RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780700|ref|YP_003065113.1| serine protease DO-like protease [Candidatus Liberibacter asiaticus str. psy62] (489 letters) >gnl|CDD|30614 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]. Length = 347 Score = 209 bits (532), Expect = 1e-54 Identities = 112/286 (39%), Positives = 162/286 (56%), Gaps = 5/286 (1%) Query: 99 PILSDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDL 158 P GSGF I+ DGYI+T+NH++ +V L+D E+PAKLVG D + DL Sbjct: 62 PSDPPLRSAEGLGSGFIISSDGYIVTNNHVIAGAEEITVTLADGREVPAKLVGKDPISDL 121 Query: 159 AVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRD---IPDRP 215 AVLK+ + D++ +RVG+ V IGNPF L TV++GIVSAL R Sbjct: 122 AVLKIDGAGGLPVIALGDSDKLRVGDVVVAIGNPFGLGQTVTSGIVSALGRTGVGSAGGY 181 Query: 216 GTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLI 275 F Q DA IN GNSGGP N G V+G+N I+ G+G IP++++ + LI Sbjct: 182 VNFIQTDAAINPGNSGGPLVNIDGEVVGINTAIIAPSGGSSGIGFAIPVNLVAPVLDELI 241 Query: 276 SKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDG 335 SKG+V G+ G++ + LT ++A LGL G+++ V+ SPA KAG+K GD+I ++G Sbjct: 242 SKGKVVRGYLGVIGEPLTADIA--LGLPVAAGAVVLGVLPGSPAAKAGIKAGDIITAVNG 299 Query: 336 RIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK 381 + + S D V +AS P ++V + L + G + +AV LG Sbjct: 300 KPVASLSDLVAAVASNRPGDEVALKLLRGGKERELAVTLGDRSPLS 345 >gnl|CDD|36534 KOG1320, KOG1320, KOG1320, Serine protease [Posttranslational modification, protein turnover, chaperones]. Length = 473 Score = 92.7 bits (230), Expect = 2e-19 Identities = 81/326 (24%), Positives = 134/326 (41%), Gaps = 46/326 (14%) Query: 86 FRKDFHKFFSGEEPILSDTVERLMFGSGFFITDDGYILTSNHIVEDGA-----SFSVILS 140 F K + F G+ P L+ GSGF + DG I+T+ H+V S +V+L Sbjct: 149 FWKGMNPFELGDIPSLN--------GSGFVVGGDGIIVTNGHVVRVEPRIYAHSSTVLLR 200 Query: 141 DDTEL--------PAKLVGTDALFDLAVLKVQSDRKFIPV-EFEDANNIRVGEAVFTIGN 191 + +VG D + +A LK+++ + V +++ R G V IGN Sbjct: 201 VQIDAAIGPGNSGEPVIVGVDKVAGVAFLKIKTPENILYVIPLGVSSHFRTGVEVSAIGN 260 Query: 192 PFRLRGTVSAGIVSALDRDIPDRPGTFT-------QIDAPINQGNSGGPCFNALGHVIGV 244 F L T++ G+VS R Q DA IN GNSGGP N G VIGV Sbjct: 261 GFGLLNTLTQGMVSGQLRKSFKLGLETGVLISKINQTDAAINPGNSGGPLLNLDGEVIGV 320 Query: 245 NAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRV---------DHGWFGIMTQNLTQE 295 N VT F G+ IP+ + + L H + G+ + + Sbjct: 321 NTRKVTRIGFSHGISFKIPIDTVLVIVLRLGEFQISLRPVKPLVPVHQYIGLPSYYIFAG 380 Query: 296 LAIPLGLR-------GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQI 348 L + + L++ V+ S G+K GD + ++G+ +K+ + I Sbjct: 381 LVFVPLTKSYIFPSGVVQLVLVSQVLPGSINGGYGLKPGDQVVKVNGKPVKNLKHLYELI 440 Query: 349 ASRSPKEQVKISLCKEGSKHSVAVVL 374 S +++V + L + ++ + +L Sbjct: 441 EECSTEDKVAV-LDRRSAEDATLEIL 465 Score = 48.8 bits (116), Expect = 3e-06 Identities = 81/385 (21%), Positives = 139/385 (36%), Gaps = 39/385 (10%) Query: 106 ERLMFGSGFFITDDGYILTSNHIVE---DGASFSV-ILSDDTELPAKLVGTDALFDLAVL 161 + GSGF I +LT+ H+V D +V + A + DLAV+ Sbjct: 84 QFSSGGSGFAIYG-KKLLTNAHVVAPNNDHKFVTVKKHGSPRKYKAFVAAVFEECDLAVV 142 Query: 162 KVQSDRKFIPVEF-EDANNIRVGEAVFTIGNPFRLRG---TVSAGIVSALDRDIPDRPGT 217 ++S+ EF + N +G+ G+ F + G V+ G V ++ I T Sbjct: 143 YIESE------EFWKGMNPFELGDIPSLNGSGFVVGGDGIIVTNGHVVRVEPRIYAHSST 196 Query: 218 FT---QIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL 274 QIDA I GNSG P + V GV + + + + + +IPL + + Sbjct: 197 VLLRVQIDAAIGPGNSGEPVIVGVDKVAGVAFLKIKTPE---NILYVIPLGVSSHFRTGV 253 Query: 275 ISKG-RVDHGWFGIMTQNLTQ-ELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM 332 G +TQ + +L L G LI+ + + A G G + Sbjct: 254 EVSAIGNGFGLLNTLTQGMVSGQLRKSFKLGLETGVLISKINQTDAAINPG-NSGGPLLN 312 Query: 333 LDGRII------KSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAK----N 382 LDG +I + F I+ + P + V + + + G + Sbjct: 313 LDGEVIGVNTRKVTRIGFSHGISFKIPIDTVLVIVLRLGEFQISLRPVKPLVPVHQYIGL 372 Query: 383 DMHLEVGD--KELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHE 440 + L G +LV + + P G++ G +V VN Sbjct: 373 PSYYIFAGLVFVPLTKSYIF-PSGVVQLVLVSQVLPGSING--GYGLKPGDQVVKVNGKP 429 Query: 441 VSCIKDVERLIGKAKEKKRDSVLLQ 465 V +K + LI + + + +VL + Sbjct: 430 VKNLKHLYELIEECSTEDKVAVLDR 454 >gnl|CDD|29044 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 90 Score = 72.2 bits (177), Expect = 3e-13 Identities = 36/90 (40%), Positives = 56/90 (62%) Query: 283 GWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342 W G+ Q+LT +LA LGL+ TKG L+ +V SPA KAG+K GDVI ++G+ +KS Sbjct: 1 PWLGVTVQDLTPDLAEELGLKDTKGVLVASVDPGSPAAKAGLKPGDVILAVNGKPVKSVA 60 Query: 343 DFVWQIASRSPKEQVKISLCKEGSKHSVAV 372 D +A P ++V +++ + G + +V V Sbjct: 61 DLRRALAELKPGDKVTLTVLRGGKELTVTV 90 Score = 32.6 bits (74), Expect = 0.23 Identities = 19/83 (22%), Positives = 36/83 (43%), Gaps = 12/83 (14%) Query: 393 LLGMVLQDIND--------GNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCI 444 LG+ +QD+ + K V + +++P G++ G I++VN V + Sbjct: 2 WLGVTVQDLTPDLAEELGLKDTKGVLVASVDPGSP--AAKAGLKPGDVILAVNGKPVKSV 59 Query: 445 KDVERLIGKAKEKKRDSVLLQIK 467 D+ R + + K D V L + Sbjct: 60 ADLRRALAEL--KPGDKVTLTVL 80 >gnl|CDD|143870 pfam00089, Trypsin, Trypsin. Length = 218 Score = 58.6 bits (142), Expect = 4e-09 Identities = 37/177 (20%), Positives = 59/177 (33%), Gaps = 33/177 (18%) Query: 102 SDTVERLMFGSGFFITDDGYILTSNHIVEDGASFSVILSDDT---------------ELP 146 S V G + + ++LT+ H V + S V+L + Sbjct: 17 SLQVSSGKHFCGGSLISENWVLTAAHCVSNAKSVRVVLGAHNIVLREGGEQKFDVEKIIV 76 Query: 147 AKLVGTDALFDLAVLKVQSDRKF----IPVEFEDANNIR-VGEAVFTIG----NPFRLRG 197 D L D+A+LK++S P+ A++ VG G L Sbjct: 77 HPNYNPDTLNDIALLKLKSPVTLGDTVRPICLPTASSDLPVGTTCTVSGWGNTKTLGLPD 136 Query: 198 TVSAGIVSALDRDIPDRPG------TFTQIDAP---INQGNSGGPCFNALGHVIGVN 245 T+ V + R+ T A QG+SGGP + G +IG+ Sbjct: 137 TLQEVTVPVVSRETCRSAYGGTVTDTMICAGAGGKDACQGDSGGPLVCSDGELIGIV 193 >gnl|CDD|36635 KOG1421, KOG1421, KOG1421, Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only]. Length = 955 Score = 56.2 bits (135), Expect = 2e-08 Identities = 72/329 (21%), Positives = 131/329 (39%), Gaps = 38/329 (11%) Query: 101 LSDTVERLMF-GSGFFI-TDDGYILTSNHIVEDG-ASFSVILSDDTELPAKLVGTDALFD 157 DT +GF + GYILT+ H+V G S + + E+ V D + D Sbjct: 75 AFDTESAGESEATGFVVDKKLGYILTNRHVVAPGPFVASAVFDNHEEIEIYPVYRDPVHD 134 Query: 158 LAVLKV--QSDRKFIPVEFEDANNI-RVGEAVFTIGNPFRLRGTVSAGIVSALDRDIPDR 214 + + R I E A + +VG + +GN + ++ AG +S LDR+ PD Sbjct: 135 FGFFRYDPSTIRFSIVTEICLAPELAKVGSEIRVVGNDAGEKLSILAGFLSRLDRNAPDY 194 Query: 215 P-------GTF-TQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSI 266 TF Q + + G+SG P + G+ + +NA S +PL Sbjct: 195 GEDTYNDFNTFYIQAASSTSGGSSGSPVVDIPGYAVALNAGGSISS----ASDFFLPLDR 250 Query: 267 IKKAIPSLISKGRVDHGWFGIMTQNLTQELAIPLGLR------------GTKGSL-ITAV 313 + +A+ L + + G + + + LGL G L + V Sbjct: 251 VVRALRCLQNNTPITRGTLQVEFLHKLFDECRRLGLSSEWEQVVRTKFPERTGMLVVETV 310 Query: 314 VKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVV 373 + E PA+K ++ GD++ ++ + + + QI + +++++ + G + + V Sbjct: 311 LPEGPAEKK-LEPGDILLAVNSTCLNDFEA-LEQILDEGVGKNLELTIQRGGQELELTVT 368 Query: 374 LGSSPTAKNDMHLEVGDKELLGMVLQDIN 402 + D LEV G V D++ Sbjct: 369 VQDLHGITPDRFLEVC-----GAVFHDLS 392 >gnl|CDD|29046 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 79 Score = 47.9 bits (114), Expect = 6e-06 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Query: 303 RGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362 +I VV SPA KAG+K GD I ++G+ IKS +D V + +P + + +++ Sbjct: 9 GPPIEPVIGEVVPGSPAAKAGLKAGDRILAINGQKIKSWEDLVDAVQ-ENPGKPLTLTVE 67 Query: 363 KEGSKHSVAVV 373 + G ++ + Sbjct: 68 RNGETITLTLT 78 Score = 27.5 bits (61), Expect = 8.1 Identities = 8/54 (14%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEK------KRDSVLLQIKYDP 470 G++ G I+++N ++ +D+ + + K +R+ + + P Sbjct: 26 AKAGLKAGDRILAINGQKIKSWEDLVDAVQENPGKPLTLTVERNGETITLTLTP 79 >gnl|CDD|29043 cd00986, PDZ_LON_protease, PDZ domain of ATP-dependent LON serine proteases. Most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this bacterial subfamily of protease-associated PDZ domains a C-terminal beta-strand is thought to form the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 79 Score = 43.0 bits (101), Expect = 2e-04 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365 G +T+VV+ PA +K GD I +DG+ K ++ + I S+ + VK+ + +E Sbjct: 8 HGVYVTSVVEGMPA-AGKLKAGDHIIAVDGKPFKEAEELIDYIQSKKEGDTVKLKVKREE 66 Query: 366 SKHSVAVVLGSSP 378 + ++L + P Sbjct: 67 KELPEDLILKTFP 79 >gnl|CDD|29047 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand is presumed to form the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 80 Score = 38.4 bits (89), Expect = 0.004 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHS 369 +T V +SPADKAG+ GD + ++G + + QD ++ + V++++ ++ Sbjct: 16 VTFVRDDSPADKAGLVAGDELVAVNGWRVDALQD---RLKEYQAGDPVELTVFRDDRLIE 72 Query: 370 VAVVLGS 376 V + L Sbjct: 73 VPLTLAD 79 >gnl|CDD|29048 cd00991, PDZ_archaeal_metalloprotease, PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 79 Score = 37.2 bits (86), Expect = 0.011 Identities = 18/63 (28%), Positives = 34/63 (53%) Query: 307 GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGS 366 G +I V+ SPA+ A + GDVI ++G I + +DF+ + P E + +++ + Sbjct: 11 GVVIVGVIVGSPAENAVLHTGDVIYSINGTPITTLEDFMEALKPTKPGEVITVTVLPSTT 70 Query: 367 KHS 369 K + Sbjct: 71 KLT 73 Score = 29.1 bits (65), Expect = 2.8 Identities = 8/42 (19%), Positives = 18/42 (42%) Query: 423 EAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464 E + G I S+N ++ ++D + K + +V + Sbjct: 24 ENAVLHTGDVIYSINGTPITTLEDFMEALKPTKPGEVITVTV 65 >gnl|CDD|29049 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements. May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases.. Length = 82 Score = 37.1 bits (86), Expect = 0.011 Identities = 13/61 (21%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Query: 301 GLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRII--KSHQDFVWQIASRSPKEQVK 358 G G ++ V PA++ G++VGD I ++G + +H++ V + + + + Sbjct: 21 GKDSGGGIFVSRVEPGGPAERGGLRVGDRILEVNGVSVEGLTHEEAVELLKNSGDEVTLT 80 Query: 359 I 359 + Sbjct: 81 V 81 >gnl|CDD|29042 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1, a mammalian tight junction protein.. Length = 70 Score = 37.1 bits (86), Expect = 0.011 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 5/68 (7%) Query: 299 PLGLRGTK----GSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVW-QIASRSP 353 LG G ++ +V SPA++AG++ GDVI ++G +K+ ++ + Sbjct: 2 GLGFSIRGGTEGGVVVLSVEPGSPAERAGLQAGDVILAVNGTDVKNLTLEDVAELLKKEV 61 Query: 354 KEQVKISL 361 E+V +++ Sbjct: 62 GEKVTLTV 69 >gnl|CDD|33755 COG3975, COG3975, Predicted protease with the C-terminal PDZ domain [General function prediction only]. Length = 558 Score = 35.7 bits (82), Expect = 0.027 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 11/85 (12%) Query: 300 LGLR---GTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQ 356 LGL+ IT V PA KAG+ GD I ++G Q+ ++ Sbjct: 453 LGLKVKSEGGHEKITFVFPGGPAYKAGLSPGDKIVAING--------ISDQLDRYKVNDK 504 Query: 357 VKISLCKEGSKHSVAVVLGSSPTAK 381 +++ + +EG V LG PTA+ Sbjct: 505 IQVHVFREGRLREFLVKLGGDPTAQ 529 >gnl|CDD|31136 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane]. Length = 406 Score = 35.3 bits (81), Expect = 0.037 Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 305 TKGSLITAVVKESPADKAGMKVGDVICMLDGR 336 G + + + SPA KAG+K GDVI +DG+ Sbjct: 111 IGGVKVVSPIDGSPAAKAGIKPGDVIIKIDGK 142 >gnl|CDD|29045 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 85 Score = 34.8 bits (80), Expect = 0.047 Identities = 16/31 (51%), Positives = 22/31 (70%) Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGR 336 G +IT+V+ SPA KAG+K GD+I +DG Sbjct: 13 GGLVITSVLPGSPAAKAGIKAGDIIVAIDGE 43 >gnl|CDD|144258 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF). PDZ domains are found in diverse signaling proteins. Length = 80 Score = 33.8 bits (78), Expect = 0.11 Identities = 12/55 (21%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSH-QDFVWQIASRSPKEQVKI 359 G ++ V+ A+ G++VGD I ++G+ +++ D +A + +V + Sbjct: 24 PGIFVSEVLPGGAAEAGGLQVGDRILSINGQDLENMSHDEA-VLALKGSGGEVTL 77 >gnl|CDD|38740 KOG3532, KOG3532, KOG3532, Predicted protein kinase [General function prediction only]. Length = 1051 Score = 32.0 bits (72), Expect = 0.36 Identities = 12/50 (24%), Positives = 22/50 (44%) Query: 293 TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQ 342 + + + + + V S ADKA K GDV+ ++ I+S + Sbjct: 385 SSPIGLVFDKNTNRAVKVCTVEDNSLADKAAFKPGDVLVAINNVPIRSER 434 >gnl|CDD|33283 COG3480, SdrC, Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms]. Length = 342 Score = 31.8 bits (72), Expect = 0.38 Identities = 15/67 (22%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEG 365 G + +V+ SP K ++ GD I +DG S + + ++S+ P ++V I + Sbjct: 130 AGVYVLSVIDNSPF-KGKLEAGDTIIAVDGEPFTSSDELIDYVSSKKPGDEVTIDYERHN 188 Query: 366 SKHSVAV 372 + Sbjct: 189 ETPEIVT 195 >gnl|CDD|38339 KOG3129, KOG3129, KOG3129, 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones]. Length = 231 Score = 31.5 bits (71), Expect = 0.59 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Query: 310 ITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDF--VWQIASRSPKEQVKISLCKEGSK 367 + +VV SPAD+AG+ VGD I + + + + + V +++ +EG K Sbjct: 143 VDSVVPGSPADEAGLCVGDEILKFGNVHSGNFLPLQNIAAVVQSNEDQIVSVTVIREGQK 202 Query: 368 HSVAVV 373 +++ Sbjct: 203 VVLSLT 208 >gnl|CDD|36323 KOG1107, KOG1107, KOG1107, Membrane coat complex Retromer, subunit VPS35 [Intracellular trafficking, secretion, and vesicular transport]. Length = 760 Score = 29.9 bits (67), Expect = 1.7 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 6/70 (8%) Query: 397 VLQDINDGNKKLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKE 456 VL + + NK VR+ P+RE+E K + +V N +S +L G E Sbjct: 153 VLINFTEMNKLWVRMQHQGPSREKEKREKERNELRILVGKNLVRLS------QLEGVDLE 206 Query: 457 KKRDSVLLQI 466 RD VL +I Sbjct: 207 MYRDDVLPRI 216 >gnl|CDD|38761 KOG3553, KOG3553, KOG3553, Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis]. Length = 124 Score = 28.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 306 KGSLITAVVKESPADKAGMKVGDVICMLDG 335 KG +T V + SPA+ AG+++ D I ++G Sbjct: 59 KGIYVTRVSEGSPAEIAGLRIHDKILQVNG 88 >gnl|CDD|31349 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion]. Length = 588 Score = 29.1 bits (65), Expect = 3.3 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 10/73 (13%) Query: 160 VLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFR------LRGTVSAGIVSALDRDIPD 213 +++++ +R I V +ED IR GE V G P L ++ GI LD I + Sbjct: 38 IIRIEGNRATIQV-YEDTAGIRPGEKVENTGRPLSVELGPGLLKSIYDGIQRPLDV-IKE 95 Query: 214 RPGTFTQ--IDAP 224 G F ++ P Sbjct: 96 TSGDFIARGLNPP 108 >gnl|CDD|32719 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]. Length = 272 Score = 28.2 bits (63), Expect = 5.0 Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 16/71 (22%) Query: 426 GIQKGMTI--------VSVNTHEVSCIKDVERLIG--------KAKEKKRDSVLLQIKYD 469 GI++G + V EVS ++D +R+IG ++ LL +Y Sbjct: 124 GIEQGFKNAVYFADEAIVVTNPEVSSVRDSDRIIGLLESKSRRAEIGEEPKEHLLLNRYR 183 Query: 470 PDMQSGNDNMS 480 P+M + +S Sbjct: 184 PEMVKRGEMLS 194 >gnl|CDD|88595 cd05795, Ribosomal_P0_L10e, Ribosomal protein L10 family, P0 and L10e subfamily; composed of eukaryotic 60S ribosomal protein P0 and the archaeal P0 homolog, L10e. P0 or L10e forms a tight complex with multiple copies of the small acidic protein L12(e). This complex forms a stalk structure on the large subunit of the ribosome. The stalk is known to contain the binding site for elongation factors G and Tu (EF-G and EF-Tu, respectively); however, there is disagreement as to whether or not L10 is involved in forming the binding site. The stalk is believed to be associated with GTPase activities in protein synthesis. In a neuroblastoma cell line, L10 has been shown to interact with the SH3 domain of Src and to activate the binding of the Nck1 adaptor protein with skeletal proteins such as the Wiskott-Aldrich Syndrome Protein (WASP) and the WASP-interacting protein (WIP). These eukaryotic and archaeal P0 sequences have an additional C-terminal domain homologous with acidic proteins P1 and P2.. Length = 175 Score = 28.2 bits (63), Expect = 5.5 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Query: 186 VFTIGNPFRLRGTVSAGIVSALDRDIPDRPGTFTQIDAPINQGNSG 231 +FT G+PF +R + V A P +PG D + G +G Sbjct: 82 IFTNGDPFEIRKILEENKVPA-----PAKPGAIAPCDVVVPAGPTG 122 >gnl|CDD|33306 COG3503, COG3503, Predicted membrane protein [Function unknown]. Length = 323 Score = 28.0 bits (62), Expect = 6.3 Identities = 12/64 (18%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Query: 240 HVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSLISKGRVDHG---WFGIMTQNLTQEL 296 H IG+ A ++ + + +++ L++ A L+ R W G+ Sbjct: 121 HAIGL-ASLLGAAFLWLPRAVLLALAVAAVAAHILLRPARFGTPMLWWLGLRPYGPRTLD 179 Query: 297 AIPL 300 PL Sbjct: 180 YYPL 183 >gnl|CDD|31093 COG0750, COG0750, Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane]. Length = 375 Score = 27.8 bits (61), Expect = 7.0 Identities = 12/54 (22%), Positives = 25/54 (46%) Query: 309 LITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLC 362 ++ V +S A AG++ GD I +DG + S D + + + +++ Sbjct: 132 VVGEVAPKSAAALAGLRPGDRIVAVDGEKVASWDDVRRLLVAAAGDVFNLLTIL 185 >gnl|CDD|34816 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]. Length = 1525 Score = 27.8 bits (61), Expect = 7.2 Identities = 13/83 (15%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Query: 82 LKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFF--ITDDGYILTSNHIVEDGASFSVIL 139 L + + + + PI D +L F+ + D + V+ G F I+ Sbjct: 773 LVFSYDSLMEIYLTSDTPIALDLSNKLFIDQDFYYRLLDRVDEPINRPRVDVGTQFVHII 832 Query: 140 SDDTELPAKLVGTDALFDLAVLK 162 + + + + D+ F ++ Sbjct: 833 DYYSRILEEYLDGDSGFIRTFVE 855 >gnl|CDD|33956 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]. Length = 640 Score = 27.6 bits (61), Expect = 8.8 Identities = 19/97 (19%), Positives = 39/97 (40%), Gaps = 5/97 (5%) Query: 368 HSVAVVLGSSPTAKNDMHLEVGDKELLGMVLQDINDGNKKLVRIVALNPNREREVEAKGI 427 HS + L ++ K ++ + V D M + G VA + + + + Sbjct: 459 HSGILALINAVYNKANILVVVLDNRTTAMTGGQPHPG-----TGVAAEGTKSTAIVIEEV 513 Query: 428 QKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLL 464 + M + V T + +K++ I +A E SV++ Sbjct: 514 VRAMGVEDVETVDPYDVKELSEAIKEALEVPGPSVII 550 >gnl|CDD|146618 pfam04083, Abhydro_lipase, ab-hydrolase associated lipase region. Length = 62 Score = 27.5 bits (62), Expect = 9.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Query: 116 ITDDGYILTSNHI 128 T+DGYILT + I Sbjct: 18 TTEDGYILTLHRI 30 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0810 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,727,819 Number of extensions: 308430 Number of successful extensions: 755 Number of sequences better than 10.0: 1 Number of HSP's gapped: 747 Number of HSP's successfully gapped: 38 Length of query: 489 Length of database: 6,263,737 Length adjustment: 98 Effective length of query: 391 Effective length of database: 4,146,055 Effective search space: 1621107505 Effective search space used: 1621107505 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 59 (26.4 bits)