HHsearch alignment for GI: 254780705 and conserved domain: TIGR00974

>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system. The integral inner-membrane proteins translocate the substrate across the membrane. It has been shown , that most of these proteins contain a conserved region located about 80 to 100 residues from their C-terminal extremity. This region seems to be located in a cytoplasmic loop between two transmembrane domains. Apart from the conserved region, the sequence of these proteins is quite divergent, and they have a variable number of transmembrane helices,; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=100.00  E-value=0  Score=490.37  Aligned_cols=246  Identities=40%  Similarity=0.648  Sum_probs=221.1

Q ss_pred             HHHHHHHHHHCCC---CHHHCCCCCCCCCH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             9987456641122---02321344321101----2026678999999999999999999999999986437302456789
Q gi|254780705|r  174 KLDSDGALFLDFN---YGFFINGASSRPEV----AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ  246 (425)
Q Consensus       174 ~L~~~g~i~~~fn---~~f~t~~~s~~~e~----~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~  246 (425)
T Consensus        25 ~i~~~G~~~--ln~~n~~fft~~~~~~~~~~~~~GGi~~AivGT~~~~~~~~~ia~PlGi~~aiYL~EYa~~~~~~~~ir  102 (302)
T TIGR00974        25 YILIKGLPA--LNNNNLEFFTSSPTPTGTEGDGEGGIGPAIVGTLLLILLAIVIAVPLGIGAAIYLAEYAKEGRFTKFIR  102 (302)
T ss_pred             HHHHCCCHH--EECCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEHHHH
T ss_conf             999623000--211576004535777778888875336779999999999999999999998887553067894005687


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHH
Q ss_conf             899887653369999999999998----6266630046897-53345436689999999985110678989987077212
Q gi|254780705|r  247 ANINNLASVPSIVYGILGSAVLIN----FFKMPRSTALVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKV  321 (425)
Q Consensus       247 ~~i~~la~vPSIv~Gl~gl~~~~~----~~~~~~~~~l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~  321 (425)
T Consensus       103 ~~~~~LaG~PSIv~GLFg~~~fv~~~~i~l~~-~~S~laG~~LaLa~L~LP~iirtTeEal~~VP~~~Reas~ALGa~Kw  181 (302)
T TIGR00974       103 FAVDVLAGVPSIVVGLFGYALFVKTLGIYLGG-GFSALAGALLALAILILPVIIRTTEEALKAVPKDLREASLALGATKW  181 (302)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCHH
T ss_conf             88887521169999999999999776864522-06778799999999999999999899997247888899997260021


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCC---------CCCCC----CCCHHHHHHHHHHHHHC
Q ss_conf             7777883975332589999999999876779999985432--101---------36656----13445579999998603
Q gi|254780705|r  322 QTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA--FVT---------DYPVG----VTDIATAFPVQIYLWAA  386 (425)
Q Consensus       322 ~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~--~~~---------~~p~~----~~~p~~tlp~~Iy~~~~  386 (425)
T Consensus       182 ~TI~~~vLP~A~~GI~TG~iL~iaR~~GETAPLl~TA~~~~~~~~~~~~~N~~~~~p-~~~d~l~~~~~~L~~~iY~~~~  260 (302)
T TIGR00974       182 QTILKIVLPAALPGILTGIILSIARAAGETAPLLFTAGGSSSFLLGNSVLNDLPKAP-LGEDLLLSPPAALPVLIYNLAS  260 (302)
T ss_pred             HEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHH
T ss_conf             133224413103689999999999999989999999998877641035667776777-7754225764136888887640


Q ss_pred             C----CCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             6----65006-9999999999999999999999999997410
Q gi|254780705|r  387 D----AERPF-VERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       387 ~----~~~~~-~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
T Consensus       261 ~~~~~~~~~~~~~~a~~aalvL~~~vl~~N~~a~~~~~~~~~  302 (302)
T TIGR00974       261 ELANAPYSEARNELAWAAALVLIVLVLLLNLIARLLRRRFKK  302 (302)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             146788426888999999999999999999999999975249