HHsearch alignment for GI: 254780705 and conserved domain: COG1176

>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].
Probab=99.81  E-value=2e-17  Score=129.74  Aligned_cols=199  Identities=22%  Similarity=0.256  Sum_probs=140.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHH---------
Q ss_conf             026678999999999999999999999999986437302456789899887653369999999----9999---------
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILG----SAVL---------  268 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~g----l~~~---------  268 (425)
T Consensus        63 ~y~~v~~~Sl~iA~~~T~~~lligyP~Ay~la~~~--~~~r~~ll~----lvilPfwts~LiR~yawi~iL~~~G~iN~~  136 (287)
T COG1176          63 LYLTVLLRSLWIAALVTLICLLLGYPVAYFLARSP--PRWRNLLLL----LVILPFWTSLLIRTYAWIVILGRNGLINQA  136 (287)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--HHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             89999999999999999999999999999999677--379999999----999999899999999999998347716488


Q ss_pred             HHHHCCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98626663------004689753345436689999999985110678989987077212777788397533258999999
Q gi|254780705|r  269 INFFKMPR------STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV  342 (425)
Q Consensus       269 ~~~~~~~~------~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il  342 (425)
T Consensus       137 L~~lGl~~~p~~ll~~~~aV~igmvy~~lPfmiLPly~al~~id~~L~eAA~dLGA~~~~~F~~VilPLs~pGi~aG~~l  216 (287)
T COG1176         137 LLALGLIDEPLRLLYTETAVIIGMVYIYLPFMILPLYAALEKIDPSLLEAARDLGASPFQTFRRVILPLSLPGIIAGSLL  216 (287)
T ss_pred             HHHCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHEEECCCHHHHHHHHHH
T ss_conf             99768878867988053367689999865999999999998399789999987599765476420321771899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999876779999985432101366561344557999999860366500699999999999999999999999999974
Q gi|254780705|r  343 SLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF  421 (425)
Q Consensus       343 ~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~  421 (425)
T Consensus       217 VFi~alG~fi~P~lLGG~~------------~~~ig~lI~~q~~~-~~nw-p~asA~sv~L~~i~~~~-~~~~~~~~~~  280 (287)
T COG1176         217 VFIPALGSFVTPALLGGPK------------VLMIGNLIYQQFLS-ARNW-PFASALAVVLLLVVLLL-LLLYLLFRRR  280 (287)
T ss_pred             HHHHHHHHHHHHHHHCCCC------------CCCHHHHHHHHHHH-HCCC-CHHHHHHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             9897758899889856975------------25399999999852-0584-47899999999999999-9999999987