HHsearch alignment for GI: 254780705 and conserved domain: PRK10782

>PRK10782 DL-methionine transporter permease subunit; Provisional.
Probab=99.94  E-value=1.9e-24  Score=174.49  Aligned_cols=204  Identities=18%  Similarity=0.170  Sum_probs=160.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             266789999999999999999999999999864-----373024567898998876533699999999999986266630
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF-----SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS  277 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~-----a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~  277 (425)
T Consensus         9 ll~g~~~Tl~mt~~s~~~~~iiglplGi~l~~~~~~~~~~~~~l~~~~~~~i~~~R~iP~lv~l~~~~~~~~~~~g~-~~   87 (217)
T PRK10782          9 LVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTLSAVVNIFRSIPFIILLVWMIPFTRVIVGT-SI   87 (217)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CC
T ss_conf             99999999999999999999999999999997320224434689999999999995068999999999999998446-62


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             04689753345436689999999985110678989987077212777788397533258999999999987677999998
Q gi|254780705|r  278 TALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV  357 (425)
Q Consensus       278 ~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~  357 (425)
T Consensus        88 g~~aaiiaL~i~~~~~iar~~~~~i~~V~~g~~EAa~alG~s~~q~i~~viLPqAlp~ii~~~~~~~i~~i~~tsl~g~I  167 (217)
T PRK10782         88 GLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAV  167 (217)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             16899999999998999999999998399879999998398988994851079219999999999999999999999998


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             5432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       358 ~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
T Consensus       168 G~gg--------LG----~~a~---~~~~~~~~--~~~~~~v~~l~~ilv~~i~~~~~~l~k~~~~r  217 (217)
T PRK10782        168 GAGG--------LG----QIGY---QYGYIGYN--ATVMNTVLVLLVILVYLIQFAGDRIVRAVTHK  217 (217)
T ss_pred             CCCH--------HH----HHHH---HHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             1047--------89----9999---99998515--10999999999999999999999999986379