RPSBLAST alignment for GI: 254780700 and conserved domain: PRK10898

>gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional. Length = 353
 Score =  152 bits (387), Expect = 1e-37
 Identities = 89/275 (32%), Positives = 141/275 (51%), Gaps = 8/275 (2%)

Query: 111 GSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFI 170
           GSG  +   GYILT+ H++ D     V L D     A LVG+D+L DLAVLK+ +    +
Sbjct: 80  GSGVIMDQRGYILTNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATN--L 137

Query: 171 PVEFEDANNI-RVGEAVFTIGNPFRLRGTVSAGIVSALDRD--IPDRPGTFTQIDAPINQ 227
           PV   +   +  +G+ V  IGNP+ L  T++ GI+SA  R    P     F Q DA IN 
Sbjct: 138 PVIPINPKRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLSPTGRQNFLQTDASINH 197

Query: 228 GNSGGPCFNALGHVIGVNAMIV---TSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHGW 284
           GNSGG   N+LG ++G+N +       G+   G+G  IP  +  K +  LI  GRV  G+
Sbjct: 198 GNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPTQLATKIMDKLIRDGRVIRGY 257

Query: 285 FGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF 344
            GI  + +    A   G+   +G ++  V  + PA KAG++V D+I  ++ +   S  + 
Sbjct: 258 IGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAAKAGIQVNDLIISVNNKPAISALET 317

Query: 345 VWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPT 379
           + Q+A   P   + + + ++  + ++ V +   P 
Sbjct: 318 MDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA 352