HHsearch alignment for GI: 254780705 and conserved domain: CHL00187

>CHL00187 cysT sulfate transport protein; Provisional.
Probab=99.92  E-value=1.5e-23  Score=168.83  Aligned_cols=175  Identities=22%  Similarity=0.262  Sum_probs=145.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HH
Q ss_conf             202667899999999999999999999999998643730245678989988765336999999999999---------86
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI---------NF  271 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~---------~~  271 (425)
T Consensus        49 ~~~~~~~~~Sl~~s~~~t~i~~~ig~~~A~~l~r~~--~~gk~~~~~l~~lP~~iP~~v~a~~~~~~f~~~G~~~~~l~~  126 (235)
T CHL00187         49 PIALSAYSLTVSMALIAALINGIFGLLIAWVLVRYN--FPGKRFLDAAVDLPFALPTSVAGLTLATVYGDNGWIGHILSS  126 (235)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             999999999999999999999999999999999843--761899999999999978999999999996446617689997


Q ss_pred             HCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             26663-00468975334543668999999998511067898998707721277778839753325899999999998767
Q gi|254780705|r  272 FKMPR-STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE  350 (425)
Q Consensus       272 ~~~~~-~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GE  350 (425)
T Consensus       127 ~~~~~~~~~~giii~~~~~~~P~~~~~~~~~l~~i~~~leEAA~~lGAs~~~~f~~I~lPll~p~i~a~~~l~f~~~~~e  206 (235)
T CHL00187        127 LGIKIVFTKLGVLLAMIFVSLPFVVRTIQPVLQEIEKELEEAAWSLGASPWETFWKVIFPPLIPALLTGLALTFSRAIGE  206 (235)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             07651230999999999988799999899999860299999998739995041131217846899999999999999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             799999854321013665613445579999998603
Q gi|254780705|r  351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA  386 (425)
Q Consensus       351 ta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~  386 (425)
T Consensus       207 Fg~~~~lgGn-----~~~----~~~t~~~~iy~~~~  233 (235)
T CHL00187        207 YGSIVLISSN-----IPF----KDLVASVLIFQSLE  233 (235)
T ss_pred             HHHHHEEECC-----CCC----CCCHHHHHHHHHHH
T ss_conf             8789802568-----898----42048999999986