HHsearch alignment for GI: 254780705 and conserved domain: COG4208

>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism].
Probab=99.82  E-value=4.6e-20  Score=146.59  Aligned_cols=206  Identities=23%  Similarity=0.223  Sum_probs=147.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC------
Q ss_conf             26678999999999999999999999999986437302456789899887653369999999999998626663------
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPR------  276 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~------  276 (425)
T Consensus        63 alsAi~LTllva~I~VPlN~vFGv~aAW~iakf~F~G--k~lL~tlIDlPFsVSPVvaGl~~vLl~g~-~g~lG~wl~~~  139 (287)
T COG4208          63 ALSAIKLTLLVALIAVPLNVVFGVAAAWAIARFEFPG--KALLLTLIDLPFSVSPVVAGLVYVLLFGS-NGWLGGWLEAH  139 (287)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCC--HHHHHHHHCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHHC
T ss_conf             8999999999998630078999999999999705884--44665654377742279987899998705-66320788857


Q ss_pred             ----CHHHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ----0046897-53345436689999999985110678989987077212777788397533258999999999987677
Q gi|254780705|r  277 ----STALVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET  351 (425)
Q Consensus       277 ----~~~l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt  351 (425)
T Consensus       140 ~iqIiFa~PGiVLaT~FVT~PFVaREliPlmq~qG~~eEeAA~~LGAsgWQtFwrVTLPnIkWgLlYGvvL~nARamGEF  219 (287)
T COG4208         140 DIQIIFAVPGIVLATIFVTCPFVARELIPLMQEQGTDEEEAALTLGASGWQTFWRVTLPNIRWGLLYGVVLTNARAMGEF  219 (287)
T ss_pred             CCEEEEECCCCEEEEEEECCCHHHHHHHHHHHHHCCCHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHCHHHHCCC
T ss_conf             94699954741354522216128989879998839848899987262301102567547307999888987160554167


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999998543210136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       352 a~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
T Consensus       220 GAVsVVS---------G~IrG~TnTlPL~VEily~eY---~~~~AFa~AslLallAlvTL~lK~~le~r~~~  279 (287)
T COG4208         220 GAVSVVS---------GHIRGETNTLPLHVEILYNEY---NTVGAFAAASLLALLALVTLVLKTILEWRQGK  279 (287)
T ss_pred             CCEEEEE---------CCCCCCCCCCCHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7369984---------452477665230169887644---68899999999999999999999999987666