HHsearch alignment for GI: 254780705 and conserved domain: COG4176

>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism].
Probab=99.71  E-value=3e-16  Score=122.33  Aligned_cols=151  Identities=24%  Similarity=0.400  Sum_probs=126.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             01202667899999999999999999999999998643730245678989988765336999999999999862666300
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST  278 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~  278 (425)
T Consensus        86 ~~~GlW~~tM~TLaLVl~a~~isivIGiPlGI~~a---r~~~~~~i~~PiLDlMQTmP~FVYLIPa----v~lFGl---G  155 (290)
T COG4176          86 GNLGLWDQTMQTLALVLTATLISIVIGIPLGIWAA---RSPRVYRIVRPILDLMQTMPTFVYLIPA----VMLFGL---G  155 (290)
T ss_pred             HHHCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH---CCHHHHHHHHHHHHHHHCCCHHHHHHHH----HHHCCC---C
T ss_conf             98150899999999999999999998004899985---3688999996899998605427999999----999078---8


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46897533454366899999999851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       279 ~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
T Consensus       156 ~VPg~iAtvIfA~PP~IRlT~LGIrqVp~eliEA~~AFG~t~~Q~L~kVqLPlA~PtIMaGiNQtIMlALsMVVIAsMIG  235 (290)
T COG4176         156 NVPGLIATVIFAMPPMIRLTNLGIRQVPAELIEAADAFGATPRQKLFKVQLPLALPTIMAGINQTIMLALSMVVIASMIG  235 (290)
T ss_pred             CCCEEEEEEEEECCCHHHHHHCCCCCCCHHHHHHHHHCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             87634136565368158776324101789999999970898888978720743077899866799999999999999875


Q ss_pred             H
Q ss_conf             4
Q gi|254780705|r  359 M  359 (425)
Q Consensus       359 ~  359 (425)
T Consensus       236 a  236 (290)
T COG4176         236 A  236 (290)
T ss_pred             C
T ss_conf             7