RPSBLAST alignment for GI: 254780700 and conserved domain: COG0265

>gnl|CDD|30614 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]. Length = 347
 Score =  209 bits (532), Expect = 1e-54
 Identities = 112/286 (39%), Positives = 162/286 (56%), Gaps = 5/286 (1%)

Query: 99  PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158
           P           GSGF I+ DGYI+T+NH++      +V L+D  E+PAKLVG D + DL
Sbjct: 62  PSDPPLRSAEGLGSGFIISSDGYIVTNNHVIAGAEEITVTLADGREVPAKLVGKDPISDL 121

Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD---IPDRP 215
           AVLK+        +   D++ +RVG+ V  IGNPF L  TV++GIVSAL R         
Sbjct: 122 AVLKIDGAGGLPVIALGDSDKLRVGDVVVAIGNPFGLGQTVTSGIVSALGRTGVGSAGGY 181

Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275
             F Q DA IN GNSGGP  N  G V+G+N  I+       G+G  IP++++   +  LI
Sbjct: 182 VNFIQTDAAINPGNSGGPLVNIDGEVVGINTAIIAPSGGSSGIGFAIPVNLVAPVLDELI 241

Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335
           SKG+V  G+ G++ + LT ++A  LGL    G+++  V+  SPA KAG+K GD+I  ++G
Sbjct: 242 SKGKVVRGYLGVIGEPLTADIA--LGLPVAAGAVVLGVLPGSPAAKAGIKAGDIITAVNG 299

Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK 381
           + + S  D V  +AS  P ++V + L + G +  +AV LG      
Sbjct: 300 KPVASLSDLVAAVASNRPGDEVALKLLRGGKERELAVTLGDRSPLS 345