HHsearch alignment for GI: 254780705 and conserved domain: COG2011

>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].
Probab=99.81  E-value=5.6e-18  Score=133.32  Aligned_cols=211  Identities=23%  Similarity=0.292  Sum_probs=164.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             211012026678999999999999999999999999986437-----302456789899887653369999999999998
Q gi|254780705|r  196 SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH-----KGFFSSFVQANINNLASVPSIVYGILGSAVLIN  270 (425)
Q Consensus       196 ~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~-----~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~  270 (425)
T Consensus         7 ~~~~~~~l~~a~~eTlyMv~~s~~~~~~iGlplGvlL~~T~~g~i~~n~~~~~il~~ivNi~Rs~PFiIL-lv~liP~Tr   85 (222)
T COG2011           7 SNDLWQLLWRATLETLYMVFVSTLFAFLIGLPLGVLLFLTGPGGLLENKLLYRILSAIVNILRSIPFIIL-LVALIPLTR   85 (222)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEECCCCCCCCHHHHHHHHHHHHHHHHCCHHHHH-HHHHHHHHH
T ss_conf             0657999999999999999999999999987663436781788613008899999999998751209999-999998899


Q ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             62666300468975334543668999999998511067898998707721277778839753325899999999998767
Q gi|254780705|r  271 FFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE  350 (425)
Q Consensus       271 ~~~~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GE  350 (425)
T Consensus        86 ~ivGTsiG~~AAivPL~i~a~PF~ARlve~aL~EVd~GvIEAA~amGAs~~~II~kVlLpEa~p~li~g~Tvt~I~LIg~  165 (222)
T COG2011          86 LIVGTSIGTTAAIVPLTIGAAPFVARLVESALREVDKGVIEAAQAMGASPWQIIRKVLLPEALPGLVSGITVTLISLIGY  165 (222)
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99726525304774167888889999999999744725899999849988888787326213678998899999999808


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       351 ta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
T Consensus       166 SAMAGaIGgGG--------L----GdlAir-yGY----~Rf~~~Vm~~~viillilVq~iQ~~Gd~l~~r~~kr  222 (222)
T COG2011         166 SAMAGAIGGGG--------L----GDLAIR-YGY----QRFNTDVMVVAVVILLILVQLIQSLGDRLVRRLDKR  222 (222)
T ss_pred             HHHHCCCCCCC--------H----HHHHHH-HHH----HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             88830226673--------3----699999-878----855883157999999999999999989999997149