BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780700|ref|YP_003065113.1| serine protease DO-like
protease [Candidatus Liberibacter asiaticus str. psy62]
         (489 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780700|ref|YP_003065113.1| serine protease DO-like protease [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040377|gb|ACT57173.1| serine protease DO-like protease [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 489

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 489/489 (100%), Positives = 489/489 (100%)

Query: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60
           MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK
Sbjct: 1   MFKRQILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKK 60

Query: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120
           KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG
Sbjct: 61  KVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDG 120

Query: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180
           YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI
Sbjct: 121 YILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNI 180

Query: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240
           RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH
Sbjct: 181 RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGH 240

Query: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300
           VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL
Sbjct: 241 VIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPL 300

Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360
           GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS
Sbjct: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKIS 360

Query: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER 420
           LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER
Sbjct: 361 LCKEGSKHSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNRER 420

Query: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480
           EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS
Sbjct: 421 EVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQSGNDNMS 480

Query: 481 RFVSLKIDK 489
           RFVSLKIDK
Sbjct: 481 RFVSLKIDK 489


>gi|114766775|ref|ZP_01445712.1| periplasmic serine protease, DO/DeqQ family protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114541032|gb|EAU44089.1| periplasmic serine protease, DO/DeqQ family protein [Roseovarius
           sp. HTCC2601]
          Length = 494

 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 146/494 (29%), Positives = 244/494 (49%), Gaps = 35/494 (7%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           ++     A++  +  S  L+  A+  P       +  R+SP++V++              
Sbjct: 19  LRLFWLAAVSMFLIVSQTLMASAQNAPE--SFAKLAERISPAVVNITTSTTVAGRTGPQ- 75

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                G +PE  P +++FR+   +     +            GSGF I++DGYI+T+NH+
Sbjct: 76  -----GIVPEGSPFEDFFREFQDRNGGPGDRP----RRSSALGSGFVISEDGYIVTNNHV 126

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           +E      +   +   LPA+LVGTD   D+A+LKV++D     V F +++N RVG+ V  
Sbjct: 127 IEGADEIEIEFFEGFTLPAELVGTDPNTDIALLKVEADEALKFVSFGNSDNARVGDWVMA 186

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I
Sbjct: 187 MGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDGQVIGVNTAI 246

Query: 249 VTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGS 308
           ++     +G+G  +  +++ K +  L   G    GW G+  Q++T+++A  LGL  T+G+
Sbjct: 247 LSPNGGSIGIGFSMASNVVTKVVDQLKEFGETRRGWLGVRIQDVTEDMAEALGLASTEGA 306

Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKH 368
           +++  V E PA +AGM+ GDVI   DGR ++  +  V  + +    + V++ + + G+  
Sbjct: 307 MVSD-VPEGPAMEAGMQAGDVIVSFDGREVQDTRQLVRIVGNTEVGKSVRVVVNRNGNTE 365

Query: 369 SVAVVLGSS-------PTAKNDMHLEVGDKELLGMVLQDINDGNKKLV-------RIVAL 414
           ++ V LG         P ++     E  + EL+G+ L  +    +  +        +   
Sbjct: 366 TLKVTLGRREEAERTYPASQEMTPEEPAESELMGLTLSPLTQELRDEMGLQSSATGLAVT 425

Query: 415 NPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDMQS 474
             +   E   KG++ G  I      EV  I ++E  I +AKE  R S+LL ++   D   
Sbjct: 426 GVDETSEAFEKGLRAGDIITEAGQAEVLSISELETKIEEAKEAGRKSILLLVRRGGD--- 482

Query: 475 GNDNMSRFVSLKID 488
                 RFV+L +D
Sbjct: 483 -----PRFVALSLD 491


>gi|149912789|ref|ZP_01901323.1| possible serine protease [Roseobacter sp. AzwK-3b]
 gi|149813195|gb|EDM73021.1| possible serine protease [Roseobacter sp. AzwK-3b]
          Length = 490

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 145/497 (29%), Positives = 249/497 (50%), Gaps = 40/497 (8%)

Query: 8   SVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQM 67
           +++++   ALT  +  +  LV  A+          +  RVSP++V++             
Sbjct: 15  ALRALWLTALTMALIVAQALVALAR----PESFADLADRVSPAVVNITTSTVV------A 64

Query: 68  FNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNH 127
             A     +PE  P +++FR+   +   G+ P           GSGF I++DG+++T+NH
Sbjct: 65  EGAGPSPIVPEGSPFEDFFREFRDRNGDGDRP-----RRSSALGSGFVISEDGFVVTNNH 119

Query: 128 IVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVF 187
           ++E      +      EL A+++GTD   D+A+LKV++D+    V F D++  RVG+ V 
Sbjct: 120 VIEAADEIIIEFFSGEELVAEVIGTDPKTDIALLKVKADQPLAFVTFGDSDTARVGDWVM 179

Query: 188 TIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAM 247
            +GNP     + SAGIVSA +R +      + Q DA IN+GNSGGP FN    VIGVN  
Sbjct: 180 AMGNPLGQGFSASAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMDAQVIGVNTA 239

Query: 248 IVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKG 307
           I++     +G+G  +  +++ + I  L   G    GW G+  Q++T+++A  +GL   +G
Sbjct: 240 ILSPTGGSIGIGFSMASNVVTRVIDQLKEYGETRRGWLGVRIQDVTEDVAEAMGLEEVRG 299

Query: 308 SLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSK 367
           +L+T  V E PA +AGM+ GDVI   DG  +   +  V Q+ +    + V++++ +EG  
Sbjct: 300 ALVTD-VPEGPASEAGMQAGDVILSFDGTQVNDTRGLVRQVGNTEVGKAVRVTVFREGKT 358

Query: 368 HSVAVVLGSSPTAK---------NDMHLEVGDKELLGMVLQDINDGNKKLV-------RI 411
            ++ V LG    A+          D   E  ++E++G+ +  ++D  +  +        +
Sbjct: 359 QTLKVTLGRREVAEGAVPTAQPGPDTPAEPSEQEMMGLTISPLDDELRGQLDLGSDVTGL 418

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V  + +   E   KG++ G  I       V+ I D+E  I +A++  R S+LL I+   +
Sbjct: 419 VVTDVDDLSEAYEKGVRAGDLITEAGQQNVASISDLEDRISEARDAGRKSILLLIRRSGE 478

Query: 472 MQSGNDNMSRFVSLKID 488
                    RFV+L ID
Sbjct: 479 --------PRFVALPID 487


>gi|84500011|ref|ZP_00998277.1| periplasmic serine protease, DO/DeqQ family protein [Oceanicola
           batsensis HTCC2597]
 gi|84391945|gb|EAQ04213.1| periplasmic serine protease, DO/DeqQ family protein [Oceanicola
           batsensis HTCC2597]
          Length = 475

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 143/498 (28%), Positives = 248/498 (49%), Gaps = 38/498 (7%)

Query: 6   ILSVKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVE 65
           +LS +++ T+ L  ++     +   A+          +  R SPS+V++           
Sbjct: 1   MLSPRALWTLMLATLLVLVQAVQAMAR----PESFADLADRFSPSVVNITTSTMV----- 51

Query: 66  QMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTS 125
                 G   +PE  P +++FR+   +      P           GSGF I++DGYI+T+
Sbjct: 52  -AGREQGSPIVPEGSPFEDFFREFQDRNRGDRAP-----RRSSALGSGFVISEDGYIVTN 105

Query: 126 NHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEA 185
           NH++      ++   +  EL A+LVGTD   D+A+LKV++D     V F D++  RVG+ 
Sbjct: 106 NHVISGADEITIEFFNGEELDAELVGTDEKTDIALLKVETDEPLPYVNFGDSDLARVGDW 165

Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVN 245
           V  +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN
Sbjct: 166 VVAMGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNLDGEVIGVN 225

Query: 246 AMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLRGT 305
             I++     +G+G  +  +++K  +  L   G    GW G+  Q++T+++A  +GL   
Sbjct: 226 TAILSPTGGSIGIGFSMASNVVKGVVDQLKEYGETRRGWLGVRIQDVTEDMADAMGLEEV 285

Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365
           +G++++  V E PA +AGMK GDVI   DG  ++  +  V Q+ +    + V++++ ++G
Sbjct: 286 RGAMVSD-VPEGPAMEAGMKAGDVITSFDGVDVEDTRGLVRQVGNTQVGKTVRVTVWRDG 344

Query: 366 SKHSVAVVLGSSPTAKNDMHL-------EVGDKELLGMVLQDINDGNKKLV-------RI 411
              ++ V LG    A+            E  +K+L+GM L  + +     +        +
Sbjct: 345 ETETLRVTLGRREEAEAQAVPAAQPGGDEPMEKDLMGMSLSAVTEDLAGQLGLDADAEGL 404

Query: 412 VALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPD 471
           V  + ++  +   KG++ G  I      +++ I D+E  +  A++  R S+LL I+ + +
Sbjct: 405 VVRDVDQASDAYEKGLRAGDLITEAGQQQIATIGDLEERVAAARDAGRKSILLLIRREGE 464

Query: 472 MQSGNDNMSRFVSLKIDK 489
                    RFV+L I +
Sbjct: 465 --------PRFVALPISE 474


>gi|260427244|ref|ZP_05781223.1| protease Do subfamily [Citreicella sp. SE45]
 gi|260421736|gb|EEX14987.1| protease Do subfamily [Citreicella sp. SE45]
          Length = 492

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 142/495 (28%), Positives = 242/495 (48%), Gaps = 34/495 (6%)

Query: 9   VKSICTVALTCVIFSSTYLVLEAKLPPSSVDLPPVIARVSPSIVSVMVEPKKKVSVEQMF 68
           ++      L+  +  S  L+  A+  P       +  +VSPS+V++              
Sbjct: 16  LRLFWLATLSMFMIVSQALMASAQGAPQ--SFSVLAEKVSPSVVNITTSTMVAGRTGPQ- 72

Query: 69  NAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHI 128
                G +PE  P +++FR+   +      P           GSGF I++DGYI+T+NH+
Sbjct: 73  -----GIVPEGSPFEDFFREFQDRNGG---PGEDRPRRSSALGSGFVISEDGYIVTNNHV 124

Query: 129 VEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFT 188
           +E      +   +   LPA LVGTD   D+A+LKV++D     V F +++N +VG+ V  
Sbjct: 125 IEGADEIEIEFFEGFSLPATLVGTDPNTDIALLKVEADSPLKFVSFGNSDNAKVGDWVMA 184

Query: 189 IGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMI 248
           +GNP     +VSAGIVSA +R +      + Q DA IN+GNSGGP FN  G VIGVN  I
Sbjct: 185 MGNPLGQGFSVSAGIVSARNRALSGTYDDYIQTDAAINRGNSGGPLFNMNGEVIGVNTAI 244

Query: 249 VTSGQ