HHsearch alignment for GI: 254780705 and conserved domain: PRK11123

>PRK11123 arginine transporter permease subunit ArtQ; Provisional.
Probab=99.71  E-value=5.5e-14  Score=107.91  Aligned_cols=204  Identities=17%  Similarity=0.142  Sum_probs=150.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHH---------
Q ss_conf             26678999999999999999999999999986437302456789899887653369999999999---998---------
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAV---LIN---------  270 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~---~~~---------  270 (425)
T Consensus         7 Ll~G~~~Tl~l~~~a~~~g~~lG~~la~~r--~s~~~~l~~~~~~yv~~~RgtP~lv~l~~~yfg~p~l~~~l~~~~~~~   84 (238)
T PRK11123          7 LASAAGMTVGLAVCALIVGLALAMFFAVWE--SAKWRPVAWPGTALVTLLRGLPEILVVLFIYFGSSQLLLTLSDGFTLN   84 (238)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999999999999999999999--888688999999999999167599999999995289887631000001


Q ss_pred             -----------HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -----------626663004689753345436689999999985110678989987077212777788397533258999
Q gi|254780705|r  271 -----------FFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG  339 (425)
Q Consensus       271 -----------~~~~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g  339 (425)
T Consensus        85 ~~~~~~~~~~~~~~~~~~~f~~avial~l~~~Ay~aEi~R~gi~sVp~GQ~EAa~alGms~~q~~r~IilPQa~r~~lP~  164 (238)
T PRK11123         85 LGFVQIPVQMDIENFEVSPFLCGVIALSLLYAAYASQTLRGALKAVPVGQWESGQALGLSKSAIFFRLVMPQMWRHALPG  164 (238)
T ss_pred             CHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             00111010012134564699999999999999999999999998399999999998498999999999989999999738


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999998767799999854321013665613445579999998603665006999999999999999999999999999
Q gi|254780705|r  340 STVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN  419 (425)
Q Consensus       340 ~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~  419 (425)
T Consensus       165 l~n~~i~liK~TSL~s~Igv~E--------l~~~a~~i~-------~~t~~~-~e~y~~~a~iYlii~~~l~~~~~~lEk  228 (238)
T PRK11123        165 LGNQWLVLLKDTALVSLISVND--------LMLQTKSIA-------TRTQEP-FTWYIIAAAIYLVITLISQYILKRIDL  228 (238)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHH-------HHHCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999849999998999--------999999999-------713456-999999999999999999999999999


Q ss_pred             HHHCC
Q ss_conf             74104
Q gi|254780705|r  420 RFKKR  424 (425)
Q Consensus       420 r~~~~  424 (425)
T Consensus       229 R~~r~  233 (238)
T PRK11123        229 RFTRF  233 (238)
T ss_pred             HHCCC
T ss_conf             85422