HHsearch alignment for GI: 254780705 and conserved domain: PRK10998

>PRK10998 malG maltose transporter permease; Provisional.
Probab=99.79  E-value=4.6e-16  Score=121.13  Aligned_cols=204  Identities=15%  Similarity=0.075  Sum_probs=142.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH-
Q ss_conf             1202667899999999999999999999999998643730245678989988765336999999999999862666300-
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST-  278 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~-  278 (425)
T Consensus        78 ~~~~~~~~~NSl~va~~~~v~~l~~~~~aaYalar~~f~--g~~~l~~~~l~~~~iP~~~~~ip~~-~~~~~lgl~~~~~  154 (296)
T PRK10998         78 PFPVLLWLWNSVKIAGITAIGIVALSTTCAYAFARMRFP--GKATLLKGMLIFQMFPAVLSLVALY-ALFDRLGQYIPFI  154 (296)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEECC--CHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCCH
T ss_conf             437899999999999999999999999999987312155--5899999999999988999999999-9999960202201


Q ss_pred             --HHHHHHHH-HHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHH
Q ss_conf             --46897533-45436689999999985110678989987077212777788397533258999999999987677-999
Q gi|254780705|r  279 --ALVGGLIL-ALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET-APL  354 (425)
Q Consensus       279 --~l~g~~~l-~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt-a~l  354 (425)
T Consensus       155 ~l~t~~~ii~~~~~~~~~~i~ll~~ff~~iP~el~EAA~iDGas~~~~f~~IilPl~~P~i~t~~i~~fi~~WNef~~~l  234 (296)
T PRK10998        155 GLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVAS  234 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             33224999999999999999999999862979899999985997777978767862599999999999999999999999


Q ss_pred             HHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99854321013665613445579999998603665006999999999999999999999999999741
Q gi|254780705|r  355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       355 l~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
T Consensus       235 l~l~~------------~~~~tl~v~l~~~~~~~~~~~g~~~A~~~i~~lP~lI----~f~~~qr~~i  286 (296)
T PRK10998        235 LLLRD------------VNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSALPITL----VFLLAQRWLV  286 (296)
T ss_pred             HHHCC------------CCCEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH----HHHHHHHHHH
T ss_conf             99089------------5430099999998662356499999999999999999----9999999999