HHsearch alignment for GI: 254780705 and conserved domain: COG4239

>COG4239 ABC-type uncharacterized transport system, permease component [General function prediction only].
Probab=98.58  E-value=5.6e-05  Score=50.48  Aligned_cols=204  Identities=23%  Similarity=0.293  Sum_probs=118.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
T Consensus       133 lARliygfRiSvLfgL~lT~~SaliGv~~GA~qGyfg--g~vdL~~QRfIEvws~mP~l----yllii~as~~~-p~f~~  205 (341)
T COG4239         133 LARLIYGFRISVLFGLSLTLISALIGVLAGALQGYFG--GWVDLLGQRFIEVWSGMPTL----YLLIILASIFQ-PNFWW  205 (341)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHHCCCHH----HHHHHHHHHHC-CCHHH
T ss_conf             9999999999999999999999999998887753413--00488770599998447299----99999999968-54799


Q ss_pred             HHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6897-533454366899999999851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  280 LVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       280 l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
T Consensus       206 ll~i~llf~Wm~lv~vvRa--efLr~Rn~dYvkAArAlGv~d~~Ii~rHilPnamvatlTflPf~l~~sitTltsLdFLg  283 (341)
T COG4239         206 LLGIMLLFGWMSLVGVVRA--EFLRARNLDYVKAARALGVSDRRIILRHILPNAMVATLTFLPFILSGSITTLTSLDFLG  283 (341)
T ss_pred             HHHHHHHHHHHHHHHHHHH--HHHHHCCHHHHHHHHHCCCCCCEEEHHHHCCHHHHHHHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             9999999999999999999--99986026889999973988650302132629889999987898706332300166652


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             43210136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
T Consensus       284 f-----glp~gs----pSLGELl~qgk~nlqapWlgit--~fv~l~~~lslLvfIgea~Rdafdp  337 (341)
T COG4239         284 F-----GLPPGS----PSLGELLNQGKNNLQAPWLGIT--AFVVLSLLLSLLIFIGEAVRDAFDP  337 (341)
T ss_pred             C-----CCCCCC----CCHHHHHHHHHHCCCCCHHHHH--HHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             6-----999999----6789999976524778425588--9999999999999942998863150