RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780703|ref|YP_003065116.1| putative phosphate transport system protein [Candidatus Liberibacter asiaticus str. psy62] (229 letters) >gnl|CDD|162721 TIGR02135, phoU_full, phosphate transport system regulatory protein PhoU. This model describes PhoU, a regulatory protein of unknown mechanism for high-affinity phosphate ABC transporter systems. The protein consists of two copies of the domain described by Pfam model pfam01895. Deletion of PhoU activates constitutive expression of the phosphate ABC transporter and allows phosphate transport, but causes a growth defect and so likely has some second function. Length = 212 Score = 207 bits (529), Expect = 2e-54 Identities = 85/209 (40%), Positives = 129/209 (61%) Query: 7 SAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDIGDK 66 +DEEL L ++EMG + + ++ +VRA E D LA KVI++D ++ LE I +K Sbjct: 1 KRFDEELKELREELLEMGGLVEEQLEDAVRALTEKDRELARKVIEDDDQINALEVKIEEK 60 Query: 67 AIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGVPRKLVWTIEP 126 + IA +QP+A DLR I+ IKI++DLERIGD A N AKR L L+ K + +E Sbjct: 61 CLRLIALQQPVAKDLRLIISIIKISSDLERIGDYAVNIAKRALRLKEEDAKPKHLEELEK 120 Query: 127 LAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNITLCT 186 + +L+L+ L + LD + ++ E + + D +D ++ +FREL+TYM E+P NI Sbjct: 121 MGKLALKMLKDALDAFLNKDAELARQVAEMDERVDELYRQIFRELVTYMKENPENIEAAL 180 Query: 187 HLLFCSKNIERIGDHVTNIAETIHYMTTG 215 +L ++ +ERIGDH TNIAE + Y+ TG Sbjct: 181 DVLLIARYLERIGDHATNIAERVIYIKTG 209 >gnl|CDD|182974 PRK11115, PRK11115, transcriptional regulator PhoU; Provisional. Length = 236 Score = 136 bits (344), Expect = 5e-33 Identities = 75/213 (35%), Positives = 122/213 (57%), Gaps = 3/213 (1%) Query: 4 HILSAYDEELDFLSRRIVEMGIVSRKMVDSSVRAFIEGDTVLAHKVIDNDVVLDQLERDI 63 HI ++ EL+ + +++ MG + + + ++ A D LA +VI+ D ++ +E I Sbjct: 9 HISGQFNAELESIRTQVLTMGGLVEQQLSDAITAMHNQDAELAKRVIEGDHKVNMMEVAI 68 Query: 64 GDKAIITIAKRQPMASDLREIVGSIKIAADLERIGDLAKNTAKRVLALQMFGV-PRKLVW 122 + + IAKRQP ASDLR ++ IK ADLERIGD+A A+ AL+ F + L+ Sbjct: 69 DEACVRIIAKRQPTASDLRLVMAIIKTIADLERIGDVADKIAR--TALEKFSQQHQPLLV 126 Query: 123 TIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPRNI 182 ++E L +++ L ++LD + ++ I D ++D + + R+L+TYMMEDPR I Sbjct: 127 SLESLGRHTIQMLHDVLDAFARMDLDEAVRIYREDKKVDQEYEGIVRQLMTYMMEDPRTI 186 Query: 183 TLCTHLLFCSKNIERIGDHVTNIAETIHYMTTG 215 +L+C+++IERIGD NI E I Y G Sbjct: 187 PSVLTVLWCARSIERIGDRCQNICEYIIYFVKG 219 >gnl|CDD|165706 PLN00138, PLN00138, large subunit ribosomal protein LP2; Provisional. Length = 113 Score = 29.6 bits (66), Expect = 0.67 Identities = 12/25 (48%), Positives = 17/25 (68%) Query: 76 PMASDLREIVGSIKIAADLERIGDL 100 P A DL++I+GS+ AD +RI L Sbjct: 18 PSAEDLKDILGSVGADADDDRIELL 42 >gnl|CDD|180528 PRK06321, PRK06321, replicative DNA helicase; Provisional. Length = 472 Score = 28.3 bits (63), Expect = 1.8 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Query: 56 LDQLERDIGDKAIITIAKRQPMASDLREIVGSIKIAADL 94 L QL R + D+A +PM SDLRE GSI+ +DL Sbjct: 385 LSQLSRKVEDRA-----NHRPMMSDLRE-SGSIEQDSDL 417 >gnl|CDD|184529 PRK14133, PRK14133, DNA polymerase IV; Provisional. Length = 347 Score = 26.2 bits (58), Expect = 7.3 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Query: 121 VWTIEPLAELSLEQLSEILDVYGSRSTEKTQSICNRDGELDAMHTSLFRELLTYMMEDPR 180 ++TIE L +LS E L E +G E+ + I R+ E+ S+ +E T + +D + Sbjct: 194 IYTIEDLLKLSREFLIEYFGKFGVEIYERIRGIDYREVEVSRERKSIGKE--TTLKKDTK 251 Query: 181 NITLCTHLLF 190 + L Sbjct: 252 DKEELKKYLK 261 >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc. Length = 708 Score = 26.2 bits (58), Expect = 7.4 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Query: 30 MVDSSVRAFIEG----DTVLAHKVIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIV 85 + DS V E DT+ K+++N + ++ DK II +A R +A +I+ Sbjct: 627 LTDSKVLILDESTSNLDTITEKKIVNNLL-------NLQDKTIIFVAHRLSVAKQSDKII 679 >gnl|CDD|130686 TIGR01625, YidE_YbjL_dupl, AspT/YidE/YbjL antiporter duplication domain. This model represents a domain that is duplicated the aspartate-alanine antiporter AspT, as well as HI0035 of Haemophilus influenzae, YidE and YbjL of E. coli, and a number of other known or putative transporters. Member proteins may have 0, 1, or 2 copies of TrkA potassium uptake domain pfam02080 between the duplications. The domain contains several apparent transmembrane regions and is proposed here to act in transport. Length = 154 Score = 26.1 bits (58), Expect = 8.3 Identities = 12/35 (34%), Positives = 16/35 (45%) Query: 109 LALQMFGVPRKLVWTIEPLAELSLEQLSEILDVYG 143 L L FG L W I A L + + +L +YG Sbjct: 32 LLLGHFGATGPLTWYIPFSANLFIREFGLMLFLYG 66 >gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional. Length = 241 Score = 26.1 bits (58), Expect = 8.9 Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 11/74 (14%) Query: 75 QPMASDLREIVGSIKIAA-DLERIGDLAKNTAKRVLALQMFGVPRKLV------WTIEPL 127 + +A++LR + DL +A A+ L+ FG P L+ +T PL Sbjct: 44 EALAAELRSTGVKAAAYSIDLSNPEAIAPGIAE---LLEQFGCPDVLINNAGMAYT-GPL 99 Query: 128 AELSLEQLSEILDV 141 E+ L ++ + Sbjct: 100 LEMPLSDWQWVIQL 113 >gnl|CDD|132536 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively. Length = 413 Score = 25.7 bits (57), Expect = 9.4 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 14/82 (17%) Query: 35 VRAFIEGDTVL----AHK----VIDNDVVLDQLERDIGDKAIITIAKRQPMASDLREIVG 86 VR ++G VL A K ID VL + R + + I + + +A LRE++ Sbjct: 303 VRGILDGHIVLSRELAAKNHYPAID---VLASVSRVMNE---IVSEEHKELAGKLRELLA 356 Query: 87 SIKIAADLERIGDLAKNTAKRV 108 K A DL IG + + ++ Sbjct: 357 VYKEAEDLINIGAYKRGSNPKI 378 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0729 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,729,825 Number of extensions: 238278 Number of successful extensions: 458 Number of sequences better than 10.0: 1 Number of HSP's gapped: 451 Number of HSP's successfully gapped: 22 Length of query: 229 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 139 Effective length of database: 4,049,753 Effective search space: 562915667 Effective search space used: 562915667 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.0 bits)