQIYSRTGGFMGLSFAIPIDVAMEVVDQLKEKGRVTRGWLGVVIQDVTRELAESF 283

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GL   +G+L+  V+ +SPA K G++VGD+I   +G+ +         +      E V I 
Sbjct: 284 GLGKPQGALVARVLADSPAAKGGVQVGDIILDFNGKSVPRSAALPPLVGRAEIGETVDIQ 343

Query: 361 LCKEGSKHSVAVVLGSSPT----AKNDMHLEVGDKELLGMVLQDINDGNKKLVRIV---- 412
           + + G + ++ + +G  P      K     +   +E L + + D+    +  + +V    
Sbjct: 344 ILRAGDEKTLKIKIGELPEKKELEKATGKPDHIFEERLALEIADLKKEERTQLDVVSGVR 403

Query: 413 ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM 472
                        GI+ G  I+S+N  E+      + L  K    K   +LLQ       
Sbjct: 404 VTKVEEG-PAFEAGIRHGDIILSINNTEIKDTAQFKELAKKLPAGKAVPLLLQ------- 455

Query: 473 QSGNDNMSRFVSLKIDK 489
               +  + F+++ I +
Sbjct: 456 ---REQTTSFIAITIPE 469


>gi|297620673|ref|YP_003708810.1| DO serine protease [Waddlia chondrophila WSU 86-1044]
 gi|297375974|gb|ADI37804.1| DO serine protease [Waddlia chondrophila WSU 86-1044]
          Length = 483

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 138/487 (28%), Positives = 237/487 (48%), Gaps = 29/487 (5%)

Query: 10  KSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFN 69
            S+    +  V F  +    +  L  +S+D   V+ + +P++VSV V+ K K +  Q  +
Sbjct: 14  WSMVAAFMAFVCFPISGFCKDQPLGRTSLDFTEVVKKATPAVVSVKVKSKTKRNSFQFGD 73

Query: 70  AYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIV 129
           +  F     D    ++F +        +EP           GSGF I++DGYILT+ H+V
Sbjct: 74  SDPFDFFNHDDFFGHFFGRRPRSPAHPQEPQYQ-----TGQGSGFIISEDGYILTNGHVV 128

Query: 130 EDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTI 189
                 SV+ +D  E  A+L+G D+  D+AV+K+        +   +++++ VG+ V  I
Sbjct: 129 NGAEEISVLFNDGREYNAELIGIDSSTDIAVIKINDKNL-PYLNLGNSDDLEVGQWVIAI 187

Query: 190 GNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
           GNP  L+ +V+AG+VSA  R   D  R   F Q DA IN+GNSGGP  +  G+VIG+N  
Sbjct: 188 GNPLGLQASVTAGVVSAKGRSGLDLARIEDFIQTDAAINRGNSGGPLLDLDGNVIGMNTA 247

Query: 248 IVTSGQF--HMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGT 305
           IVT+     +MG+G  IP ++I+  +  LI+ G V  G+ GI  Q +   LA    L   
Sbjct: 248 IVTNMGSGGYMGIGFAIPSNMIQNIMEQLIANGSVTRGFIGINLQPIDNNLAQSFSLSKV 307

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           KG+L++ V  +SPA KAG+K GD+I   +G+ + +       ++   P  ++ + + ++G
Sbjct: 308 KGALVSDVTPDSPAQKAGLKQGDIILDYNGKEVSTISSLRNAVSFMKPGSKITLKVLRDG 367

Query: 366 SKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV------RIVALNPNRE 419
            +  + + +G  P  +    +       LG+ ++ +       +       +V    +  
Sbjct: 368 KEIHIPLTVGEFPDEEE---IASSKTNKLGIEVKPLTADIAHNLGYVDLKGVVVSKISAG 424

Query: 420 REVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNM 479
                 GI++G  I +VN  ++  ++   + I KA    +  +LL +K    M       
Sbjct: 425 SPAAMAGIKQGALITAVNHVKIDSVEAFNQQISKA--DPQKPILLLVKQGDYMH------ 476

Query: 480 SRFVSLK 486
             FVS+K
Sbjct: 477 --FVSIK 481


>gi|74474903|dbj|BAE44436.1| antigenic protein Et 49 [Edwardsiella tarda]
          Length = 471

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 130/478 (27%), Positives = 223/478 (46%), Gaps = 16/478 (3%)

Query: 2   FKR--QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPK 59
            K+   +LS  ++        + +S      A    +   L P++ +V PS+VS+ VE  
Sbjct: 1   MKKTTLVLSAVALSLGMALSPMSASAAETSSATTAQALPSLAPMLEKVMPSVVSINVEGS 60

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD- 118
             V+  ++   +      ED PL                            GSG  I   
Sbjct: 61  ATVNNSRVPPQFQ-QFFGEDSPLCQPGSPFGDSPMCQGGGNAPSKERFKALGSGVIIDAG 119

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
            GY++T+NH+V +  S  V LSD     AK++GTD   D+A+++++  +    ++  D++
Sbjct: 120 KGYVVTNNHVVANADSIKVQLSDGRRFDAKVIGTDPRTDIALIQLKDAKNLTAIKMADSD 179

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGGPCFN 236
           N+RVG+    IGNP+ L  TV++GIVSAL R   +      F Q DA IN+GNSGG   N
Sbjct: 180 NLRVGDYAVAIGNPYGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGGALVN 239

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   L  EL
Sbjct: 240 LNGDLIGINTAILAPDGGNIGIGFAIPSNMVKNLTGQMVEYGQVKRGELGIMGTELNSEL 299

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  + +   +G+ I+ V+ +S A KAG+K  DVI  L+G+ I S   F  +I +     +
Sbjct: 300 AKAMKIDAQRGAFISQVLPKSAAAKAGLKRLDVIVSLNGKNISSFASFRAEIGTMPVGSK 359

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNP 416
           + + + ++G   +V V L    +A++ +  +     + G  L +          +   N 
Sbjct: 360 LALGIIRDGKPMNVEVTLEQ--SAQSQVASDNIFSGIEGAELSNA----AGGKGVKVDNV 413

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
            +       G+QKG  I+ VN H ++ I ++ +++      K   + L I+   +   
Sbjct: 414 KKGSTAARIGLQKGDVILGVNQHAIANIGELRKILDA----KPPVLALNIQRGDNTLY 467


>gi|218460930|ref|ZP_03501021.1| serine protease Do protein [Rhizobium etli Kim 5]
          Length = 510

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 172/496 (34%), Positives = 254/496 (51%), Gaps = 42/496 (8%)

Query: 8   SVKSICTVALTCVIFSS---TYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
           +V  I    L   +      +Y        P+      V+  VSP++VSV VE +     
Sbjct: 19  TVAGIAAAVLATGVPLEITRSYAEAVKVQAPAVPSFANVVDAVSPAVVSVRVENRVNPVA 78

Query: 65  EQM------FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTV------------- 105
           +        FN  GF +LP+DHPLK +FR+        +                     
Sbjct: 79  DNNDGFSFDFNGRGFDDLPDDHPLKRFFRQFGQDPNDQQGHQRRFGQNGPGGPNGPGKGR 138

Query: 106 -ERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQ 164
              +  GSGFFI++DGYI+T+NH+V DG +F  +++D TEL AKL+G D   DLAVLKV 
Sbjct: 139 LRPVAQGSGFFISEDGYIVTNNHVVSDGQAFVAVMNDGTELDAKLIGKDPRTDLAVLKVD 198

Query: 165 SD-RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQID 222
              +KF  V + D NN+RVG+ V  +GNPF L GTV+AGIVSA  RDI   P   + Q+D
Sbjct: 199 GKGKKFTYVNWADDNNVRVGDWVVAVGNPFGLGGTVTAGIVSARGRDIGSGPYDDYLQVD 258

Query: 223 APINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDH 282
           A +N+GNSGGP FN  G V+G+N  I +     +G+   IP S  +  +  L+  G+V  
Sbjct: 259 AAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGSVGIAFAIPASTARDVVADLMKDGQVSR 318

Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342
           GW G+  Q +T+++A  +GL    G+L+ A    SP DKAGMK GDV+  L+G  IK  +
Sbjct: 319 GWLGVQIQPVTKDIAESIGLSEPSGALVVAPQAGSPGDKAGMKAGDVVTALNGETIKDAR 378

Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKEL--------- 393
           D   +I +  P  +V++S+ + G   S+ V LG+ P  + D   +  ++           
Sbjct: 379 DLSRRIGAMQPGSKVELSVWRAGKAQSLQVELGTLPADQKDASADDNNQPQQPEAPASEK 438

Query: 394 ----LGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
               LG+ +   +DG      +     + + +   KGI++G  I SVN  EVS   DV +
Sbjct: 439 ALADLGLTVGPSDDGK----GLAITGIDPDSDAADKGIKEGEKITSVNNQEVSTPADVVK 494

Query: 450 LIGKAKEKKRDSVLLQ 465
           ++ +AK+  R   L Q
Sbjct: 495 VLNQAKKDGRTRALFQ 510


>gi|86748144|ref|YP_484640.1| peptidase S1C, Do [Rhodopseudomonas palustris HaA2]
 gi|86571172|gb|ABD05729.1| Peptidase S1C, Do [Rhodopseudomonas palustris HaA2]
          Length = 525

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 153/477 (32%), Positives = 233/477 (48%), Gaps = 17/477 (3%)

Query: 22  FSSTYLVLEAKLPPSSVD-LPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDH 80
           F+S  L  EA  P         ++++V P+++SV V+  +      +       +     
Sbjct: 56  FASPALAAEAAAPTGMPSGFGDLVSKVKPAVISVRVKIDEDSRTTPLIRNDDSDDNANPG 115

Query: 81  PLKNYFRKDFHKF-FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVIL 139
              +  R    +F F GE  +          GSGFFI+ DGY +T+ H+V+   S  V  
Sbjct: 116 MGDDQLRPFLKQFGFRGEGAMPKRHEMITGEGSGFFISPDGYAVTNYHVVDHAKSVQVTT 175

Query: 140 SDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
            D     AK+VGTD   DLA++KV     F  V+F      RVG+ V  +GNPF L GTV
Sbjct: 176 DDGAVHTAKVVGTDKKTDLALIKVDGKSDFTYVKFA-DQPARVGDWVVAVGNPFGLGGTV 234

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGIVSA  RDI   P   + QIDAPIN+GNSGGP F+  G+VIGVN  I +     +G+
Sbjct: 235 TAGIVSARGRDIGSGPYDDYVQIDAPINKGNSGGPAFDTSGNVIGVNTAIYSPSGGSVGI 294

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  IP +  K  I  L  KG V  GW G+  Q +T E+A  +GL+  +G+L+ +    SP
Sbjct: 295 GFDIPAATAKLVIAQLKDKGVVTRGWLGVQVQPVTAEIADSMGLKQARGALVDSPQDGSP 354

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A KAG+  GDVI  ++G  IK  +     I+  +P   VK+ +  +G   +V + L   P
Sbjct: 355 AAKAGIAAGDVITAVNGAEIKDSRALARTISMMAPGSAVKLDVLHKGDSKTVTLSLAEMP 414

Query: 379 TAKNDMH-----LEVGDKELLGMVLQDIND-GNKKLVRIVALNPNREREVEAKGIQKGMT 432
                +           +  LG+ +   ++ G+     +V    + E     +G++ G  
Sbjct: 415 NESAKVADSGDAGRESGRPYLGLRVAPASEVGDSGQKGVVVTGVDPEGPAADRGLRSGDV 474

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           I+ V    V+   DV   + +A E  + +VL+++K         D+ +RFV++ I K
Sbjct: 475 ILDVGGKPVANSGDVRDALKQASEHGKKTVLMRVK-------TADSAARFVAVPIAK 524


>gi|46579879|ref|YP_010687.1| peptidase/PDZ domain-containing protein [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|46449295|gb|AAS95946.1| peptidase/PDZ domain protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234120|gb|ADP86974.1| protease Do [Desulfovibrio vulgaris RCH1]
          Length = 482

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 137/480 (28%), Positives = 229/480 (47%), Gaps = 40/480 (8%)

Query: 29  LEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRK 88
                  S  D   +      ++V++  E   +       +     N P+  P   +F +
Sbjct: 20  SSTAQAASLPDFRELAKNAGAAVVNISTEKTVQAPENPFGDM--LRNAPQGTPFDRFFEQ 77

Query: 89  DFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT----E 144
            F +F     P      ++   GSGF ++ DGYI+T+NH++ D     V + ++T     
Sbjct: 78  -FERFHGKMRPQ-----KQRSLGSGFILSADGYIVTNNHVIADADVIHVNIENETGKSAS 131

Query: 145 LPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIV 204
             AK++GTD   DLA+LK+ + R+   + F D++++ VGE +  IGNPF L  +V+AGI+
Sbjct: 132 YDAKVIGTDEETDLALLKIDAKRQLPVLRFGDSDSLEVGEWLMAIGNPFGLDHSVTAGIL 191

Query: 205 SALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIP 263
           SA  RDI   P   F Q DA IN GNSGGP  N  G VIG+N  IV S     G+G  IP
Sbjct: 192 SAKGRDIRSGPFDNFLQTDASINPGNSGGPLINMKGEVIGINTAIVAS---GQGIGFAIP 248

Query: 264 LSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAG 323
            ++  + I  L S  +V  GW G+  Q++ +  A  LGL   +G+L+ +V+   PADKAG
Sbjct: 249 SNMAARIIDQLKSDKKVRRGWIGVTIQDVDENTARALGLGEPRGALVGSVMPGEPADKAG 308

Query: 324 MKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTA--- 380
           +K GD++  ++G  I      + ++A+  P E  KI+L + G   +V + LG        
Sbjct: 309 IKAGDILLKVEGEDIADSGRLLRRVAALKPGETAKITLWRNGQTKTVNLTLGERTAEHLA 368

Query: 381 ------KNDMHLEVGDKELLGMVLQDINDGNKKLV------RIVALNPNREREVEAKGIQ 428
                 +     +      LG+ ++  N    + +       ++ +     R      I+
Sbjct: 369 AQGGTPRQTPESKQQASSSLGLTVRPPNAEEARALKLDRPQGLLVIAVEEGRPAADADIR 428

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
            G  ++S N H V+   D+ +++ +   K+R +V+LQI+            + F ++ I+
Sbjct: 429 AGDVVLSANLHPVNSTADLAKVVQE-DAKRRGAVMLQIQRR--------GQTFFRTIPIE 479


>gi|254252849|ref|ZP_04946167.1| Trypsin-like serine protease [Burkholderia dolosa AUO158]
 gi|124895458|gb|EAY69338.1| Trypsin-like serine protease [Burkholderia dolosa AUO158]
          Length = 492

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 119/471 (25%), Positives = 215/471 (45%), Gaps = 41/471 (8%)

Query: 38  VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGE 97
            D   ++ +V P++V++        +        G     ++  +  +FR+ F       
Sbjct: 37  PDFADLVEKVGPAVVNIRTTANVPTAAR-----GGLPPGFDNGDMSEFFRRFFGIPLPPG 91

Query: 98  EP-----------ILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELP 146
                           DT +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  
Sbjct: 92  PGNGNPKNAPAPDNPPDTEQNRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFK 151

Query: 147 AKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSA 206
           AKL+G D   D+AV+K+Q+      V   D+N +RVGE V  IG+PF L  TV+AGIVS+
Sbjct: 152 AKLIGVDDRTDVAVVKIQASNL-PVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSS 210

Query: 207 LDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266
             R+  D    F Q D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+  
Sbjct: 211 KSRNTGDYLP-FIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDE 269

Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKV 326
             +    L + G+V  G   +    +T+++A  +GL   +G+L+++V    PADKAG++ 
Sbjct: 270 AMRVAEQLKATGKVTRGRIAVAIGEVTKDVAESIGLPKAEGALVSSVEPGGPADKAGIQP 329

Query: 327 GDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN---- 382
           GD+I   +GR + +  D    +    P  +  +++ ++G    + + +  +P        
Sbjct: 330 GDIILKFNGRSVDAASDLPRMVGDTKPGTKATVTVWRKGQARDLPITIAETPADTTAKAG 389

Query: 383 ---DMHLEVGDKELLGMVLQDINDGNKKLV----RIVALNPNREREVEAKGIQKGMTIVS 435
              ++  +      LG+ + DI     K +     +              G+Q+G  ++ 
Sbjct: 390 QRKNVPQKPRQNNSLGLTVSDIPADQMKSLKLKNGVQIDGVE--GPAARAGLQRGDIVLR 447

Query: 436 VNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           V   +++  K    +  +   +K  +VL++            + ++FV ++
Sbjct: 448 VGDTDITSAKQFAEVTAQLDPQKAVAVLVR----------RGDNTQFVPVR 488


>gi|76810909|ref|YP_334279.1| peptidase [Burkholderia pseudomallei 1710b]
 gi|76580362|gb|ABA49837.1| subfamily S1C unassigned peptidase [Burkholderia pseudomallei
           1710b]
          Length = 485

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 120/497 (24%), Positives = 217/497 (43%), Gaps = 38/497 (7%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           + +    A   V  +               D   ++ RV P++V++              
Sbjct: 4   LAAQSATAAPNVTTTPAATGAAPAARAGLPDFADLVERVGPAVVNIRTTANVPADTRGAL 63

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPIL---------SDTVERLMFGSGFFITDD 119
                    ++  +  +FR+ F                     DT +    GSGF ++ D
Sbjct: 64  PPGL-----DNGDMSEFFRRFFGIPLPQGPGGQKNAPSTPDAPDTEQNRGVGSGFILSPD 118

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GY++T+ H+V+D  +  V L+D  E  AKL+G D   D+A++K+ +      V   D+N 
Sbjct: 119 GYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDERTDVAIVKINASSL-PTVAIGDSNR 177

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALG 239
           +RVGE V  IG+PF L  TV+AGIVSA  R+  D    F Q D  +N GNSGGP  N  G
Sbjct: 178 VRVGEWVVAIGSPFGLDNTVTAGIVSAKGRNTGDYLP-FIQTDVAVNPGNSGGPLINMQG 236

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            VIG+N+ I +     MG+   IP+    +    L + G+V  G   +    +T+E+A  
Sbjct: 237 EVIGINSQIYSRTGGFMGISFAIPIDEAMRVAEQLKASGKVTRGRIAVAIGEVTKEVADS 296

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
           +GL   +G+L+++V    PADKAG++ GD+I   +GR +++  D    +    P  +  +
Sbjct: 297 IGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKATV 356

Query: 360 SLCKEGSKHSVAVVLGSSPTAKN------DMHLEVGDKELLGMVLQDINDGNKKLV---- 409
           ++ ++G    + + +   P  K           +      LG+ + D++    K +    
Sbjct: 357 TVWRKGQSRDLPITIAEFPADKAAKADSRQAPQQKPRSSALGLTVSDLSPEQLKTLKLRN 416

Query: 410 RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYD 469
            +       +      G+Q+G  ++ V   +++  K    +  K   ++  +VL++    
Sbjct: 417 GVQIDAV--DGPASRAGLQRGDIVLRVGDVDITSAKQFVDVTSKLDPQRAVAVLVR---- 470

Query: 470 PDMQSGNDNMSRFVSLK 486
                     ++F+ ++
Sbjct: 471 ------RGENTQFIPIR 481



 Score = 70.2 bits (169), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%), Gaps = 10/88 (11%)

Query: 402 NDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           + G  K    +  +       +  G+Q G  I+  N   V    D+ R++G  K   + +
Sbjct: 296 SIGLPKAEGALVSSVEPGGPADKAGLQPGDIILKFNGRPVEAASDLPRMVGDTKPGAKAT 355

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           V +               SR + + I +
Sbjct: 356 VTV----------WRKGQSRDLPITIAE 373


>gi|222053515|ref|YP_002535877.1| protease Do [Geobacter sp. FRC-32]
 gi|221562804|gb|ACM18776.1| protease Do [Geobacter sp. FRC-32]
          Length = 466

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 156/483 (32%), Positives = 234/483 (48%), Gaps = 31/483 (6%)

Query: 13  CTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYG 72
                TC +  S  L   A   P   D   +  ++ P++V++      K           
Sbjct: 8   LFALFTCSLALSVMLCGVAMAKPVLPDFVELAKKLKPTVVNISTAKTIKPQRR------- 60

Query: 73  FGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDG 132
               P + P  N   +DF   F  E        +    GSGF I+D+GYI+T+NH+V + 
Sbjct: 61  -FQRPFNSPFGNDPFQDFFDRFFDESQQHPYKQK--SLGSGFIISDEGYIITNNHVVAEA 117

Query: 133 ASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNP 192
               V LSD  E   ++ GTD   DLA+LK+ +          D++ I +GE V  IGNP
Sbjct: 118 DEIKVKLSDGREFKGEIKGTDEKLDLALLKISTKDHLPVAALGDSDKIEIGEWVMAIGNP 177

Query: 193 FRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTS 251
           F L  TV+AGI+SA  R I   P   F Q DA IN GNSGGP FNA G VIG+N  IV  
Sbjct: 178 FGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNAQGEVIGINTAIVAG 237

Query: 252 GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLIT 311
                G+G  IP+++ K  IP L  KG+V  GW G+  Q +T ELA    L+G KG+LI 
Sbjct: 238 ---GQGIGFAIPVNMAKNIIPMLKEKGKVTRGWIGVSIQPITPELAQSFELKGEKGALIA 294

Query: 312 AVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVA 371
            VVK+ PA+KAG+K GD+I   +GR I    +    +A+    +QV + + +EG    ++
Sbjct: 295 EVVKDGPAEKAGLKSGDIILEFNGRAIHEMNELPRMVAATPVDKQVNVKILREGKPVDLS 354

Query: 372 VVLGSSPTAKNDMHLEVGDKELLGMVLQDIND------GNKKLVRIVALNPNREREVEAK 425
           + +      + D       +E LG+ +++++       G K+   +V  +   E   E  
Sbjct: 355 INVERLKDGE-DGDQAGVSQEKLGITVRELSKDLAAKLGIKEQKGVVITDVKPESSAEQT 413

Query: 426 GIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSL 485
           GI KG  I  +N  +++ + D E+ +   K+     +LL+            +MS FV+ 
Sbjct: 414 GIAKGDIIREINGSKINSVGDYEKAVNGHKKGTVMRMLLR----------RGDMSLFVAF 463

Query: 486 KID 488
           ++D
Sbjct: 464 RVD 466


>gi|39936550|ref|NP_948826.1| peptidase S1C Do [Rhodopseudomonas palustris CGA009]
 gi|39650406|emb|CAE28929.1| probable serine protease [Rhodopseudomonas palustris CGA009]
          Length = 501

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 135/486 (27%), Positives = 222/486 (45%), Gaps = 32/486 (6%)

Query: 22  FSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHP 81
             +      A+ P     +  V  +V  ++V++                     LP   P
Sbjct: 29  VIAGPAPASARGPEG---IADVAEKVIDAVVNISTTQTVDAKGSGESKGGAAPQLPPGSP 85

Query: 82  LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSD 141
            + +F   F      +        +    GSGF I   G ++T+NH++ D    +VIL+D
Sbjct: 86  FEEFFEDFFKNRRGEKGGGP---RKTNSLGSGFIIDPAGVVVTNNHVIADSDEINVILND 142

Query: 142 DTELPAKLVGTDALFDLAVLKVQSD--RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
            T++ A+LVG D   DLAVLK +    +    V+F D++ +R+GE V  IGNPF L GTV
Sbjct: 143 GTKIKAELVGVDKKTDLAVLKFKPPAGKTLTAVKFGDSDKLRLGEWVIAIGNPFSLGGTV 202

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGIVSA +RDI   P   + Q DA IN+GNSGGP FN  G VIGVN +I++     +G+
Sbjct: 203 TAGIVSARNRDINSGPYDSYIQTDAAINRGNSGGPLFNLAGEVIGVNTLIISPSGGSIGI 262

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  +P   +   +  L   G +  GW G+  Q +T E+A  L ++  +G+L+  V  + P
Sbjct: 263 GFAVPSKTVVPVVDQLRQFGELRRGWLGVRIQQVTDEIAESLSIKPARGALVAGVDDKGP 322

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A  AG++ GDV+   DG+ IK  +D    +A  +  + V + + ++G + +  V LG   
Sbjct: 323 AKPAGIEPGDVVVKFDGKDIKEPKDLSRIVADTAVGKTVDVVVIRKGKEETKQVTLGRLD 382

Query: 379 TAKNDMHLEVGDKE---------LLGMVLQDINDGNKKLV-------RIVALNPNREREV 422
                       +          +LG+ L  ++   +           ++    +   + 
Sbjct: 383 DDAKPQPASAKSQPEADKPVTQKVLGLDLAALSKDLRGRYKIKDSVKGVLVTGVDDGSDA 442

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
             K +  G  IV V    V    D+++ + + K+  + SVLL +       +      RF
Sbjct: 443 AEKRLSAGDVIVEVAQESVGSAADIKKRVDQLKKDGKKSVLLLV-------ANASGELRF 495

Query: 483 VSLKID 488
           V+L + 
Sbjct: 496 VALSLQ 501


>gi|15618887|ref|NP_225173.1| DO Serine protease [Chlamydophila pneumoniae CWL029]
 gi|15836510|ref|NP_301034.1| DO serine protease [Chlamydophila pneumoniae J138]
 gi|9789769|sp|Q9Z6T0|DEGP_CHLPN RecName: Full=Probable serine protease do-like; Flags: Precursor
 gi|4377306|gb|AAD19116.1| DO Serine Protease [Chlamydophila pneumoniae CWL029]
 gi|8979352|dbj|BAA99186.1| DO serine protease [Chlamydophila pneumoniae J138]
          Length = 488

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 141/509 (27%), Positives = 244/509 (47%), Gaps = 41/509 (8%)

Query: 1   MFKRQILSVKSIC--TVALTCVIFSSTYLVLEAKLPPSSVD---------LPPVIARVSP 49
           M  +Q+ S  ++   +  L   +        E+++     D            V  + +P
Sbjct: 1   MITKQLRSWLAVLVGSSLLALPLSGQAVGKKESRVSELPQDVLLKEISGGFSKVATKATP 60

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM 109
           ++V +   PK +          G    P ++P   +  + F++FF           +  +
Sbjct: 61  AVVYIESFPKSQAVTHPSPGRRG----PYENPFDYFNDEFFNRFFGLPSQREKPQSKEAV 116

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            G+GF ++ DGYI+T+NH+VED     V L D  + PA ++G D   DLAV+K+   +  
Sbjct: 117 RGTGFLVSPDGYIVTNNHVVEDTGKIHVTLHDGQKYPATVIGLDPKTDLAVIKI-KSQNL 175

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQ 227
             + F ++++++VG+    IGNPF L+ TV+ G++SA  R+         F Q DA IN 
Sbjct: 176 PYLSFGNSDHLKVGDWAIAIGNPFGLQATVTVGVISAKGRNQLHIADFEDFIQTDAAINP 235

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP  N  G VIGVN  IV+    ++G+G  IP  +  + I  LI  G+V  G+ G+
Sbjct: 236 GNSGGPLLNIDGQVIGVNTAIVSGSGGYIGIGFAIPSLMANRIIDQLIRDGQVTRGFLGV 295

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +  ELA    L    G+L+T VVK SPADKAG+K  DVI   +G+ + S   F   
Sbjct: 296 TLQPIDAELAACYKLEKVYGALVTDVVKGSPADKAGLKQEDVIIAYNGKEVDSLSMFRNA 355

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKK 407
           ++  +P  ++ + + +EG    + V +  +P         +   + +G+ +Q++     K
Sbjct: 356 VSLMNPDTRIVLKVVREGKVIEIPVTVSQAPKEDG-----MSALQRVGIRVQNLTPETAK 410

Query: 408 LV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
            +        I+ ++        + GI  G  I++VN  +VS I+D+ R     K+   +
Sbjct: 411 KLGIAPETKGILIISVEPGSVAASSGIAPGQLILAVNRQKVSSIEDLNR---TLKDSNNE 467

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++LL +           ++ RF++LK ++
Sbjct: 468 NILLMV--------SQGDVIRFIALKPEE 488


>gi|255019679|ref|ZP_05291758.1| Serine protease precursor MucD/AlgY associated with sigma factor
           RpoE [Acidithiobacillus caldus ATCC 51756]
 gi|254970902|gb|EET28385.1| Serine protease precursor MucD/AlgY associated with sigma factor
           RpoE [Acidithiobacillus caldus ATCC 51756]
          Length = 487

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 126/508 (24%), Positives = 231/508 (45%), Gaps = 40/508 (7%)

Query: 1   MFKRQILSVKS-ICTVALTCVIFSSTYLVLEAKLPPSS-----VDLPPVIARVSPSIVSV 54
           M + +   +KS +  VA+   +       + A    +S      D  P++ +  P++V++
Sbjct: 1   MRRERFAGLKSPLVAVAVVLSLGIGALSPVYADAANTSTLVNLPDFTPIVRQYGPAVVNI 60

Query: 55  MVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGF 114
                K                P + PL  +F         G      D  +    GSGF
Sbjct: 61  STTETKVARNAGSP-------FPPNSPLNQFFAP--FFGPQGPGGGPEDKYQVQSLGSGF 111

Query: 115 FITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEF 174
            ++ DGYI+T+ H+V+      V L++  +  AKLVG     D+A+LK+ +      V+ 
Sbjct: 112 IVSPDGYIVTAAHVVKGAQKIIVSLTNHQQYEAKLVGLSTRIDVALLKIDAKNL-PTVQI 170

Query: 175 EDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGP 233
            D++ + VG+ V  +G PF    +V+ G+VSA  R +PD P   F Q D PIN GNSGGP
Sbjct: 171 GDSSKLEVGQWVLAVGAPFGFENSVTQGVVSATSRPLPDDPYIPFIQTDVPINPGNSGGP 230

Query: 234 CFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLT 293
            FN  G V+G+N  I T+   +MG+   IP+++   A+  L    +V  GW G+M Q+++
Sbjct: 231 LFNMRGQVVGINDQIYTNSGGYMGLSFSIPINVAMDAVKQLKLGQKVHFGWLGVMIQDVS 290

Query: 294 QELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSP 353
            +LA    ++   G+L++ VV   PA KAG+K GDVI   DG+ + +       + +   
Sbjct: 291 MDLAKSFHMKEPMGALVSQVVPNGPAAKAGIKPGDVIVSFDGQPVYNSAQLPPLVGALPA 350

Query: 354 KEQVKISLCKEGSKHSVAVVLGSSPTA--------KNDMHLEVGDKELLGMVLQDINDGN 405
             + K+ + ++G   ++ + + S P+         +     + GD + L + +  ++   
Sbjct: 351 GFKAKVGIIRDGKAMTLPITIESLPSDMNGKEEGQEPASPSQKGDIKRLNIKVGPLSASA 410

Query: 406 KKLV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
           ++ +     ++ L   +       G++ G  I+ V    V+ + D+++++      +   
Sbjct: 411 RQQLDVNSGVLVLGVGQG-PAGQAGVRPGDVILQVAQQPVTSVADLQKIVASLPAGQPIP 469

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           VLL               + +V L + +
Sbjct: 470 VLL----------HRAQGNFYVVLTLPR 487


>gi|87119814|ref|ZP_01075711.1| serine protease MucD precursor [Marinomonas sp. MED121]
 gi|86165290|gb|EAQ66558.1| serine protease MucD precursor [Marinomonas sp. MED121]
          Length = 464

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 131/458 (28%), Positives = 222/458 (48%), Gaps = 24/458 (5%)

Query: 34  PPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKF 93
                D   ++   SP++V++  E                   P    L  +FR  F + 
Sbjct: 25  AVQLPDFTELVEDSSPAVVNISTEQL------PATGQGQGQLNPNAKELNEFFRHFFGQQ 78

Query: 94  FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
              ++P      +R   GSGF I+ DGY+LT+NH+++      V L+D  E  A+LVGTD
Sbjct: 79  PLDKQPQR---KQRNSLGSGFIISQDGYVLTNNHVIDGADIIHVRLNDRREYQAELVGTD 135

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              DLA+LK+++D     V+  D+++++ G+ V  IG+PF    TV+AGIVSAL R++P 
Sbjct: 136 KRTDLALLKIEADDL-PTVKIGDSDDMKPGQWVLAIGSPFGFDYTVTAGIVSALGRNLPS 194

Query: 214 RPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
                F Q D  IN GNSGGP FN  G VIG+N+ I T     MGV   IP +++   + 
Sbjct: 195 DNYVPFIQTDVAINPGNSGGPLFNLDGEVIGINSQIYTRSGGFMGVSFAIPSNLVMSVVD 254

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L S+GRV   W G++ Q+++ +LA   GL    G+L++ V+ +SPA  AG+  GD+I  
Sbjct: 255 QLKSEGRVTRAWLGVIIQDVSNDLAESFGLDRPSGALVSRVIPDSPAQAAGLMDGDIILE 314

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE 392
            +G +I+   +  +++ +    +  +  + + G K  ++  L + P+  + +      + 
Sbjct: 315 FNGELIEQSSELPYRVGALKAGDLAESVIYRNGKKMDLSFTLENYPSDPDQLTQTQQQEN 374

Query: 393 LLGMVLQDINDGNKKLVRI---VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVER 449
            LGMV+ +I +   +  +I   V +           G+Q+G  I  +N   +  ++    
Sbjct: 375 RLGMVVGEIPEDMLRRFKIKNGVVVEQVLGGSAARNGLQQGDVITMLNGTSIDSVETFMS 434

Query: 450 LIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
            +   +     SV +++  D            F+  KI
Sbjct: 435 SVSDIQANH--SVPMRVIRDGF--------PMFIPFKI 462


>gi|260220632|emb|CBA28366.1| hypothetical protein Csp_A06910 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 492

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 133/456 (29%), Positives = 213/456 (46%), Gaps = 29/456 (6%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           +      +  +  P++V++ V+   K S        G   L    P   +FR+       
Sbjct: 61  TPASFADIAEQQGPAVVNISVQGAVKTSARS-----GVPQLDPRDPFYEFFRRF------ 109

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
            + P  SD       GSGF +  DG +LT+ H+V D +  +V L D  E  AK++G D L
Sbjct: 110 -QPPAESDNAPTRGTGSGFIVKADGVVLTNAHVVADASEVTVKLKDKREFKAKVLGIDKL 168

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD-R 214
            D+AVLK+ +      V+  D  N RVGE V  IG+PF    TV+AGIVSA  R +PD  
Sbjct: 169 SDVAVLKIDAKDL-PTVKIGDPKNSRVGEWVVAIGSPFGFENTVTAGIVSAKSRSLPDEG 227

Query: 215 PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q D  IN GNSGGP FN  G VIG+N+ I +    + G+   IP+ +  K    L
Sbjct: 228 YVPFLQTDVAINPGNSGGPLFNLAGEVIGINSQIYSRSGGYQGLSFAIPIDVAMKVEGQL 287

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           ++ G+V  G  G+  Q ++ ELA   GL    G+L+ +V K S ADKAG++ GDVI   +
Sbjct: 288 LAHGKVSRGRLGVTIQEVSPELAESFGLDKPAGALVNSVDKGSAADKAGLQAGDVILKFN 347

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL 394
           G  I    +    ++  +P     +S+ ++G    +++ LG   + K          + L
Sbjct: 348 GTAISQSSELPPLVSDTAPGSNAALSVWRQGKPKELSITLGQMESGKVAAESAAPQDKQL 407

Query: 395 GMVLQDINDGNK---KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           G+ ++ +N   +   ++   + +    +   +  G++ G  I+SVN    S    ++  +
Sbjct: 408 GLAVRPLNRQERAEAQVAGGLVVEDVADGPAKRAGLRSGDVILSVNGELASSPDTLKSQL 467

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           G+     R  + L +    D          FV + +
Sbjct: 468 GQ----GRKKMALLVLRGED--------RLFVPVTV 491


>gi|221124326|ref|XP_002162245.1| PREDICTED: similar to Serine protease HTRA2, mitochondrial [Hydra
           magnipapillata]
          Length = 438

 Score =  194 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 133/456 (29%), Positives = 213/456 (46%), Gaps = 29/456 (6%)

Query: 36  SSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS 95
           +      +  +  P++V++ V+   K S        G   L    P   +FR+       
Sbjct: 7   TPASFADIAEQQGPAVVNISVQGAVKTSARS-----GVPQLDPRDPFYEFFRRF------ 55

Query: 96  GEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDAL 155
            + P  SD       GSGF +  DG +LT+ H+V D +  +V L D  E  AK++G D L
Sbjct: 56  -QPPAESDNAPTRGTGSGFIVKADGVVLTNAHVVADASEVTVKLKDKREFKAKVLGIDKL 114

Query: 156 FDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD-R 214
            D+AVLK+ +      V+  D  N RVGE V  IG+PF    TV+AGIVSA  R +PD  
Sbjct: 115 SDVAVLKIDAKDL-PTVKIGDPKNSRVGEWVVAIGSPFGFENTVTAGIVSAKSRSLPDEG 173

Query: 215 PGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274
              F Q D  IN GNSGGP FN  G VIG+N+ I +    + G+   IP+ +  K    L
Sbjct: 174 YVPFLQTDVAINPGNSGGPLFNLAGEVIGINSQIYSRSGGYQGLSFAIPIDVAMKVEGQL 233

Query: 275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLD 334
           ++ G+V  G  G+  Q ++ ELA   GL    G+L+ +V K S ADKAG++ GDVI   +
Sbjct: 234 LAHGKVSRGRLGVTIQEVSPELAESFGLDKPAGALVNSVDKGSAADKAGLQAGDVILKFN 293

Query: 335 GRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELL 394
           G  I    +    ++  +P     +S+ ++G    +++ LG   + K          + L
Sbjct: 294 GTAISQSSELPPLVSDTAPGSNAALSVWRQGKPKELSITLGQMESGKVAAESAAPQDKQL 353

Query: 395 GMVLQDINDGNK---KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLI 451
           G+ ++ +N   +   ++   + +    +   +  G++ G  I+SVN    S    ++  +
Sbjct: 354 GLAVRPLNRQERAEAQVAGGLVVEDVADGPAKRAGLRSGDVILSVNGELASSPDTLKSQL 413

Query: 452 GKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           G+     R  + L +    D          FV + +
Sbjct: 414 GQ----GRKKMALLVLRGED--------RLFVPVTV 437


>gi|330720633|gb|EGG98889.1| HtrA protease/chaperone protein [gamma proteobacterium IMCC2047]
          Length = 469

 Score =  194 bits (491), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 145/498 (29%), Positives = 238/498 (47%), Gaps = 38/498 (7%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M +  +    S   +AL  ++FS +          S  D   +   + P++V++    + 
Sbjct: 1   MLRMNVK--LSFFALALASLLFSMSARAA------SLPDFTELADELKPAVVNISAVQEV 52

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           +     + N   + ++P        FR+ F +     +P      +    GSGF I++DG
Sbjct: 53  QTK-PALQNPELYQHVP------ELFRQFFGQMPQFHQPQR---RKAPSLGSGFIISEDG 102

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YILT+NH+V+      V L D  E  A+++G D   DLA+LK+ +D     VE  D ++I
Sbjct: 103 YILTNNHVVKGADKVLVRLIDRREFEAEVIGQDGRSDLALLKIDADHL-PVVELADPDDI 161

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSAL-DRDIPDRPGTFTQIDAPINQGNSGGPCFNALG 239
           +VGE V  IG+PF    +V+AGIVSA       D    F Q D  IN GNSGGP FN  G
Sbjct: 162 KVGEWVMAIGSPFGFDYSVTAGIVSATGRTSFQDSYVPFIQTDVAINPGNSGGPLFNLDG 221

Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIP 299
            V+G+N +IVT    +MG+   IP+S+    +  L +KG V  GW G+  Q+++++LA  
Sbjct: 222 EVVGINTIIVTRSGGYMGLSFAIPMSVAMDVVEQLKNKGEVSRGWLGVEIQDVSRQLAES 281

Query: 300 LGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKI 359
            GLR   G+ IT +V + PA  AG+KVGDVI   DG  +K   D    + S     +V +
Sbjct: 282 FGLRQASGAAITRLVPDGPAAAAGLKVGDVILNFDGYDVKLSSDLPHLVGSTKAGSKVTV 341

Query: 360 SLCKEGSKHSVAVVLGSSPTAKNDMHLEV-----GDKELLGMVLQDINDGNKKLVRI--- 411
            + + G K  + VV+G  P        +      G+ E L M++ ++ND  ++   I   
Sbjct: 342 EVFRNGKKKKLTVVVGDLPQEFVADRSQKNQPARGEIERLNMIVDNLNDQLRERTGIDEG 401

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V +   ++ +    G+++G  I   N  +VS + ++ R++   +      V +       
Sbjct: 402 VVVIEVKQGDAAQAGLRRGDVITMFNGQQVSSVAELARIVVDLEADTMVPVRV------- 454

Query: 472 MQSGNDNMSRFVSLKIDK 489
                     F+ L++ +
Sbjct: 455 ---VRQGRPIFLPLRVTE 469


>gi|192292368|ref|YP_001992973.1| protease Do [Rhodopseudomonas palustris TIE-1]
 gi|192286117|gb|ACF02498.1| protease Do [Rhodopseudomonas palustris TIE-1]
          Length = 501

 Score =  194 bits (491), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 134/486 (27%), Positives = 221/486 (45%), Gaps = 32/486 (6%)

Query: 22  FSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHP 81
             +      A+ P     +  V  +V  ++V++                     LP   P
Sbjct: 29  VIAGPAPASARGPEG---IADVAEKVIDAVVNISTTQTVDAKGSGESKGGAAPQLPPGSP 85

Query: 82  LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSD 141
            + +F   F      +        +    GSGF I   G ++T+NH++ D    +VIL+D
Sbjct: 86  FEEFFEDFFKNRRGEKGGGP---RKTNSLGSGFIIDPAGVVVTNNHVIADSDEINVILND 142

Query: 142 DTELPAKLVGTDALFDLAVLKVQSD--RKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTV 199
             ++ A+LVG D   DLAVLK +    +    V+F D++ +R+GE V  IGNPF L GTV
Sbjct: 143 GAKIKAELVGVDKKTDLAVLKFKPPAGKTLTAVKFGDSDKLRLGEWVIAIGNPFSLGGTV 202

Query: 200 SAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV 258
           +AGIVSA +RDI   P   + Q DA IN+GNSGGP FN  G VIGVN +I++     +G+
Sbjct: 203 TAGIVSARNRDINSGPYDSYIQTDAAINRGNSGGPLFNLAGEVIGVNTLIISPSGGSIGI 262

Query: 259 GLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESP 318
           G  +P   +   +  L   G +  GW G+  Q +T E+A  L ++  +G+L+  V  + P
Sbjct: 263 GFAVPSKTVVPVVDQLRQFGELRRGWLGVRIQQVTDEIAESLSIKPARGALVAGVDDKGP 322

Query: 319 ADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSP 378
           A  AG++ GDV+   DG+ IK  +D    +A  +  + V + + ++G + +  V LG   
Sbjct: 323 AKPAGIEPGDVVVKFDGKDIKEPKDLSRIVADTAVGKTVDVVVIRKGKEETKQVTLGRLD 382

Query: 379 TAKNDMHLEVGDKE---------LLGMVLQDINDGNKKLV-------RIVALNPNREREV 422
                       +          +LG+ L  ++   +           ++    +   + 
Sbjct: 383 DDAKPQPASAKSQPEADKPVTQKVLGLDLAALSKDLRGRYKIKDSVKGVLVTGVDDGSDA 442

Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRF 482
             K +  G  IV V    V    D+++ + + K+  + SVLL +       +      RF
Sbjct: 443 AEKRLSAGDVIVEVAQESVGSAADIKKRVDQLKKDGKKSVLLLV-------ANASGELRF 495

Query: 483 VSLKID 488
           V+L + 
Sbjct: 496 VALSLQ 501


>gi|120609880|ref|YP_969558.1| protease Do [Acidovorax citrulli AAC00-1]
 gi|120588344|gb|ABM31784.1| protease Do [Acidovorax citrulli AAC00-1]
          Length = 493

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 139/482 (28%), Positives = 219/482 (45%), Gaps = 31/482 (6%)

Query: 2   FKRQILSVKSICTVAL--TCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPK 59
           F+  + S+ +   VAL     + +         L     D   ++ +V P++V++    K
Sbjct: 11  FRTLVRSLAAAGAVALFPAGALHAQAATASPPPLVQGLPDFTDLVDQVGPAVVNIRTIEK 70

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS---GEEPILSDTVERLMFGSGFFI 116
                              D  +  +F++           + P   D  +    GSGF +
Sbjct: 71  APDRSSTSGM---------DEEMLEFFKRFGLPMPGVPRQQRPQRPDEEQPRGVGSGFIV 121

Query: 117 TDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFED 176
           T DGY++T+ H+VE      V L+D  E  AK+VG+D   D+AV+K+        V+  D
Sbjct: 122 TSDGYVMTNAHVVEGAQEVLVTLTDKREFKAKIVGSDKRTDVAVVKI-DATGLPAVKVGD 180

Query: 177 ANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFN 236
            N +RVGE V  IG+PF L  TV+AGIVSA  RD  D    F Q D  IN GNSGGP  N
Sbjct: 181 MNRLRVGEWVMAIGSPFGLENTVTAGIVSAKQRDTGDYLP-FIQTDVAINPGNSGGPLIN 239

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N+ I +     MG+   IP+    +    L + GRV  G  G+    +T+++
Sbjct: 240 MRGEVVGINSQIYSRSGGFMGISFAIPIDEAIRVSDQLRATGRVTRGRIGVQIGQVTKDV 299

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  +GL  T+G+L+T V   SPADKAG++ GD+I   DG+ I    D    + +  P  +
Sbjct: 300 AESIGLGKTQGALVTGVETGSPADKAGVEAGDIITRFDGKSIDKISDLPRLVGNTKPGNK 359

Query: 357 VKISLCKEGSKH--SVAVVLGSSPTAKNDMHLEVGDKEL-------LGMVLQDINDGNKK 407
             +++ + G+     + V              + G K         LG+   D+ D  KK
Sbjct: 360 STVTVFRRGATKDLPITVAEVEPDDRPTAAAGDRGAKPKASPAALQLGLAAVDLTDAQKK 419

Query: 408 LV----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVL 463
            +     +              G+++G  I+ V   E+S +KD E ++ KA + K  +VL
Sbjct: 420 ELKLKGGVRVTGVTD--AAARAGLREGDVILGVANTEISGMKDFEAVLAKADKSKPINVL 477

Query: 464 LQ 465
            +
Sbjct: 478 FR 479


>gi|16752049|ref|NP_445415.1| serine protease [Chlamydophila pneumoniae AR39]
 gi|7189789|gb|AAF38665.1| serine protease, HtrA/DegQ/DegS family [Chlamydophila pneumoniae
           AR39]
          Length = 488

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 142/509 (27%), Positives = 245/509 (48%), Gaps = 41/509 (8%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLV--LEAKLPPSSVD---------LPPVIARVSP 49
           M  +Q+ S  ++   +    +  S   V   E+++     D            V  + +P
Sbjct: 1   MITKQLRSWLAVLVGSXLLALPLSGQAVGKKESRVSELPQDVLLKEISGGFSKVATKATP 60

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM 109
           ++V +   PK +          G    P ++P   +  + F++FF           +  +
Sbjct: 61  AVVYIESFPKSQAVTHPSPGRRG----PYENPFDYFNDEFFNRFFGLPSQREKPQSKEAV 116

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            G+GF ++ DGYI+T+NH+VED     V L D  + PA ++G D   DLAV+K+   +  
Sbjct: 117 RGTGFLVSPDGYIVTNNHVVEDTGKIHVTLHDGQKYPATVIGLDPKTDLAVIKI-KSQNL 175

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQ 227
             + F ++++++VG+    IGNPF L+ TV+ G++SA  R+         F Q DA IN 
Sbjct: 176 PYLSFGNSDHLKVGDWAIAIGNPFGLQATVTVGVISAKGRNQLHIADFEDFIQTDAAINP 235

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP  N  G VIGVN  IV+    ++G+G  IP  +  + I  LI  G+V  G+ G+
Sbjct: 236 GNSGGPLLNIDGQVIGVNTAIVSGSGGYIGIGFAIPSLMANRIIDQLIRDGQVTRGFLGV 295

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +  ELA    L    G+L+T VVK SPADKAG+K  DVI   +G+ + S   F   
Sbjct: 296 TLQPIDAELAACYKLEKVYGALVTDVVKGSPADKAGLKQEDVIIAYNGKEVDSLSMFRNA 355

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKK 407
           ++  +P  ++ + + +EG    + V +  +P         +   + +G+ +Q++     K
Sbjct: 356 VSLMNPDTRIVLKVVREGKVIEIPVTVSQAPKEDG-----MSALQRVGIRVQNLTPETAK 410

Query: 408 LV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
            +        I+ ++        + GI  G  I++VN  +VS I+D+ R     K+   +
Sbjct: 411 KLGIAPETKGILIISVEPGSVAASSGIAPGQLILAVNRQKVSSIEDLNR---TLKDSNNE 467

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++LL +           ++ RF++LK ++
Sbjct: 468 NILLMV--------SQGDVIRFIALKPEE 488


>gi|317490893|ref|ZP_07949329.1| protease Do [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920440|gb|EFV41763.1| protease Do [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 475

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 133/479 (27%), Positives = 221/479 (46%), Gaps = 14/479 (2%)

Query: 2   FKRQ--ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPK 59
            K+   +LS  ++        + +S      A        L P++ +V PS+VS+ VE  
Sbjct: 1   MKKSTLVLSAVALSLGMALSPMSASAAETASAVTSQQLPSLAPMLEKVMPSVVSINVEGS 60

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFF-SGEEPILSDTVERLMFGSGFFIT- 117
             V+              ++ P               G         +    GSG  I  
Sbjct: 61  ATVNNNGRMPQQFQQFFGDNSPFCQDGSPFSGSPMCQGGGANGPSKEKFKALGSGVIIDA 120

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
             GY+ T+NH+VE+  S  V LSD  +  AK++GTD   D+A+++++  +    ++  D+
Sbjct: 121 AKGYVATNNHVVENADSIQVQLSDGRKYEAKVIGTDPRTDIALIQLKDAKNLTAIKMADS 180

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGGPCF 235
           + +RVG+    IGNP+ L  TV++GIVSAL R   +      F Q DA IN+GNSGG   
Sbjct: 181 DALRVGDYTVAIGNPYGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGGALV 240

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   L  E
Sbjct: 241 NLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTGQMVEFGQVKRGELGIMGTELNSE 300

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
           LA  + +   +G+ I+ V+ +S A KAG+K GDV+  L+G+ I S   F  +I +     
Sbjct: 301 LAKAMKVDAQRGAFISQVLPKSSAAKAGIKAGDVVVSLNGKPISSFASFRAEIGTMPVGS 360

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALN 415
           ++K+ L ++G   S+ V L  S  A+          E  G  L ++  G  K   +   N
Sbjct: 361 KLKLGLIRDGKPISIDVTLEQSQQAQVASSNVFAGIE--GAELSNVTTGKVK--GVKVDN 416

Query: 416 PNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
             +       G+QKG  I+ VN   V+ + ++ +++    + K   + L I    +   
Sbjct: 417 VQKGSTAARVGLQKGDIILGVNQQPVANLGELRKIM----DSKPPVLALNILRGDNSLY 471


>gi|121601816|ref|YP_988752.1| protease Do family protein [Bartonella bacilliformis KC583]
 gi|120613993|gb|ABM44594.1| protease Do family protein [Bartonella bacilliformis KC583]
          Length = 505

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 170/510 (33%), Positives = 263/510 (51%), Gaps = 38/510 (7%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLP-------PSSVDLPPVIARVSPSIVSVMV- 56
           + L      T   + + FS + L   A                  ++++V P++V+V V 
Sbjct: 8   RTLRAIGFSTALASTMFFSGSNLWRSAAYAKPVFVTSGQQQGFADIVSQVKPAVVAVQVK 67

Query: 57  ----EPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEE-PILSDTVERLMFG 111
               E KK       F + G   LP+ HPLK +F +     +  ++    S     + FG
Sbjct: 68  SDKKETKKDRFFGGFFGSPGMDQLPDQHPLKKFFEEFHEYAWPNDKYSNRSRKPRSVAFG 127

Query: 112 SGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           SGFFI+ DGYI+T+NH++  G S+S++L D TEL A+L+GTD   DLAVLKV   R F  
Sbjct: 128 SGFFISSDGYIVTNNHVISGGTSYSIVLDDSTELEARLIGTDPRTDLAVLKVDDKRTFTY 187

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR-PGTFTQIDAPINQGNS 230
           V+F D   +R+G+ V  +GNPF L GTV+AGIVSA  RDI       F QIDA +N+GNS
Sbjct: 188 VDFADDTKVRIGDWVVAVGNPFGLGGTVTAGIVSARGRDIGAGVYDDFIQIDAAVNRGNS 247

Query: 231 GGPCFNALGHVIGVNAMIVTS---GQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GGP FN  G V+GVN    +       ++G+   IP    ++ +  +I KG V  GW G+
Sbjct: 248 GGPTFNLNGQVVGVNTAFFSPSGGNGGNVGIAFAIPAITAQQVVKQIIEKGSVQRGWIGV 307

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +T+E++  +GL+  KG+L+T  +K  PA KAG+K GDVI  ++ + +   +D   +
Sbjct: 308 QIQAVTKEISDSVGLKEVKGALVTDPLK-GPAQKAGIKAGDVIISVNDKKVTDARDLARR 366

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK--------ELLGMVLQ 399
           IA+  P E   + + + G + SV V + S P ++N                 E  G+++ 
Sbjct: 367 IANIRPGETATLGVWRSGKEDSVKVKIDSMPESENKGEGSKSSSKKGGSETLEDYGLIVT 426

Query: 400 DINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKR 459
             +D +     ++  + + + +   +GI+ G  IV+VN   V    DV   I  A+E  R
Sbjct: 427 TSDDDS----GLIVTDVDLDSDAAERGIRPGDVIVTVNNKPVKKASDVADAIKYAQELGR 482

Query: 460 DSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            ++LLQ++          + +RFV+L I K
Sbjct: 483 SAILLQVR--------TKDQNRFVALPIIK 504


>gi|148550710|ref|YP_001260149.1| protease Do [Sphingomonas wittichii RW1]
 gi|148503129|gb|ABQ71382.1| protease Do [Sphingomonas wittichii RW1]
          Length = 501

 Score =  193 bits (490), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 137/521 (26%), Positives = 235/521 (45%), Gaps = 64/521 (12%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLE--------AKLPPSSVDLPPVIARVSPSIVSVMV 56
           +I +       A+  VI   +    +           P +      +  R++P++V++  
Sbjct: 6   RIFASLLSTAAAVGLVIGQPSPAAAQSPPAASPVVPRPGAPQSFADLTERLAPAVVNIST 65

Query: 57  EPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFI 116
             + ++     F            P + +F            P    T E    GSGF +
Sbjct: 66  RQRVQMPSFSPFA---------GTPFERFFG----------SPTGPRTREAQSLGSGFIL 106

Query: 117 TDDGYILTSNHIVE-----DGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIP 171
           + DGYI+T+NH++         + +V L +  E PA LVG+D   DLAVLK+   +    
Sbjct: 107 SADGYIVTNNHVITADGQGKVETITVTLHNGEEYPATLVGSDPASDLAVLKITLRKPLPF 166

Query: 172 VEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR--PGTFTQIDAPINQGN 229
           V F D+  +RVG+ V  IGNPF L GTV+AGIVSA+ R+         + Q DA IN+GN
Sbjct: 167 VTFGDSTRVRVGDWVLAIGNPFGLGGTVTAGIVSAVYRNTGTGRAYDRYLQTDASINRGN 226

Query: 230 SGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMT 289
           SGGP F++ G VIG+N  I +    ++G+G  IP  I    +  L +   ++ G+ G+  
Sbjct: 227 SGGPMFDSSGRVIGINNAIFSPTGGNVGIGFAIPAEIAAPIVEKLKAGKAIERGYLGVTI 286

Query: 290 QNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIA 349
           Q +T++LA  LG+   +G  + +V    PA +AG++ GDVI  +DG+ +   Q   + +A
Sbjct: 287 QPMTEDLASSLGVPRDRGEFVQSVEPGGPAAQAGIRAGDVILRVDGKEVTPSQSLSFLVA 346

Query: 350 SRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKN----------------DMHLEVGDKEL 393
           S  P  +V + L +   + +V       P+                   D       ++ 
Sbjct: 347 SVEPGRKVAVELMRGNQRMTVTATPVLRPSEDKLARQGFGRDDRRFDNFDKDRASPSEKT 406

Query: 394 LGMVLQDINDGNKKLVR-------IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKD 446
           LG+ ++ +  G  + +        +V  +     +   KG+ +G  I+S N   V+   D
Sbjct: 407 LGLAVEPLTPGIARQLGASDVSQGLVISSVEGNSDAARKGLSRGDIILSANNRPVASAAD 466

Query: 447 VERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKI 487
           +E  I +A+   R ++LL++K       G      +V +++
Sbjct: 467 LEAAIRQARTAGRSAILLRVK-------GRGEAPAYVPVRL 500


>gi|308274571|emb|CBX31170.1| Probable serine protease do-like [uncultured Desulfobacterium sp.]
          Length = 495

 Score =  193 bits (490), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 124/440 (28%), Positives = 216/440 (49%), Gaps = 22/440 (5%)

Query: 37  SVDLPPVIARVSPSIVSVMVEPKKKVSV---EQMFNAYGFGNLPEDHPLKNYFRKDFHKF 93
                 +    SP++V++      K      +        G   +D  + ++F K F+  
Sbjct: 51  PESFSALAEMASPAVVNIQTVRTAKTKNMFRQFRGGPPNSGPFNDDDQMNDFFNKFFN-- 108

Query: 94  FSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTD 153
                P      ++   GSGF I  +GYI+T+NH+VE      VIL ++ E  A ++G D
Sbjct: 109 -----PDQQKEFKQRSLGSGFIIDKEGYIVTNNHVVEGSDKIKVILKNEKEYNAVIIGRD 163

Query: 154 ALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD 213
              DLA++K++ +     ++  D++ ++VG+ V  IG+PF L  TV+AGIVSA  R I  
Sbjct: 164 PNTDLALIKIKDENNLPVLKLGDSDALKVGQWVVAIGSPFGLEHTVTAGIVSAKGRVIGS 223

Query: 214 RPGT-FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIP 272
            P   + Q DA IN GNSGGP  N  G VIG+N +I+       G+G  IP+++ +  I 
Sbjct: 224 GPYDDYIQTDASINPGNSGGPLLNMNGEVIGINTIII---AGGQGIGFAIPVNLARGIID 280

Query: 273 SLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332
            L   G V  GW GI  Q+L  +L+   G++G KG L++ ++   PADKAG+K  D+I  
Sbjct: 281 QLKQHGDVTRGWLGITIQDLPSDLSEYFGIKGGKGVLVSDIIPGDPADKAGIKAKDIITE 340

Query: 333 LDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK--NDMHLEVGD 390
           ++G+ I S +  +  IA     + VKI + ++G +    V +      K  ++ +    +
Sbjct: 341 INGQKIDSSRTLLKIIAGMGVGKNVKIKILRDGKEKMFNVEIAKRMDEKIASNRNSTKNE 400

Query: 391 KELLGMVLQDINDGNKKLV------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444
            + +G+ + +++    +         ++ +  + E +    GI  G  I  +N   V  +
Sbjct: 401 ADEIGIRVANLSPEMARRYDISEKEGVIVVAVDSEGKAAEAGIVPGDIIKEINHQPVKSV 460

Query: 445 KDVERLIGKAKEKKRDSVLL 464
           ++   L+ K ++ K  ++ L
Sbjct: 461 REYAELLKKIQKNKPFNMFL 480



 Score = 72.1 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 42/106 (39%), Gaps = 12/106 (11%)

Query: 390 DKELLGMVLQDIND------GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSC 443
            +  LG+ +QD+        G K    ++  +       +  GI+    I  +N  ++  
Sbjct: 289 TRGWLGITIQDLPSDLSEYFGIKGGKGVLVSDIIPGDPADKAGIKAKDIITEINGQKIDS 348

Query: 444 IKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
            + + ++I  A      +V ++I  D   +  N      ++ ++D+
Sbjct: 349 SRTLLKII--AGMGVGKNVKIKILRDGKEKMFNVE----IAKRMDE 388


>gi|258543852|ref|ZP_05704086.1| S1C (protease Do) subfamily peptidase MucD [Cardiobacterium hominis
           ATCC 15826]
 gi|258520892|gb|EEV89751.1| S1C (protease Do) subfamily peptidase MucD [Cardiobacterium hominis
           ATCC 15826]
          Length = 465

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 128/474 (27%), Positives = 220/474 (46%), Gaps = 30/474 (6%)

Query: 19  CVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPE 78
            ++  +  L         + D   ++A+   ++VS+ VE +                   
Sbjct: 15  TLVILALALAAPMSFADPAPDFTALVAKTKDAVVSIEVESRVSAPSTINGFPPEI----- 69

Query: 79  DHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVI 138
               +++F   F + F  +     +       GSGF I  DGYILT+ H+VE      V 
Sbjct: 70  ---FEDFFG--FPEPFGQQFEAPREQRILQGQGSGFIIDSDGYILTNAHVVEGAEKVRVQ 124

Query: 139 LSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGT 198
           L+++ E  A ++G D   D+A++K+Q D      +  D++ ++VG+ V  IG+PF    T
Sbjct: 125 LNNNKEYNADVIGLDKRTDVALVKIQGDHL-PVAKIGDSDQVQVGDWVLAIGSPFGFSHT 183

Query: 199 VSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMG 257
            + GIVSA+ R++P      F Q DA IN GNSGGP FN+ G VI +N+ I +      G
Sbjct: 184 ATQGIVSAVARNLPSGDYVPFIQTDAAINPGNSGGPLFNSKGEVIAINSQIYSRSGAFNG 243

Query: 258 VGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKES 317
           +   IP+++ K     L  KG V  GW G+  Q L Q LA   G+   +G+L+ +V + S
Sbjct: 244 LAFSIPINMAKNIADQLKDKGEVVRGWLGVRIQGLDQTLAESFGMEKPQGALVASVEENS 303

Query: 318 PADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS 377
           PA KAG++ GDVI   +G+ +    D    +AS    E+V+I L ++G + +V   +G+ 
Sbjct: 304 PAAKAGIENGDVILQYNGKAVSKSADLPAYVASTPIGEKVEIKLLRDGKEETVKAEIGNL 363

Query: 378 PTAKNDMHLEVGDKELLGMVLQDINDGNKKLV-----RIVALNPNREREVEAKGIQKGMT 432
                D         + G+ L  + + +++ +      +           E  G++ G  
Sbjct: 364 NDVSGDG---KASASIRGLSLGTLENEDREALDYRGKGVRISGVKPGSAAEKSGLRAGDI 420

Query: 433 IVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
           I++V    V   K  +RL+ KA  K+   +L+            +  + +++L+
Sbjct: 421 IIAVGGKRVEDPKTAQRLLEKANSKRPVPLLI----------YRNGQNLYLALQ 464


>gi|224825658|ref|ZP_03698762.1| protease Do [Lutiella nitroferrum 2002]
 gi|224601882|gb|EEG08061.1| protease Do [Lutiella nitroferrum 2002]
          Length = 508

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 147/507 (28%), Positives = 243/507 (47%), Gaps = 47/507 (9%)

Query: 9   VKSICTVALTCVIFS----------------STYLVLEAKLPPSSVDLPPVIARVSPSIV 52
            ++I + AL   + +                +     + ++     D   ++ R  P++V
Sbjct: 22  FRTIVSAALAVTLLAGCDKIERLFKGDNPNVAIPAQSDGRVAMLLPDFTQLVERDGPAVV 81

Query: 53  SVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGS 112
           ++     +  + +          +PED PL ++FR+        ++   S   E + FGS
Sbjct: 82  NIQANKLEAAAAQNELPFP----IPEDDPLYDFFRRFMPNQPPQQDQTPS---ESVSFGS 134

Query: 113 GFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPV 172
           GF I+DDGYILT+ H+V  G+   V+++D  EL AKLVG D   D+AVLKV++       
Sbjct: 135 GFIISDDGYILTNAHVVAGGSQIKVVMTDKRELKAKLVGLDKRTDVAVLKVEAAGL-PVA 193

Query: 173 EFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSG 231
           +  D   ++VGE V  IG PF    TV+AGIVSA  R +PD     F Q D  IN GNSG
Sbjct: 194 KIGDPAKLKVGEWVAAIGAPFGFDNTVTAGIVSAKGRSLPDENYVPFIQTDVAINPGNSG 253

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP FN  G V+G+N+ I +     MG+   IP+ I       + +KG+V  G  G+  Q 
Sbjct: 254 GPLFNLRGEVVGINSQIYSRSGGFMGISFAIPIDIAINVAEQIKTKGKVSRGQLGVHIQE 313

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           ++QELA   GL+   G+L+  V    PA KAG++VGD+I  ++G++++S +D    +   
Sbjct: 314 VSQELAQSFGLKQPNGALVVRVEPNGPAAKAGLQVGDIILHMNGKLVESSKDLPILVGGL 373

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE--------LLGMVLQDIND 403
            P  ++K+ + ++G++  V VVLG       +      ++          LG+ L ++  
Sbjct: 374 QPGAKIKLGVWRKGAEKDVPVVLGELANEAANAPQPQQEEPAPQSFQFNKLGLTLTELTA 433

Query: 404 GNKKLVRIVA--LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDS 461
             K  + +    L    +      G+Q G  I+ +N  +V  +K  ER +  A      S
Sbjct: 434 AQKTELGLPGGLLIQKAQGPAARAGLQHGDIIIGLNQSQVLDVKGFERALANA----GGS 489

Query: 462 VLLQIKYDPDMQSGNDNMSRFVSLKID 488
           + L ++          + + FV L++D
Sbjct: 490 IALLVRR--------QDNTLFVPLRLD 508


>gi|284431714|gb|ADB84596.1| DegP [Edwardsiella tarda]
          Length = 471

 Score =  193 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 131/478 (27%), Positives = 224/478 (46%), Gaps = 16/478 (3%)

Query: 2   FKR--QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPK 59
            K+   +LS  ++        + +S      A    +   L P++ +V PS+VS+ VE  
Sbjct: 1   MKKTTLVLSAVALSLGMALSPMSASAAETSSATTAQALPSLAPMLEKVMPSVVSINVEGS 60

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD- 118
             V+  ++   +      ED PL                            GSG  I   
Sbjct: 61  ATVNNSRVPPQFQ-QFFGEDSPLCQPGSPFGGSPMCQGGGNAPSKERFKALGSGVIIDAG 119

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
            GY++T+NH+V +  S  V LSD     AK++GTD   D+A+++++  +    ++  D++
Sbjct: 120 KGYVVTNNHVVANADSIKVQLSDGRRFDAKVIGTDPRTDIALIQLKDAKNLTAIKMADSD 179

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGGPCFN 236
           N+RVG+    IGNP+ L  TV++GIVSAL R   +      F Q DA IN+GNSGG   N
Sbjct: 180 NLRVGDYAVAIGNPYGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGGALVN 239

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   L  EL
Sbjct: 240 LNGDLIGINTAILAPDGGNIGIGFAIPSNMVKNLTGQMVEYGQVKRGELGIMGTELNSEL 299

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  + +   +G+ I+ V+ +S A KAG+K GDVI  L+G+ I S   F  +I +     +
Sbjct: 300 AKAMKIDAQRGAFISQVLPKSAAAKAGLKAGDVIVSLNGKNISSFASFRAEIGTMPVGSK 359

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNP 416
           + + + ++G   +V V L    +A++ +  +     + G  L +          +   N 
Sbjct: 360 LALGIIRDGKPMNVEVTLEQ--SAQSQVASDNIFSGIEGAELSNA----AGGKGVKVDNV 413

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
            +       G+QKG  I+ VN H ++ I ++ +++      K   + L I+   +   
Sbjct: 414 KKGSTAARIGLQKGDVILGVNQHAIANIGELRKILDA----KPPVLALNIQRGDNTLY 467


>gi|302186913|ref|ZP_07263586.1| peptidase S1, chymotrypsin:PDZ/DHR/GLGF [Pseudomonas syringae pv.
           syringae 642]
          Length = 481

 Score =  193 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 130/501 (25%), Positives = 220/501 (43%), Gaps = 32/501 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L      + +         +  D   ++ + SP++V++    K 
Sbjct: 1   MSIPRMKSYFSLIAAVLMLGQVVTAHA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRK---DFHKFFSGEEPILSDTVERLMFGSGFFIT 117
                          LP    L+ +  +      +             E    GSGF I+
Sbjct: 54  PDRAVANQQMPDLEGLPPM--LREFLERSMPPGSRPPGSGAGKGDRQREAQSLGSGFIIS 111

Query: 118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDA 177
            DGY+LT+NH+++      V LSD +EL AKLVGTD   D+AVLK+         +  ++
Sbjct: 112 PDGYVLTNNHVIDGADEILVRLSDRSELKAKLVGTDPRTDVAVLKIDGKDL-PTAKLGNS 170

Query: 178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFN 236
           N ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN
Sbjct: 171 NTLKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFN 230

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++L
Sbjct: 231 MAGEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKANGKVSRGWLGVVIQEVNKDL 290

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A   GL    G+L+  V+++ PA K G++VGDVI   +G+ I    D    I +     +
Sbjct: 291 AESFGLDKPAGALVAQVLEDGPAAKGGVQVGDVILSANGQPIVMSADLPHLIGNLKDGSK 350

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDM-----HLEVGDKELLGMVLQDINDGNKKLV-- 409
            ++ + ++G +  + V +G+ P    +M              LG+ + ++    KK +  
Sbjct: 351 AELEVIRDGKRQKLTVTVGALPDEGQEMGDVGGTGAERSSNRLGVSVIELTAEQKKSLDL 410

Query: 410 -RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKY 468
              VA+           G+Q G  I  +N   ++  K    +     + +  S+ +    
Sbjct: 411 KGGVAIKEVTGGPASLIGLQAGDVITHLNNQAITSSKQFTEVAKSLPKDRSVSMRVL--- 467

Query: 469 DPDMQSGNDNMSRFVSLKIDK 489
                      + F++ K+ +
Sbjct: 468 -------RQGRATFITFKLSE 481


>gi|269302780|gb|ACZ32880.1| protease, Do family [Chlamydophila pneumoniae LPCoLN]
          Length = 488

 Score =  193 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 141/509 (27%), Positives = 244/509 (47%), Gaps = 41/509 (8%)

Query: 1   MFKRQILSVKSIC--TVALTCVIFSSTYLVLEAKLPPSSVD---------LPPVIARVSP 49
           M  +Q+ S  ++   +  L   +        E+++     D            V  + +P
Sbjct: 1   MITKQLRSWLAVLVGSSLLALPLSGQAVGKKESRVSELPQDVLLKEISGGFSKVATKATP 60

Query: 50  SIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLM 109
           ++V +   PK +          G    P ++P   +  + F++FF           +  +
Sbjct: 61  AVVYIESFPKSQAVTHPSPGRRG----PYENPFDYFNDEFFNRFFGLPSQREKPQSKEAV 116

Query: 110 FGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKF 169
            G+GF ++ DGYI+T+NH+VED     V L D  + PA ++G D   DLAV+K+   +  
Sbjct: 117 RGTGFLVSPDGYIVTNNHVVEDTGKIHVTLHDGQKYPATVIGLDPKTDLAVIKI-KSQNL 175

Query: 170 IPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQ 227
             + F ++++++VG+    IGNPF L+ TV+ G++SA  R+         F Q DA IN 
Sbjct: 176 PYLSFGNSDHLKVGDWAIAIGNPFGLQATVTVGVISAKGRNQLHIADFEDFIQTDAAINP 235

Query: 228 GNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGI 287
           GNSGGP  N  G VIGVN  IV+    ++G+G  IP  +  + I  LI  G+V  G+ G+
Sbjct: 236 GNSGGPLLNIDGQVIGVNTAIVSGSGGYIGIGFAIPSLMANRIIDQLIRDGQVTRGFLGV 295

Query: 288 MTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQ 347
             Q +  ELA    L    G+L+T VVK SPADKAG+K  DVI   +G+ + S   F   
Sbjct: 296 TLQPIDAELAACYKLEKVYGALVTDVVKGSPADKAGLKQEDVIIAYNGKEVDSLSTFRNA 355

Query: 348 IASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKK 407
           ++  +P  ++ + + +EG    + V +  +P         +   + +G+ +Q++     K
Sbjct: 356 VSLMNPDTRIVLKVVREGKVIEIPVTVSQAPKEDG-----MSALQRVGIRVQNLTPETAK 410

Query: 408 LV-------RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRD 460
            +        I+ ++        + GI  G  I++VN  +VS I+D+ R     K+   +
Sbjct: 411 KLGIAPETKGILIISVEPGSVAASSGIAPGQLILAVNRQKVSSIEDLNR---TLKDSNNE 467

Query: 461 SVLLQIKYDPDMQSGNDNMSRFVSLKIDK 489
           ++LL +           ++ RF++LK ++
Sbjct: 468 NILLMV--------SQGDVIRFIALKPEE 488


>gi|119713598|gb|ABL97649.1| serine protease [uncultured marine bacterium EB0_39H12]
          Length = 462

 Score =  193 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 133/481 (27%), Positives = 226/481 (46%), Gaps = 30/481 (6%)

Query: 15  VALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFG 74
           +    ++ S         LP    +   +    SP +V++                  +G
Sbjct: 6   IIFALIVMSFYGYAQSRDLP----NFSDLAEEASPGVVNITSSKTVNNRNS-------YG 54

Query: 75  NLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGAS 134
               D     +F + F +      P  +     +  GSGFFI+DDG++LT+NH+VED   
Sbjct: 55  RGFGDPRYDEFFERFFGQQPRPSTPRENS-RPVVSTGSGFFISDDGFLLTNNHVVEDADE 113

Query: 135 FSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR 194
            +V L D  E  A+++GTD   D+A+LK+ ++     ++   +  ++VGE V  IG+PF+
Sbjct: 114 ITVSLGDRREFKAEVIGTDERSDVALLKIDAENL-PFLKIGKSKQLKVGEWVVAIGSPFQ 172

Query: 195 LRGTVSAGIVSALDRDIPDRPGT----FTQIDAPINQGNSGGPCFNALGHVIGVNAMIVT 250
           LR +V++GIVSA  R IP+   +    F Q D  IN GNSGGP FN  G VIG+N+ I T
Sbjct: 173 LRFSVTSGIVSAKGRSIPNGSDSTYVPFIQTDVAINPGNSGGPLFNLEGEVIGINSQIYT 232

Query: 251 SGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLI 310
               +MGV   IP+         L   G V  GW G+  Q +  +LA  L +   KG+LI
Sbjct: 233 RSGGYMGVSFAIPIDYAMDVADQLKENGYVARGWLGVSIQEINSQLAEALDMDVPKGALI 292

Query: 311 TAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSV 370
           + +++ SPA+K+G++  DVI   DG  I    D    + S  P  +V   + ++G   ++
Sbjct: 293 SQIIEGSPAEKSGLEEEDVILFFDGEEIFYSSDLPLTVGSIRPGSEVNAMVLRDGKNKTI 352

Query: 371 AVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV--RIVALNPNREREVEAKGIQ 428
            V +G  P   +    +   K  LG+ +++ ND ++K     +   + + E      GI+
Sbjct: 353 QVTVGELPKDPSIAFNDT-KKNALGITVENQNDEDQKPFVKGVRVTSVDPEGIAYTSGIR 411

Query: 429 KGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLKID 488
           +G  I ++    ++ + +   ++ K          L ++ +  +    +   R +SL + 
Sbjct: 412 RGDVIYALARTRINNVSEFRDVLSK----------LDMERNTTIGVSRNGNKRILSLNLS 461

Query: 489 K 489
           K
Sbjct: 462 K 462


>gi|237745507|ref|ZP_04575987.1| peptidase S1 [Oxalobacter formigenes HOxBLS]
 gi|229376858|gb|EEO26949.1| peptidase S1 [Oxalobacter formigenes HOxBLS]
          Length = 486

 Score =  193 bits (489), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 125/489 (25%), Positives = 222/489 (45%), Gaps = 27/489 (5%)

Query: 1   MFKRQILSVKSICTVALTCVIFSST---YLVLEAKLPPSSVDLPPVIARVSPSIVSVMVE 57
           M K  +L    +  + L+  +            + +     DL  ++ +V P++V++   
Sbjct: 1   MKKPLLLPFSKLIFLLLSVFVLFFPVDRAFSASSGMVNGLPDLTALVEKVGPAVVNIRTV 60

Query: 58  PKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFH--KFFSGEEPILSDTVERLMFGSGFF 115
            K +     ++          D   + Y  + F   +  S           R   GSGF 
Sbjct: 61  EKIQSRRNPVYEM--------DEDFQEYLFRFFGVPRPDSPPAQSRQKEQIRRGLGSGFI 112

Query: 116 ITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFE 175
           I+ DGY+LT++H++++     V L+D+ E  AK+VG+D   D+A+LK+        ++  
Sbjct: 113 ISPDGYVLTNHHVIDNADDVFVRLTDNREFKAKVVGSDKRTDVALLKIDGKAL-PYLKTG 171

Query: 176 DANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCF 235
            + +I+ G+ V  IG+PF L  TV+AGI+SA  RD  D      Q D  +N GNSGGP  
Sbjct: 172 KSVDIKAGQWVLAIGSPFALENTVTAGIISAKARDTGDYLP-LIQTDVAVNPGNSGGPLI 230

Query: 236 NALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQE 295
           N  G  +G+N+ I +    +MG+   IP+    +    L   G+V  G  GI    ++ E
Sbjct: 231 NMAGEAVGINSQIYSRSGGYMGISFAIPIDEALRVSEQLKKSGKVTRGQLGIQVGEVSGE 290

Query: 296 LAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKE 355
            A  L L   +G L+  V   SPA+KAG++ GD+I   + + I+   +    +    P +
Sbjct: 291 TAKALNLPDKQGVLVVHVESGSPAEKAGLEAGDIILKFNEQSIEKISELPRLVGDTPPGK 350

Query: 356 QVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKE--------LLGMVLQDINDGNKK 407
            V++S+ ++G   S+ V +           +   D+E        +LG+ + D+    KK
Sbjct: 351 TVRLSVWRKGKTLSLPVTVSVMQADVQSARVPQADREGGSMLSSKVLGLTVSDLTAAQKK 410

Query: 408 LVRIV--ALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQ 465
            + +    L    E    A GI+KG  I+ +N  +V+     + L+ K    ++ + +L 
Sbjct: 411 QLGVKQGVLVTKAENPAVASGIRKGDVILRLNNADVANRNSFQDLVSKI--DRKKTAVLL 468

Query: 466 IKYDPDMQS 474
           I+ +  +  
Sbjct: 469 IQRNNMISY 477


>gi|238920969|ref|YP_002934484.1| serine endoprotease [Edwardsiella ictaluri 93-146]
 gi|238870538|gb|ACR70249.1| protease do [Edwardsiella ictaluri 93-146]
          Length = 471

 Score =  193 bits (488), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 130/478 (27%), Positives = 221/478 (46%), Gaps = 16/478 (3%)

Query: 2   FKR--QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPK 59
            K+   +LS  ++        + +S      A    +   L P++ +V PS+VS+ VE  
Sbjct: 1   MKKTTLVLSAVALSLGMALSPMSASAAETSSATTAQALPSLAPMLEKVMPSVVSINVEGS 60

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD- 118
             V+  ++   +      ED PL                            GSG  I   
Sbjct: 61  ATVNNSRVPPQFQ-QFFGEDSPLCQPGSPFGGSPMCQGGGNAPSKERFKALGSGVIIDAG 119

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
            GY++T+NH+V +  S  V LSD     AK++GTD   D+A+++++  +    ++  D++
Sbjct: 120 KGYVVTNNHVVANADSIKVQLSDGRRFDAKVIGTDPRTDIALIQLKDAKNLTAIKMADSD 179

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGGPCFN 236
            +RVG+    IGNP+ L  TV++GIVSAL R   +      F Q DA IN+GNSGG   N
Sbjct: 180 RLRVGDYAVAIGNPYGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGGALVN 239

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   L  EL
Sbjct: 240 LNGDLIGINTAILAPDGGNIGIGFAIPSNMVKNLTGQMVEYGQVKRGELGIMGTELNSEL 299

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  + +   +G+ I+ V+ +S A KAG+K GDVI  L+G+ I S   F  +I +     +
Sbjct: 300 AKAMKIDAQRGAFISQVLPKSAAAKAGLKAGDVIVSLNGKNISSFASFRAEIGTMPVGSK 359

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNP 416
           + + + + G   +V V L  S  ++        D    G+   ++N+       +   N 
Sbjct: 360 LALGIIRNGKPMNVEVTLEQSAQSQVA-----SDNIFSGIEGAELNNA-AGGKGVKVDNV 413

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
            +       G+QKG  I+ VN   ++ I ++ +++      K   + L I+   +   
Sbjct: 414 KKGSTAARIGLQKGDVILGVNQQAIANIGELRKILDA----KPPVLALNIQRGDNTLY 467


>gi|33242347|ref|NP_877288.1| serine protease DO [Chlamydophila pneumoniae TW-183]
 gi|33236858|gb|AAP98945.1| serine protease DO [Chlamydophila pneumoniae TW-183]
          Length = 483

 Score =  193 bits (488), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 141/505 (27%), Positives = 242/505 (47%), Gaps = 40/505 (7%)

Query: 3   KRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVD---------LPPVIARVSPSIVS 53
            R  L+V  + +  L   +        E+++     D            V  + +P++V 
Sbjct: 1   MRSWLAVL-VGSGLLALPLSGQAVGKKESRVSELPQDVLLKEISGGFSKVATKATPAVVY 59

Query: 54  VMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSG 113
           +   PK +          G    P ++P   +  + F++FF           +  + G+G
Sbjct: 60  IESFPKSQAVTHPSPGRRG----PYENPFDYFNDEFFNRFFGLPSQREKPQSKEAVRGTG 115

Query: 114 FFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVE 173
           F ++ DGYI+T+NH+VED     V L D  + PA ++G D   DLAV+K+   +    + 
Sbjct: 116 FLVSPDGYIVTNNHVVEDTGKIHVTLHDGQKYPATVIGLDPKTDLAVIKI-KSQNLPYLS 174

Query: 174 FEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSG 231
           F ++++++VG+    IGNPF L+ TV+ G++SA  R+         F Q DA IN GNSG
Sbjct: 175 FGNSDHLKVGDWAIAIGNPFGLQATVTVGVISAKGRNQLHIADFEDFIQTDAAINPGNSG 234

Query: 232 GPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQN 291
           GP  N  G VIGVN  IV+    ++G+G  IP  +  + I  LI  G+V  G+ G+  Q 
Sbjct: 235 GPLLNIDGQVIGVNTAIVSGSGGYIGIGFAIPSLMANRIIDQLIRDGQVTRGFLGVTLQP 294

Query: 292 LTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASR 351
           +  ELA    L    G+L+T VVK SPADKAG+K  DVI   +G+ + S   F   ++  
Sbjct: 295 IDAELAACYKLEKVYGALVTDVVKGSPADKAGLKQEDVIIAYNGKEVDSLSMFRNAVSLM 354

Query: 352 SPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLV-- 409
           +P  ++ + + +EG    + V +  +P         +   + +G+ +Q++     K +  
Sbjct: 355 NPDTRIVLKVVREGKVIEIPVTVSQAPKEDG-----MSALQRVGIRVQNLTPETAKKLGI 409

Query: 410 -----RIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464
                 I+ ++        + GI  G  I++VN  +VS I+D+ R     K+   +++LL
Sbjct: 410 APETKGILIISVEPGSVAASSGIAPGQLILAVNRQKVSSIEDLNR---TLKDSNNENILL 466

Query: 465 QIKYDPDMQSGNDNMSRFVSLKIDK 489
            +           ++ RF++LK ++
Sbjct: 467 MV--------SQGDVIRFIALKPEE 483


>gi|260459275|ref|ZP_05807530.1| protease Do [Mesorhizobium opportunistum WSM2075]
 gi|259034829|gb|EEW36085.1| protease Do [Mesorhizobium opportunistum WSM2075]
          Length = 464

 Score =  193 bits (488), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 144/492 (29%), Positives = 222/492 (45%), Gaps = 43/492 (8%)

Query: 5   QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSV 64
             +S K +C   L  V+  S              D   ++ +  P++V++      +   
Sbjct: 2   SYISRKRLCIGLLAGVLTLSAGGFAPVSAQEIPNDFSAIVRQKLPAVVAITTRQIIQDQT 61

Query: 65  EQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILT 124
                                   DF   F G  PI     E    GSGF I+ +GYI+T
Sbjct: 62  TL---------------------DDFLNPFDGRGPIQPQVRE--ALGSGFVISPEGYIVT 98

Query: 125 SNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGE 184
           +NH+V D     V+ SD    PA+LVG D   D+AVLKV          + D++ ++ G 
Sbjct: 99  NNHVVADSTEIHVVFSDKETSPARLVGRDPATDIAVLKVDPRPNMTIAVWGDSDAMQPGA 158

Query: 185 AVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGT-FTQIDAPINQGNSGGPCFNALGHVIG 243
               IG+PF L GTV+ G++SA  RDI   P   F Q DA IN+GNSGGP FNA G VIG
Sbjct: 159 WTIAIGSPFGLGGTVTVGVLSARSRDIQAGPYDDFLQTDASINRGNSGGPLFNARGEVIG 218

Query: 244 VNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR 303
           VN  IV+     +G+G  +P    +     LI  GR++ G+ G+  Q +T  LA  LG+ 
Sbjct: 219 VNTAIVSPSGGSIGIGFAVPSRTARSIADQLIRTGRIERGFIGVRLQEVTPSLAEALGMS 278

Query: 304 GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCK 363
           GTKG+L+ +V   SPA+KAG++ GDVI   +G+ I+   D     A+  P  +  ++  +
Sbjct: 279 GTKGALVASVEPGSPAEKAGLRSGDVITRFNGKDIQGVHDLTLAAANEKPGSRATLTRNR 338

Query: 364 EGSKHSVAVVLGSSPTAK---NDMHLEVGDKELLGMVLQDINDGNKKLVR-------IVA 413
            GS+  V + +G     +     +       + LG+ L  I D  ++ +        +  
Sbjct: 339 GGSQQEVELTVGQRKDEEMRTGAVPNPEAADQGLGLSLSPIPDEARQQLGLQPGTTGVFV 398

Query: 414 LNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQ 473
                       G++ G  IVS N   V+   DV +   K++++    +L +I+      
Sbjct: 399 QEVAPNSLAAESGLKPGDVIVSANNQNVTQPSDVRQEWAKSRQQN-KPILFRIER----- 452

Query: 474 SGNDNMSRFVSL 485
                 S FV++
Sbjct: 453 ---QGQSLFVAV 461


>gi|294637657|ref|ZP_06715936.1| protease do [Edwardsiella tarda ATCC 23685]
 gi|291089212|gb|EFE21773.1| protease do [Edwardsiella tarda ATCC 23685]
          Length = 470

 Score =  193 bits (488), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 130/478 (27%), Positives = 216/478 (45%), Gaps = 17/478 (3%)

Query: 2   FKR--QILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPK 59
            K+   +LS  ++        + +S      A    +   L P++ +V PS+VS+ VE  
Sbjct: 1   MKKTTLVLSAVALSLGMALSPMSASAAETSSATTAQALPSLAPMLEKVMPSVVSINVEGS 60

Query: 60  KKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITD- 118
             V+         F    ED PL                            GSG  I   
Sbjct: 61  ATVNNNVPSQFQQFFG--EDSPLCQPGSPFGGSPMCQGGGNAPSKERFKALGSGVIIDAA 118

Query: 119 DGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDAN 178
            GY++T+NH+V +  S  V LSD     AK++GTD   D+A+++++  +    ++  D++
Sbjct: 119 KGYVVTNNHVVANADSIKVQLSDGRRFDAKVIGTDPRTDIALIQLKDAKNLTAIKMADSD 178

Query: 179 NIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPD--RPGTFTQIDAPINQGNSGGPCFN 236
            +RVG+    IGNP+ L  TV++GIVSAL R   +      F Q DA IN+GNSGG   N
Sbjct: 179 KLRVGDYAVAIGNPYGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGGALVN 238

Query: 237 ALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQEL 296
             G +IG+N  I+     ++G+G  IP +++K     ++  G+V  G  GIM   L  EL
Sbjct: 239 LNGDLIGINTAILAPDGGNIGIGFAIPSNMVKNLTGQMVEYGQVKRGELGIMGTELNSEL 298

Query: 297 AIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356
           A  + +   +G+ I+ V+ +S A KAG+K GDVI  L+G+ I S   F  +I +     +
Sbjct: 299 AKAMKIDAQRGAFISQVLPKSAAAKAGLKAGDVIVSLNGKSISSFASFRAEIGTMPVGSK 358

Query: 357 VKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNP 416
           + + + ++G   +V   L  S  ++          E  G  L +          +   N 
Sbjct: 359 LSLGIIRDGKPMTVEATLEQSSQSQVASDNIFSGIE--GAELSNA----AGGKGVKVDNV 412

Query: 417 NREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
            +       G+QKG  I+ VN   ++ I ++ +++      K   + L I+   +   
Sbjct: 413 KKGSTAARIGLQKGDVILGVNQQAIANIGELRKILDA----KPPVLALNIQRGDNTLY 466


>gi|213971123|ref|ZP_03399242.1| serine protease, MucD [Pseudomonas syringae pv. tomato T1]
 gi|301381860|ref|ZP_07230278.1| serine protease, MucD [Pseudomonas syringae pv. tomato Max13]
 gi|302059029|ref|ZP_07250570.1| serine protease, MucD [Pseudomonas syringae pv. tomato K40]
 gi|302132828|ref|ZP_07258818.1| serine protease, MucD [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213924112|gb|EEB57688.1| serine protease, MucD [Pseudomonas syringae pv. tomato T1]
          Length = 479

 Score =  193 bits (488), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 129/499 (25%), Positives = 222/499 (44%), Gaps = 30/499 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSTPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS-GEEPILSDTVERLMFGSGFFITDD 119
                          LP    L+ +  +                  E    GSGF I+ D
Sbjct: 54  PDRAVANKQMPDLEGLPPM--LREFLERSMPPGSRAPGAGKGDRQREAQSLGSGFIISPD 111

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GY+LT+NH+++      V LSD +EL AKL+GTD   D+AVLK++        +  ++N 
Sbjct: 112 GYVLTNNHVIDGADEILVRLSDRSELKAKLIGTDPRTDVAVLKIEGKDL-PTAKLGNSNT 170

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  
Sbjct: 171 LKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMA 230

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA 
Sbjct: 231 GEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKASGKVSRGWLGVVIQEVNKDLAE 290

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G+L+  V+++ PA K G++VGDVI   +G+ +    D    I +     + +
Sbjct: 291 SFGLDKPAGALVAQVLEDGPAAKGGLQVGDVILSANGQPVVMSADLPHLIGNLKDGSKAE 350

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---R 410
           + + ++G +  + V +G+ P    +M    G         LG+ + ++    KK +    
Sbjct: 351 LEVIRDGKRQKLTVTVGALPDEGLEMGGAAGATAERSSNRLGVSVIELTAEQKKTLDIKG 410

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            VA+    +      G+Q G  I  +N   ++  K    +     + +  S+ +      
Sbjct: 411 GVAIKEVTDGPASLIGLQPGDVITHLNNQAITSGKQFTDVAKSLPKDRSVSMRVL----- 465

Query: 471 DMQSGNDNMSRFVSLKIDK 489
                    + F++ K+ +
Sbjct: 466 -----RQGRATFITFKLSE 479


>gi|28871363|ref|NP_793982.1| serine protease, MucD [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28854614|gb|AAO57677.1| serine protease, MucD [Pseudomonas syringae pv. tomato str. DC3000]
 gi|331015597|gb|EGH95653.1| serine protease, MucD [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 479

 Score =  193 bits (488), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 129/499 (25%), Positives = 222/499 (44%), Gaps = 30/499 (6%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           M   ++ S  S+    L     ++           +  D   ++ + SP++V++    K 
Sbjct: 1   MSTPRMKSYFSLIAAVLMLGQVATAQA-------ENLPDFTGLVEQASPAVVNISTRQKL 53

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFS-GEEPILSDTVERLMFGSGFFITDD 119
                          LP    L+ +  +                  E    GSGF I+ D
Sbjct: 54  PDRAVANKQMPDLEGLPPM--LREFLERSMPPGSRAPGAGKGDRQREAQSLGSGFIISPD 111

Query: 120 GYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANN 179
           GY+LT+NH+++      V LSD +EL AKL+GTD   D+AVLK++        +  ++N 
Sbjct: 112 GYVLTNNHVIDGADEILVRLSDRSELKAKLIGTDPRTDVAVLKIEGKDL-PTAKLGNSNT 170

Query: 180 IRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPG-TFTQIDAPINQGNSGGPCFNAL 238
           ++VGE V  IG+PF    +V+ GIVSA  R +P+     F Q D  IN GNSGGP FN  
Sbjct: 171 LKVGEWVLAIGSPFGFDHSVTKGIVSAKGRSLPNDTYVPFIQTDVAINPGNSGGPLFNMA 230

Query: 239 GHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAI 298
           G V+G+N+ I T     MG+   IP+ +       L + G+V  GW G++ Q + ++LA 
Sbjct: 231 GEVVGINSQIFTRSGGFMGLSFAIPIDVAMDVANQLKASGKVSRGWLGVVIQEVNKDLAE 290

Query: 299 PLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVK 358
             GL    G+L+  V+++ PA K G++VGDVI   +G+ +    D    I +     + +
Sbjct: 291 SFGLDKPAGALVAQVLEDGPAAKGGLQVGDVILSANGQPVVMSADLPHLIGNLKDGSKAE 350

Query: 359 ISLCKEGSKHSVAVVLGSSPTAKNDMHLEVG-----DKELLGMVLQDINDGNKKLV---R 410
           + + ++G +  + V +G+ P    +M    G         LG+ + ++    KK +    
Sbjct: 351 LEVIRDGKRQKLTVTVGALPDEGLEMGGAAGASAERSSNRLGVSVIELTAEQKKTLDIKG 410

Query: 411 IVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDP 470
            VA+    +      G+Q G  I  +N   ++  K    +     + +  S+ +      
Sbjct: 411 GVAIKEVTDGPASLIGLQPGDVITHLNNQAITSGKQFTDVAKSLPKDRSVSMRVL----- 465

Query: 471 DMQSGNDNMSRFVSLKIDK 489
                    + F++ K+ +
Sbjct: 466 -----RQGRATFITFKLSE 479


>gi|209517226|ref|ZP_03266071.1| protease Do [Burkholderia sp. H160]
 gi|209502362|gb|EEA02373.1| protease Do [Burkholderia sp. H160]
          Length = 507

 Score =  193 bits (488), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 129/514 (25%), Positives = 228/514 (44%), Gaps = 50/514 (9%)

Query: 7   LSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQ 66
            SV+     A+          +  A    +  D   ++ +V P++V++           +
Sbjct: 4   FSVRKFLAAAVVAACLPLVPHMASAAPAANLPDFTDLVDKVGPAVVNIRTTTHVSNGSSR 63

Query: 67  MFNAYGFGNLPEDHPLKNYFRKDFHKFFSG-------------------------EEPIL 101
                G     +D  +  +FR+ F                               + P  
Sbjct: 64  GGLPPGM----DDGDMSEFFRRFFGIPLPQSPQSPRGGDNGGGGGGNGGGSGGSADTPDN 119

Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVL 161
           ++  +    GSGF ++ DGY++T+ H+V+D  +  V L+D  E  AKL+G D   D+AV+
Sbjct: 120 TEPEQNSGVGSGFIMSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVV 179

Query: 162 KVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQI 221
           K+ +      +   D+N +RVGE V  IG+PF L  TV+AGIVSA  RD  D    F Q 
Sbjct: 180 KINASNL-PTITIGDSNKVRVGEWVVAIGSPFGLENTVTAGIVSAKGRDTGDYLP-FIQT 237

Query: 222 DAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVD 281
           D  +N GNSGGP  N  G VIG+N+ I +     MG+   IP+    +    L S G+V 
Sbjct: 238 DVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKSSGKVV 297

Query: 282 HGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH 341
            G   +    +T+++A  LGL   +G+L+++V    PADKAG++ GD+I   +G  +++ 
Sbjct: 298 RGRIAVAIGEVTKDVADSLGLPKAQGALVSSVEPGGPADKAGVQPGDIILKFNGHPVETA 357

Query: 342 QDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLEVGDK-------ELL 394
            D    +    P  +  I++ ++G  H + + +    + K     +             L
Sbjct: 358 TDLPRMVGDTKPGTKTSITVWRKGQTHELPITITEMQSDKVAKADQKKPPAPKQRATNAL 417

Query: 395 GMVLQDINDGNKKLVRIV-ALNPNR-EREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIG 452
           G+ + DI    +K ++I   +  +  +      G+QKG  I+ V   +V+  K  + +  
Sbjct: 418 GIAVSDIPADQQKALKIQNGVQIDAVDGPAARVGLQKGDIILRVGDTDVTSAKQFDEVTS 477

Query: 453 KAKEKKRDSVLLQIKYDPDMQSGNDNMSRFVSLK 486
               +K  ++L++            + ++FV ++
Sbjct: 478 HLDSQKMVALLVR----------RGDNTQFVPIR 501


>gi|315121865|ref|YP_004062354.1| serine protease DO-like protease [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495267|gb|ADR51866.1| serine protease DO-like protease [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 490

 Score =  192 bits (487), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 267/493 (54%), Positives = 357/493 (72%), Gaps = 13/493 (2%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MFK  ILS+++I    L  + F+ST  V EA++PPS+ DL P++ RVS S+VS++VEPKK
Sbjct: 1   MFKSHILSIRNISITVLMYIFFASTCFVAEARIPPST-DLVPIVERVSRSVVSILVEPKK 59

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG