RPSBLAST alignment for GI: 254780700 and conserved domain: smart00228

>gnl|CDD|128524 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2. Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities. Length = 85
 Score = 46.2 bits (110), Expect = 2e-05
 Identities = 21/85 (24%), Positives = 36/85 (42%), Gaps = 9/85 (10%)

Query: 281 DHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKS 340
             G  G        E           G ++++VV  SPA KAG+KVGDVI  ++G  ++ 
Sbjct: 10  GGGGLGFSLVGGKDEG---------GGVVVSSVVPGSPAAKAGLKVGDVILEVNGTSVEG 60

Query: 341 HQDFVWQIASRSPKEQVKISLCKEG 365
                     +    +V +++ + G
Sbjct: 61  LTHLEAVDLLKKAGGKVTLTVLRGG 85