Query         gi|254780705|ref|YP_003065118.1| phosphate ABC transporter, permease protein PstA [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 425
No_of_seqs    239 out of 2719
Neff          6.1 
Searched_HMMs 39220
Date          Sun May 29 20:33:18 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780705.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG0581 PstA ABC-type phosphat 100.0       0       0  499.1  28.5  260  165-425    31-292 (292)
  2 TIGR00974 3a0107s02c phosphate 100.0       0       0  490.4  21.9  246  174-423    25-302 (302)
  3 PRK11268 pstA phosphate transp 100.0       0       0  462.4  30.0  272   11-420    20-292 (292)
  4 TIGR02138 phosphate_pstC phosp 100.0       0       0  416.6  28.7  287   18-422     1-317 (317)
  5 PRK11275 pstC phosphate transp 100.0       0       0  410.2  26.4  235  186-424    53-315 (319)
  6 COG0573 PstC ABC-type phosphat 100.0       0       0  403.6  29.2  295    2-424     2-309 (310)
  7 pfam11812 DUF3333 Domain of un 100.0       0       0  321.0  15.6  152    7-160     1-154 (155)
  8 PRK09421 modB molybdate ABC tr 100.0 3.3E-29 8.3E-34  204.9  25.2  210  202-424     6-226 (229)
  9 TIGR02141 modB_ABC molybdate A 100.0 7.2E-30 1.8E-34  209.1  19.4  197  210-420     3-212 (212)
 10 COG4590 ABC-type uncharacteriz 100.0 7.3E-32 1.9E-36  221.8   7.4  223  200-425   425-730 (733)
 11 COG4149 ModC ABC-type molybdat 100.0 4.3E-30 1.1E-34  210.5  16.3  208  203-424     5-223 (225)
 12 PRK10971 sulfate/thiosulfate t 100.0 6.5E-28 1.6E-32  196.6  24.2  219  184-424    45-273 (277)
 13 TIGR01581 Mo_ABC_porter NifC-l 100.0 1.1E-27 2.7E-32  195.3  19.4  194  203-409    19-222 (226)
 14 COG0555 CysU ABC-type sulfate  100.0 3.7E-28 9.4E-33  198.2  14.4  210  201-424    53-272 (274)
 15 TIGR02139 permease_CysT sulfat 100.0 1.9E-28 4.7E-33  200.1  11.1  209  202-424    47-265 (265)
 16 PRK10592 putrescine transporte 100.0 3.3E-26 8.3E-31  185.8  22.5  208  201-424    59-270 (281)
 17 PRK11602 cysW sulfate/thiosulf 100.0 1.5E-26 3.9E-31  187.9  20.6  209  202-424    61-279 (291)
 18 TIGR03255 PhnV 2-aminoethylpho 100.0   5E-26 1.3E-30  184.6  23.0  204  204-423    67-272 (272)
 19 COG1177 PotC ABC-type spermidi 100.0 9.9E-26 2.5E-30  182.7  23.0  202  202-422    62-263 (267)
 20 TIGR00969 3a0106s02 sulfate AB  99.9 1.5E-28 3.7E-33  200.8   4.3  204  203-420    67-280 (280)
 21 PRK09500 potC spermidine/putre  99.9 6.1E-25 1.5E-29  177.7  22.6  202  201-421    54-255 (257)
 22 PRK10782 DL-methionine transpo  99.9 1.9E-24 4.9E-29  174.5  24.4  204  203-424     9-217 (217)
 23 TIGR03226 PhnU 2-aminoethylpho  99.9 4.6E-24 1.2E-28  172.1  20.5  209  200-424    87-311 (312)
 24 TIGR03262 PhnU2 putative 2-ami  99.9 1.3E-23 3.4E-28  169.2  18.9  209  200-424   327-539 (546)
 25 CHL00187 cysT sulfate transpor  99.9 1.5E-23 3.8E-28  168.8  18.8  175  201-386    49-233 (235)
 26 PRK09433 thiP thiamine transpo  99.9 2.7E-22   7E-27  160.8  21.5  205  200-420   324-531 (536)
 27 PRK09497 potB spermidine/putre  99.9 1.2E-22   3E-27  163.1  17.4  207  202-424    60-281 (285)
 28 TIGR02140 permease_CysW sulfat  99.9 5.7E-24 1.5E-28  171.5   8.6  203  204-420    46-272 (275)
 29 TIGR03262 PhnU2 putative 2-ami  99.9 1.2E-20 3.1E-25  150.3  23.9  204  201-421    50-260 (546)
 30 COG1178 ThiP ABC-type Fe3+ tra  99.9 1.9E-21 4.9E-26  155.4  19.3  203  201-420   329-534 (540)
 31 COG1178 ThiP ABC-type Fe3+ tra  99.9 2.7E-20 6.8E-25  148.1  23.5  204  199-419    50-265 (540)
 32 PRK10683 putrescine transporte  99.9 1.7E-20 4.2E-25  149.4  19.9  192  202-409    94-300 (317)
 33 cd06261 TM_PBP2 Transmembrane   99.9 2.8E-20 7.1E-25  148.0  19.8  153  207-361     1-155 (190)
 34 PRK09433 thiP thiamine transpo  99.8 2.8E-18 7.1E-23  135.2  23.7  206  200-420    49-267 (536)
 35 TIGR03416 ABC_choXWV_perm chol  99.8 2.1E-18 5.2E-23  136.1  20.0  151  199-359    80-230 (267)
 36 COG4662 TupA ABC-type tungstat  99.8 5.8E-18 1.5E-22  133.2  20.8  204  202-420    20-227 (227)
 37 PRK10952 glycine betaine trans  99.8 4.5E-18 1.1E-22  133.9  19.1  200  200-425   138-339 (354)
 38 COG4208 CysW ABC-type sulfate   99.8 4.6E-20 1.2E-24  146.6   8.4  206  203-423    63-279 (287)
 39 COG2011 AbcD ABC-type metal io  99.8 5.6E-18 1.4E-22  133.3  18.4  211  196-424     7-222 (222)
 40 COG1176 PotB ABC-type spermidi  99.8   2E-17 5.2E-22  129.7  21.2  199  202-421    63-280 (287)
 41 PRK10998 malG maltose transpor  99.8 4.6E-16 1.2E-20  121.1  24.8  204  200-422    78-286 (296)
 42 PRK10160 taurine transporter s  99.8 1.1E-15 2.7E-20  118.8  23.3  195  201-422    74-268 (275)
 43 PRK11365 ssuC alkanesulfonate   99.8 9.1E-16 2.3E-20  119.2  22.8  198  200-425    55-252 (263)
 44 COG1174 OpuBB ABC-type proline  99.8 1.2E-15   3E-20  118.6  22.6  153  199-361    20-172 (221)
 45 pfam00528 BPD_transp_1 Binding  99.8 3.9E-16 9.9E-21  121.6  19.2  180  221-424     1-180 (183)
 46 COG1175 UgpA ABC-type sugar tr  99.7 4.9E-15 1.3E-19  114.6  22.8  210  201-424    64-293 (295)
 47 PRK09494 glnP glutamine ABC tr  99.7 2.2E-14 5.7E-19  110.4  25.8  215  184-422     2-217 (219)
 48 PRK10561 glycerol-3-phosphate   99.7 3.8E-15 9.6E-20  115.3  20.8  200  202-415    52-270 (280)
 49 COG0395 UgpE ABC-type sugar tr  99.7 3.9E-14 9.9E-19  108.9  25.0  202  202-419    70-273 (281)
 50 COG0765 HisM ABC-type amino ac  99.7 4.2E-14 1.1E-18  108.6  25.0  209  199-425    14-222 (222)
 51 COG4176 ProW ABC-type proline/  99.7   3E-16 7.6E-21  122.3  13.6  151  199-359    86-236 (290)
 52 PRK11123 arginine transporter   99.7 5.5E-14 1.4E-18  107.9  25.0  204  203-424     7-233 (238)
 53 PRK10973 glycerol-3-phosphate   99.7 6.1E-14 1.6E-18  107.6  23.8  191  199-407    69-262 (281)
 54 COG0600 TauC ABC-type nitrate/  99.7 1.2E-13   3E-18  105.8  23.0  196  201-425    57-253 (258)
 55 COG4132 ABC-type uncharacteriz  99.7 1.3E-13 3.4E-18  105.5  20.7  211  202-425    53-280 (282)
 56 PRK11122 artM arginine transpo  99.6 2.1E-12 5.3E-17   97.8  24.4  155  203-360     8-171 (222)
 57 COG3639 ABC-type phosphate/pho  99.6 1.1E-12 2.7E-17   99.7  22.4  200  198-422    82-282 (283)
 58 PRK10999 malF maltose transpor  99.6   2E-13 5.1E-18  104.3  18.5  211  203-419   283-514 (520)
 59 COG1173 DppC ABC-type dipeptid  99.5 1.8E-11 4.6E-16   91.9  22.1  203  200-424    82-285 (289)
 60 PRK09881 ATP-dependent peptide  99.5 1.4E-11 3.7E-16   92.5  20.2  202  200-424    90-292 (296)
 61 PRK10417 nikC nickel transport  99.5   7E-11 1.8E-15   88.1  21.1  206  200-424    59-265 (272)
 62 PRK10913 dipeptide transporter  99.5 3.5E-11   9E-16   90.0  19.5  202  200-424    95-297 (300)
 63 COG3833 MalG ABC-type maltose   99.4 4.9E-10 1.2E-14   82.7  22.7  199  204-420    72-274 (282)
 64 PRK10352 nickel transporter pe  99.4   5E-10 1.3E-14   82.6  22.7  217  188-422    79-303 (314)
 65 PRK10914 dipeptide transporter  99.4 2.4E-09   6E-14   78.4  26.1  217  188-422    77-332 (339)
 66 COG4215 ArtQ ABC-type arginine  99.4 2.9E-10 7.4E-15   84.2  20.1  205  201-423     8-225 (230)
 67 PRK09471 oppB oligopeptide tra  99.4 7.2E-09 1.8E-13   75.3  25.1  207  198-422    85-301 (306)
 68 COG0601 DppB ABC-type dipeptid  99.3 1.1E-08 2.8E-13   74.2  25.5  216  189-422    77-310 (317)
 69 COG4209 LplB ABC-type polysacc  99.2   5E-09 1.3E-13   76.3  18.7  207  204-423    78-305 (309)
 70 TIGR03004 ectoine_ehuC ectoine  98.9 1.2E-06 3.1E-11   61.1  19.5  196  208-423    12-210 (216)
 71 COG4160 ArtM ABC-type arginine  98.9 1.8E-08 4.5E-13   72.8   9.4  129  205-335    15-152 (228)
 72 TIGR01253 thiP thiamine/thiami  98.8 2.2E-06 5.5E-11   59.5  18.1  268  100-411   231-516 (519)
 73 TIGR01097 3A0109s02M phosphona  98.8 8.1E-07 2.1E-11   62.2  15.9  181  210-418    12-192 (192)
 74 TIGR02790 nickel_nikC nickel A  98.7 6.7E-06 1.7E-10   56.4  19.0  200  200-422    58-258 (258)
 75 COG4986 ABC-type anion transpo  98.6 6.1E-07 1.6E-11   63.0  10.4  187  210-413   322-508 (523)
 76 TIGR03003 ectoine_ehuD ectoine  98.6 4.9E-06 1.2E-10   57.3  14.9  145  204-351    20-164 (218)
 77 COG4239 ABC-type uncharacteriz  98.6 5.6E-05 1.4E-09   50.5  19.6  204  200-423   133-337 (341)
 78 COG4986 ABC-type anion transpo  98.5   3E-05 7.7E-10   52.2  16.7  134  204-347     8-148 (523)
 79 COG4135 ABC-type uncharacteriz  98.5 0.00013 3.4E-09   48.1  20.1  154  201-361   340-497 (551)
 80 TIGR01253 thiP thiamine/thiami  98.4 0.00012 3.1E-09   48.4  18.3  205  200-423    42-259 (519)
 81 COG4171 SapC ABC-type antimicr  98.3 0.00014 3.5E-09   48.0  15.2  147  202-361    94-241 (296)
 82 COG4135 ABC-type uncharacteriz  98.0 0.00073 1.9E-08   43.4  14.1  209  200-425    51-284 (551)
 83 COG4597 BatB ABC-type amino ac  97.9 5.1E-06 1.3E-10   57.1   2.0  124  216-339   188-326 (397)
 84 TIGR01183 ntrB nitrate ABC tra  97.8  0.0015 3.9E-08   41.4  13.9  153  197-359     9-162 (203)
 85 TIGR02789 nickel_nikB nickel A  97.8 0.00069 1.8E-08   43.5  11.9  161  186-351    77-250 (315)
 86 TIGR01726 HEQRo_perm_3TM amino  96.7   0.045 1.1E-06   32.0  11.1   90  203-295     5-94  (99)
 87 COG4174 ABC-type uncharacteriz  94.9    0.11 2.8E-06   29.6   6.3  160  181-346   110-295 (364)
 88 COG4168 SapB ABC-type antimicr  94.6    0.32 8.3E-06   26.5  11.6   55  290-344   192-249 (321)
 89 COG0390 ABC-type uncharacteriz  94.5    0.35   9E-06   26.3   8.7   41  292-333   140-180 (256)
 90 pfam03649 UPF0014 Uncharacteri  92.7    0.71 1.8E-05   24.3  12.2   79  295-383   145-224 (250)
 91 TIGR01478 STEVOR variant surfa  91.2    0.23 5.8E-06   27.5   3.3   28  398-425   278-305 (315)
 92 PTZ00042 stevor; Provisional    89.6     1.4 3.7E-05   22.4   9.1   28  398-425   267-294 (304)
 93 PRK11275 pstC phosphate transp  85.8     0.4   1E-05   25.9   1.5   46   10-55      7-53  (319)
 94 PRK11086 sensory histidine kin  81.5    0.96 2.5E-05   23.5   2.0   37  201-237   169-205 (541)
 95 COG4709 Predicted membrane pro  75.8     5.3 0.00014   18.8  11.4   35  198-232    73-107 (195)
 96 KOG3312 consensus               70.2     7.2 0.00018   17.9   4.4   41    5-45     70-110 (186)
 97 pfam04306 DUF456 Protein of un  69.8     7.4 0.00019   17.9   6.8   11  314-324    56-66  (140)
 98 TIGR00797 matE MATE efflux fam  69.0     7.7  0.0002   17.8  12.4  160  185-357   159-335 (412)
 99 PRK11660 putative sulfate tran  68.3     5.7 0.00015   18.6   3.1   15  332-346   426-440 (567)
100 COG1033 Predicted exporters of  55.3      13 0.00034   16.2  11.0   13  346-358   319-331 (727)
101 TIGR00883 2A0106 MFS transport  55.2      14 0.00035   16.2  20.4  168  168-358     3-244 (413)
102 KOG3787 consensus               54.3      14 0.00036   16.1   4.3  150  195-360   208-366 (507)
103 PRK10555 aminoglycoside/multid  53.4      14 0.00037   16.0  15.9   27  398-424  1007-1033(1037)
104 TIGR03007 pepcterm_ChnLen poly  52.7      14 0.00036   16.1   2.9   39  313-351   396-444 (510)
105 COG0598 CorA Mg2+ and Co2+ tra  50.7      16 0.00041   15.7   3.7   31  387-420   289-319 (322)
106 COG1291 MotA Flagellar motor c  50.4      16 0.00041   15.7  10.3  194   29-256     7-234 (266)
107 KOG1934 consensus               49.2      17 0.00043   15.6   8.6  214   26-268   469-724 (868)
108 pfam11189 DUF2973 Protein of u  48.2      14 0.00036   16.1   2.3   46   30-75      7-58  (65)
109 PRK12482 flagellar motor prote  48.1      18 0.00045   15.5   6.3   30  200-229   199-228 (287)
110 COG0659 SUL1 Sulfate permease   47.6      18 0.00045   15.4   8.6   19  197-215    48-66  (554)
111 pfam10140 essB Predicted membr  47.3      18 0.00046   15.4   8.1   24  134-157    83-106 (359)
112 COG3135 BenE Uncharacterized p  44.7      20  0.0005   15.2   8.1   21  164-184    50-72  (402)
113 pfam02392 Ycf4 Ycf4. This fami  41.6      19 0.00047   15.3   2.0   30   21-51     63-92  (180)
114 CHL00036 ycf4 photosystem I as  41.5      20 0.00052   15.1   2.3   30   21-51     66-95  (184)
115 PRK08990 flagellar motor prote  41.0      22 0.00057   14.8   3.7   35  200-234   176-210 (253)
116 PRK08124 flagellar motor prote  40.7      23 0.00058   14.8   3.7   34  200-233   180-213 (263)
117 PRK02542 photosystem I assembl  40.7      20 0.00051   15.1   2.1   32   20-52     69-100 (188)
118 TIGR00879 SP MFS transporter,   37.9      25 0.00064   14.5  16.1  179  216-424   196-421 (572)
119 PRK10503 multidrug efflux syst  36.5      26 0.00067   14.4  14.3   22  403-424  1015-1036(1040)
120 COG3859 Predicted membrane pro  35.9      27 0.00069   14.3   3.2   52  285-336    36-94  (185)
121 TIGR01113 mtrE tetrahydrometha  35.8      27 0.00069   14.3   3.2   64  162-236    29-99  (298)
122 PRK09110 flagellar motor prote  35.6      27 0.00069   14.3   9.4   35  200-234   199-233 (283)
123 PRK06926 flagellar motor prote  34.2      29 0.00073   14.1   3.7   33  200-232   184-216 (272)
124 pfam04206 MtrE Tetrahydrometha  33.7      29 0.00075   14.1   5.1   57  165-231    32-93  (269)
125 PRK00972 tetrahydromethanopter  33.1      30 0.00076   14.0   4.9   57  165-231    39-99  (293)
126 pfam03594 BenE Benzoate membra  32.7      30 0.00077   14.0   8.6   14  321-334   205-218 (378)
127 pfam01350 Flavi_NS4A Flaviviru  31.7      21 0.00053   15.0   1.0   12  297-308    37-48  (145)
128 PRK11410 hypothetical protein;  30.6      33 0.00084   13.7   3.0  154   19-176     8-177 (570)
129 pfam04172 LrgB LrgB-like famil  30.4      33 0.00084   13.7  10.5   40  313-352   126-165 (215)
130 cd06159 S2P-M50_PDZ_Arch Uncha  29.5      34 0.00088   13.6   3.2   99  258-378   110-222 (263)
131 pfam00523 Fusion_gly Fusion gl  29.4      34 0.00088   13.6   4.6   18  218-235    96-113 (460)
132 pfam12273 RCR Chitin synthesis  28.7      35  0.0009   13.5   2.5   21   26-46      4-24  (124)
133 pfam06819 Arc_PepC Archaeal Pe  28.7      35  0.0009   13.5   1.9   24  163-186    87-110 (111)
134 pfam12072 DUF3552 Domain of un  27.8      37 0.00093   13.4   2.5   17   24-40      5-21  (201)
135 COG4097 Predicted ferric reduc  27.3      37 0.00095   13.4  12.9  103  252-361     4-142 (438)
136 TIGR02357 thia_yuaJ probable p  27.2      38 0.00096   13.4   7.7   12  376-387   147-158 (187)
137 TIGR00895 2A0115 MFS transport  27.2      38 0.00096   13.4   9.0   87  224-315   122-231 (413)
138 PRK01030 tetrahydromethanopter  27.0      38 0.00097   13.3   7.7   70  201-274    18-87  (266)
139 PRK06743 flagellar motor prote  26.9      38 0.00097   13.3   3.6   33  200-232   176-208 (254)
140 pfam06553 BNIP3 BNIP3. This fa  25.0      29 0.00075   14.1   0.8   34  198-233   153-186 (197)
141 KOG3120 consensus               23.8      43  0.0011   13.0   5.4  118   49-195     7-137 (256)
142 TIGR00383 corA magnesium and c  21.1      49  0.0013   12.6   2.0   92  296-420   245-336 (339)
143 pfam01726 LexA_DNA_bind LexA D  20.7      50  0.0013   12.6   3.6   35  303-337    22-56  (65)
144 COG4059 MtrE Tetrahydromethano  20.3      51  0.0013   12.5   4.6   51  177-232    45-100 (304)
145 PRK08456 flagellar motor prote  20.1      52  0.0013   12.5   5.1   35  200-234   179-213 (257)

No 1  
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism]
Probab=100.00  E-value=0  Score=499.07  Aligned_cols=260  Identities=40%  Similarity=0.619  Sum_probs=245.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             99999999999874566411220232134432110120266789999999999999999999999999864373024567
Q gi|254780705|r  165 SDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF  244 (425)
Q Consensus       165 sd~ql~~~d~L~~~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~  244 (425)
                      -..+..++.....+|.....+|+.|||+.++..+|.+|+++|++||+++++++.++++|+|+++||||+||+++|+++++
T Consensus        31 ~~~l~~il~~i~~~G~~~~~~~~~f~t~~~~~~~~~gGi~~Ai~GTl~~~~~~~li~~PiGv~aaIYL~EYa~~~~~t~~  110 (292)
T COG0581          31 LLPLLWILWTILIRGIPALSLNLEFFTGSPSPPGEGGGIGPAIVGTLYLILLAILIGVPLGIGAGIYLAEYAKKSRLTKV  110 (292)
T ss_pred             HHHHHHHHHHHHHHCHHHHHCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
T ss_conf             99999999999981667675141030589999988873699999999999999999998999999999997478729999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHH
Q ss_conf             89899887653369999999999998626663004689753345436689999999985110678989987077212777
Q gi|254780705|r  245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTV  324 (425)
Q Consensus       245 i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~  324 (425)
                      +|+++|+|+++||||||+|||++|+..+|+ ++|.++|+++|++|++|+++++|+|+|++||+++||||++||+|||||+
T Consensus       111 ir~~i~~La~vPSIV~GLFg~~~fV~~~g~-~~S~laGaLaLall~LP~iirtteeaL~~VP~~~ReAs~aLGasKwqtI  189 (292)
T COG0581         111 IRFAIDILASVPSIVYGLFGLGFFVVTLGF-GFSALAGALALALLMLPVVIRTTEEALRAVPDSLREAAYALGATKWQTI  189 (292)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHH
T ss_conf             999999880684499999999999999777-6179999999999988899999999998089999999997498487897


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCCCCCCHHHHHHHHHHHHHCC-CCCCHHHHHHHHHHH
Q ss_conf             78839753325899999999998767799999854-3210136656134455799999986036-650069999999999
Q gi|254780705|r  325 FHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM-VAFVTDYPVGVTDIATAFPVQIYLWAAD-AERPFVERTFGAILL  402 (425)
Q Consensus       325 ~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~-~~~~~~~p~~~~~p~~tlp~~Iy~~~~~-~~~~~~~~~~aa~lv  402 (425)
                      +||++|.|+|||+||++|++||++|||||++++++ .++..++|.++++|+++||+|||+|..+ ++.++++.+|+++++
T Consensus       190 ~~vvlP~A~pGIiTGviLaiaR~~GETAPlL~tag~~~~~~~~p~~~~~p~~~Lpv~Iy~~~~~~~~~~~~~~a~gaa~v  269 (292)
T COG0581         190 FKVVLPAALPGIITGVILAIARAAGETAPLLFTAGMSANSPSWPTDLLTPVAALPVHIYMLATSGPSPEAQELAWGAALV  269 (292)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             88889714758999999999999872489999965355146589876674431259999997056767799989999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999999999999741049
Q gi|254780705|r  403 LLIFLAVINTAMLWLRNRFKKRW  425 (425)
Q Consensus       403 Ll~~~~~~n~~a~~lr~r~~~~w  425 (425)
                      |+.+++.+|..|+++|||++|||
T Consensus       270 Ll~~vl~ln~~a~~l~~~~~~~~  292 (292)
T COG0581         270 LLLIVLLLNLLARLLRRRFRKKL  292 (292)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999885039


No 2  
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672   Bacterial binding protein-dependent transport systems ,  are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system. The integral inner-membrane proteins translocate the substrate across the membrane. It has been shown ,  that most of these proteins contain a conserved region located about 80 to 100 residues from their C-terminal extremity. This region seems  to be located in a cytoplasmic loop between two transmembrane domains. Apart from the conserved region, the sequence of these proteins is quite divergent, and they have a variable number of transmembrane helices,; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=100.00  E-value=0  Score=490.37  Aligned_cols=246  Identities=40%  Similarity=0.648  Sum_probs=221.1

Q ss_pred             HHHHHHHHHHCCC---CHHHCCCCCCCCCH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             9987456641122---02321344321101----2026678999999999999999999999999986437302456789
Q gi|254780705|r  174 KLDSDGALFLDFN---YGFFINGASSRPEV----AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ  246 (425)
Q Consensus       174 ~L~~~g~i~~~fn---~~f~t~~~s~~~e~----~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~  246 (425)
                      ..-.+|...  +|   +.|||+.++..+..    +||+|||+||++++.+|+++|+|+|+++||||+||+++++++++||
T Consensus        25 ~i~~~G~~~--ln~~n~~fft~~~~~~~~~~~~~GGi~~AivGT~~~~~~~~~ia~PlGi~~aiYL~EYa~~~~~~~~ir  102 (302)
T TIGR00974        25 YILIKGLPA--LNNNNLEFFTSSPTPTGTEGDGEGGIGPAIVGTLLLILLAIVIAVPLGIGAAIYLAEYAKEGRFTKFIR  102 (302)
T ss_pred             HHHHCCCHH--EECCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEHHHH
T ss_conf             999623000--211576004535777778888875336779999999999999999999998887553067894005687


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH----HHCCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHH
Q ss_conf             899887653369999999999998----6266630046897-53345436689999999985110678989987077212
Q gi|254780705|r  247 ANINNLASVPSIVYGILGSAVLIN----FFKMPRSTALVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKV  321 (425)
Q Consensus       247 ~~i~~la~vPSIv~Gl~gl~~~~~----~~~~~~~~~l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~  321 (425)
                      +.+|+|+|+||||||+|||++|+.    .+++ +.|.++|+ ++|++|+||+|+|+|+|++++||+++||||||||+|||
T Consensus       103 ~~~~~LaG~PSIv~GLFg~~~fv~~~~i~l~~-~~S~laG~~LaLa~L~LP~iirtTeEal~~VP~~~Reas~ALGa~Kw  181 (302)
T TIGR00974       103 FAVDVLAGVPSIVVGLFGYALFVKTLGIYLGG-GFSALAGALLALAILILPVIIRTTEEALKAVPKDLREASLALGATKW  181 (302)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCHH
T ss_conf             88887521169999999999999776864522-06778799999999999999999899997247888899997260021


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCC---------CCCCC----CCCHHHHHHHHHHHHHC
Q ss_conf             7777883975332589999999999876779999985432--101---------36656----13445579999998603
Q gi|254780705|r  322 QTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA--FVT---------DYPVG----VTDIATAFPVQIYLWAA  386 (425)
Q Consensus       322 ~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~--~~~---------~~p~~----~~~p~~tlp~~Iy~~~~  386 (425)
                      ||++||+||.|+|||+||+||++||++|||||+++|++..  +..         +.| .    +.+|.++||+|||++..
T Consensus       182 ~TI~~~vLP~A~~GI~TG~iL~iaR~~GETAPLl~TA~~~~~~~~~~~~~N~~~~~p-~~~d~l~~~~~~L~~~iY~~~~  260 (302)
T TIGR00974       182 QTILKIVLPAALPGILTGIILSIARAAGETAPLLFTAGGSSSFLLGNSVLNDLPKAP-LGEDLLLSPPAALPVLIYNLAS  260 (302)
T ss_pred             HEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHH
T ss_conf             133224413103689999999999999989999999998877641035667776777-7754225764136888887640


Q ss_pred             C----CCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             6----65006-9999999999999999999999999997410
Q gi|254780705|r  387 D----AERPF-VERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       387 ~----~~~~~-~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
                      +    ++.++ .+++||+++||+++++.+|..|+++|||+++
T Consensus       261 ~~~~~~~~~~~~~~a~~aalvL~~~vl~~N~~a~~~~~~~~~  302 (302)
T TIGR00974       261 ELANAPYSEARNELAWAAALVLIVLVLLLNLIARLLRRRFKK  302 (302)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             146788426888999999999999999999999999975249


No 3  
>PRK11268 pstA phosphate transporter permease subunit; Provisional
Probab=100.00  E-value=0  Score=462.35  Aligned_cols=272  Identities=25%  Similarity=0.422  Sum_probs=250.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEECHHHHCCCCCCCCCHHHHHCCCHHHHHH
Q ss_conf             88888656899999999999999999999999761444621689999987308889065765667988863045899999
Q gi|254780705|r   11 LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVR   90 (425)
Q Consensus        11 LkkR~~aEkrFr~yGi~AI~ial~fL~~Ll~sI~s~G~~AF~qT~I~l~V~~d~~~id~~~~~~~d~~~l~~~~~~~li~   90 (425)
                      -.||+.+|+.|+.....|..+++..|+.++++++.+|.+++                                       
T Consensus        20 ~~rR~~~d~~~~~l~~~~~~~~i~~L~~Il~~v~~~G~~~l---------------------------------------   60 (292)
T PRK11268         20 QARRRLKNRIALTLSLAAMAFGLFWLIWILMSTITLGIDGM---------------------------------------   60 (292)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHC---------------------------------------
T ss_conf             98899998999999999999999999999999998264117---------------------------------------


Q ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCHHHCCCEEEEEEEECCCCHHHHCCCCCCCCHHCCCCHHHHH
Q ss_conf             99996314566660348989987300168999999740632159747899970453023303455653000059999999
Q gi|254780705|r   91 KALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWK  170 (425)
Q Consensus        91 ~aL~~~~p~~~~~r~~kr~l~~liS~~a~~~Lrd~v~~np~liG~t~~~~llAsddvD~~~KG~i~r~e~~rrisd~ql~  170 (425)
                                                                                                      
T Consensus        61 --------------------------------------------------------------------------------   60 (292)
T PRK11268         61 --------------------------------------------------------------------------------   60 (292)
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             HHHHHHHHHHHHHCCCCHHHCCC-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             99999874566411220232134-43211012026678999999999999999999999999986437302456789899
Q gi|254780705|r  171 WFQKLDSDGALFLDFNYGFFING-ASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANI  249 (425)
Q Consensus       171 ~~d~L~~~g~i~~~fn~~f~t~~-~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i  249 (425)
                                     ||.|||+. ++..++.+||+|+++||++++++++++++|+|+++||||+||+++++++++++..+
T Consensus        61 ---------------~~~f~t~~~~~~~~~~gGi~~aivGTl~~~~~a~lia~Pigi~~aIyL~Eya~~~~~~~~ir~~i  125 (292)
T PRK11268         61 ---------------SLALFTEMTPPPNTEGGGLANAIAGSGLLILWATVVGTPLGIMAGIYLAEYGRKSWLAEVIRFIN  125 (292)
T ss_pred             ---------------CHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             ---------------89998388999998887669999999999999999999999999999999768643999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             88765336999999999999862666300468975334543668999999998511067898998707721277778839
Q gi|254780705|r  250 NNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVL  329 (425)
Q Consensus       250 ~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~l  329 (425)
                      |+|+|+||||||+||+.+++..++  ..+.++|+++|++|++|+++++++|++++||+++||||++||+||||++++|++
T Consensus       126 ~~LagiPSIV~Glfg~~~~v~~~~--~~s~lag~l~LaimilP~i~~~teeaL~~VP~~lreaa~ALGatkw~ti~~Vvl  203 (292)
T PRK11268        126 DILLSAPSIVVGLFVYTIVVAQME--HFSGWAGVIALALLQVPIVIRTTENMLKLVPDSLREAAYALGTPKWKMISAITL  203 (292)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHEEEEEC
T ss_conf             998427489999999999998521--255789999999999999999999999959988999999879986576223760


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             75332589999999999876779999985432101366561344557999999860366500699999999999999999
Q gi|254780705|r  330 PLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV  409 (425)
Q Consensus       330 p~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~  409 (425)
                      |.|+|||+||++||++|++|||||++||++..  ..+|.++++|.++||++||+|+.+++..+++.+||++++|+++++.
T Consensus       204 P~A~~GI~tgviLaiaRa~GETApll~ta~~~--~~~~~~l~~p~~tLp~~Iy~~a~~p~~~~~~la~a~alvL~~~vL~  281 (292)
T PRK11268        204 KASVSGIMTGVLLAIARIAGETAPLLFTALSN--QFWSTDMMQPIANLPVTIFKFAMSPFAEWQQLAWAGVLLITLCVLL  281 (292)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             76377999999999999998799999998332--3478997873015489999980496477999999999999999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999997
Q gi|254780705|r  410 INTAMLWLRNR  420 (425)
Q Consensus       410 ~n~~a~~lr~r  420 (425)
                      +|.+|++++||
T Consensus       282 lNi~ar~i~rr  292 (292)
T PRK11268        282 LNILARVVFAK  292 (292)
T ss_pred             HHHHHHHHHCC
T ss_conf             99999998559


No 4  
>TIGR02138 phosphate_pstC phosphate ABC transporter, permease protein PstC; InterPro: IPR011864   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     The typical operon for the high affinity inorganic phosphate ABC transporter encodes an ATP-binding protein, a phosphate-binding protein, and two permease proteins. This family describes PstC, which is homologous to PstA (IPR005672 from INTERPRO). In the Escherichia coli, this transport system is induced when the concentration of extrallular inorganic phosphate is low. A constitutive, lower affinity transporter operates otherwise.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016021 integral to membrane.
Probab=100.00  E-value=0  Score=416.64  Aligned_cols=287  Identities=31%  Similarity=0.425  Sum_probs=246.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEECHHHHCCCCCCCCCHHHHHCCCHHHHHHHHHHHHC
Q ss_conf             68999999999999999999999997614446216899999873088890657656679888630458999999999631
Q gi|254780705|r   18 EWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKL   97 (425)
Q Consensus        18 EkrFr~yGi~AI~ial~fL~~Ll~sI~s~G~~AF~qT~I~l~V~~d~~~id~~~~~~~d~~~l~~~~~~~li~~aL~~~~   97 (425)
                      ||-||+..+.+..+.+++++.+.+.++.+++|+|++..+..                                       
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~i~~fl~~~a~~~f~~~g~s~---------------------------------------   41 (317)
T TIGR02138         1 EKIFKGLLLIAAVIIVLVLLLIVLFLLIEAIPAFEKNGISL---------------------------------------   41 (317)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC---------------------------------------
T ss_conf             84899899999999999999999999997788887458740---------------------------------------


Q ss_pred             CCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCHHHCCCEEEEEEEECCCCHHHHCCCCCCCCHHCCCCHHHHHHHHHHHH
Q ss_conf             45666603489899873001689999997406321597478999704530233034556530000599999999999987
Q gi|254780705|r   98 SISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDS  177 (425)
Q Consensus        98 p~~~~~r~~kr~l~~liS~~a~~~Lrd~v~~np~liG~t~~~~llAsddvD~~~KG~i~r~e~~rrisd~ql~~~d~L~~  177 (425)
                                                               ..+..++++|--.++.                       
T Consensus        42 -----------------------------------------~~f~~~~~W~~~~~~~-----------------------   57 (317)
T TIGR02138        42 -----------------------------------------LNFLTGTVWDPDSKGA-----------------------   57 (317)
T ss_pred             -----------------------------------------EEEEECCCCCCCCCCC-----------------------
T ss_conf             -----------------------------------------0014312005543310-----------------------


Q ss_pred             HHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             45664112202321344321101202667899999999999999999999999998643730245678989988765336
Q gi|254780705|r  178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPS  257 (425)
Q Consensus       178 ~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPS  257 (425)
                                    +.+....|++|++++|+||++++.+|+++|+|+|+++|||++||||| |.++.++..+|+|||+||
T Consensus        58 --------------~a~~p~~~~yG~l~~i~GTl~~~~~A~liA~P~~i~~Aif~~e~aP~-~~~~~l~~~~ELLAgIPS  122 (317)
T TIGR02138        58 --------------EADTPVQEQYGALPLIVGTLITSLIAILIAVPVGIGIAIFLSEIAPK-RVKSVLKPVVELLAGIPS  122 (317)
T ss_pred             --------------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH-HHHHHHHHHHHHHHHHHH
T ss_conf             --------------15787302456699999999999999999999999999999985251-135699999999722359


Q ss_pred             HHHHHHHHHHHHHHHCC------------------C------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHH
Q ss_conf             99999999999986266------------------6------30046897533454366899999999851106789899
Q gi|254780705|r  258 IVYGILGSAVLINFFKM------------------P------RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAA  313 (425)
Q Consensus       258 Iv~Gl~gl~~~~~~~~~------------------~------~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa  313 (425)
                      ||||+||+.+++|++..                  .      +.+.|+|+++|++|++|+|+..+||++++||+++||||
T Consensus       123 VvYG~wG~~~l~P~l~~~~~~~~~~~~~~iP~~~~~~~~~~~G~~~L~a~~vL~IMIlPt~as~s~D~~~~VP~~~kea~  202 (317)
T TIGR02138       123 VVYGFWGLFVLVPFLKDHFQPFLGSNFGWIPLFGQLFSGPPNGYGLLTAGIVLAIMILPTIASISRDALRAVPRSYKEAS  202 (317)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             99999999999999999886786531353232122368998316899999999999999999999999973556788898


Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCCH-HHHHHHHHHHHHCCCCC
Q ss_conf             8707721277778839753325899999999998767799999854321013--66561344-55799999986036650
Q gi|254780705|r  314 LGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD--YPVGVTDI-ATAFPVQIYLWAADAER  390 (425)
Q Consensus       314 ~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~--~p~~~~~p-~~tlp~~Iy~~~~~~~~  390 (425)
                      ||||||||||+++|+||.+++||++|++||+|||+|||+++.|+.|++.+.+  .|.++++| ++|++..|.+..++...
T Consensus       203 ~ALGAT~wetI~~v~lP~a~~GIv~a~~LglGRAlGETmAV~mv~Gn~p~~~~~~~~~~f~~~~~T~~~~Ia~~~g~a~~  282 (317)
T TIGR02138       203 LALGATKWETIRKVILPAARSGIVGAVVLGLGRALGETMAVAMVIGNAPSLNRPIPLNLFSPYGTTITSLIANEFGEASG  282 (317)
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             77068604335553320002189999999999999999999999724323444412022335689999999850666688


Q ss_pred             ---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---06999999999999999999999999999741
Q gi|254780705|r  391 ---PFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       391 ---~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                         .+.+..++.++||+++.+++|.+++++-||.+
T Consensus       283 g~~~~~~aL~~~glvLfvitl~~n~~~~~i~~~~~  317 (317)
T TIGR02138       283 GNSVHVSALFALGLVLFVITLLVNILARYIVRRRK  317 (317)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             84268999999999999999999999999853069


No 5  
>PRK11275 pstC phosphate transporter permease subunit; Provisional
Probab=100.00  E-value=0  Score=410.22  Aligned_cols=235  Identities=24%  Similarity=0.386  Sum_probs=209.5

Q ss_pred             CCHHHCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2023213443211--01202667899999999999999999999999998643730245678989988765336999999
Q gi|254780705|r  186 NYGFFINGASSRP--EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGIL  263 (425)
Q Consensus       186 n~~f~t~~~s~~~--e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~  263 (425)
                      .++|+|+. .|+|  +.+|++++++||++++++|+++++|+|+++|+|++||+| +|+++.++..+|+|+|+||||||+|
T Consensus        53 g~~Fl~~~-~W~p~~~~~Gi~~~i~GTl~~s~iAllia~Plgi~~Aiyl~eya~-~~~~~~l~~~ielLagIPSVV~Gl~  130 (319)
T PRK11275         53 GLSFLWTK-EWDPPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELAP-GWLKRPLGIAIELLAAIPSIVYGMW  130 (319)
T ss_pred             CHHHHCCC-CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-HHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             83751699-989986877829999999999999999999999999999999766-8589899999999821758999999


Q ss_pred             HHHHHHHHHCC------------------------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCC
Q ss_conf             99999986266------------------------630046897533454366899999999851106789899870772
Q gi|254780705|r  264 GSAVLINFFKM------------------------PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGAS  319 (425)
Q Consensus       264 gl~~~~~~~~~------------------------~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas  319 (425)
                      |+.++++.++.                        .+.+.++|+++|++|++|++++.++|++++||+++||||++||+|
T Consensus       131 Gl~v~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~s~l~a~i~LaiMilP~i~s~s~eal~~VP~~~reaa~ALGat  210 (319)
T PRK11275        131 GLFVFAPLFATYFQEPVGNILSNIPIVGALFSGPAFGIGILAAGVILAIMIIPYIAAVMRDVFEQTPVMMKESAYGIGCT  210 (319)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCC
T ss_conf             99999999998754556544121046777614776440289999999999999999999999996889999999983997


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-CCCCHHHHHHHHHHHHHCCCCCC-HHHHHH
Q ss_conf             1277778839753325899999999998767799999854321013665-61344557999999860366500-699999
Q gi|254780705|r  320 KVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV-GVTDIATAFPVQIYLWAADAERP-FVERTF  397 (425)
Q Consensus       320 ~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~-~~~~p~~tlp~~Iy~~~~~~~~~-~~~~~~  397 (425)
                      |||++++|++|.++|||++|++||+|||+|||++++|+.|++  ..+|. ++++|++|++.+|+++..+.+.+ +.+..+
T Consensus       211 rw~ti~~VvlP~a~~GI~~gviLg~gRAlGETmaV~mv~Gn~--~~~~~~~lf~p~~Tlts~Ia~~~~ea~~g~~~~al~  288 (319)
T PRK11275        211 TWEVIWRIVLPFTKNGVIGGVMLGLGRALGETMAVTFIIGNT--YQLDSASLYMPGNSITSALANEFAEAESGLHTAALM  288 (319)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             999999999998886899999999999998899999992787--668987645655089999999631357748999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999999999999974104
Q gi|254780705|r  398 GAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       398 aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      +++++|+++++.+|.+|+++++|++||
T Consensus       289 a~glvLfvit~i~N~~a~~iv~R~~k~  315 (319)
T PRK11275        289 ELGLILFVITFIVLAASKLMIMRLAKN  315 (319)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999998752


No 6  
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism]
Probab=100.00  E-value=0  Score=403.62  Aligned_cols=295  Identities=27%  Similarity=0.403  Sum_probs=254.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEECHHHHCCCCCCCCCHHHHH
Q ss_conf             85588998888888656899999999999999999999999761444621689999987308889065765667988863
Q gi|254780705|r    2 KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILL   81 (425)
Q Consensus         2 ~~~~~~~~~LkkR~~aEkrFr~yGi~AI~ial~fL~~Ll~sI~s~G~~AF~qT~I~l~V~~d~~~id~~~~~~~d~~~l~   81 (425)
                      .+.+..+...++|+++|++||.....+..+.++.++.++.+++.+++|+|++..+.                        
T Consensus         2 ~~~~~~~~~~~~~~~~e~~~~~l~~~~a~i~v~~~~~i~~fl~~~a~~~f~~~g~~------------------------   57 (310)
T COG0573           2 EAPAKATQKIKKRKRKEKLFKALLFAAAVIVVLALLLILVFLLIEAIPAFQKFGLS------------------------   57 (310)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC------------------------
T ss_conf             85134445567665789999999999999999999999999999888999862830------------------------


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCHHHCCCEEEEEEEECCCCHHHHCCCCCCCCHH
Q ss_conf             04589999999996314566660348989987300168999999740632159747899970453023303455653000
Q gi|254780705|r   82 RADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANV  161 (425)
Q Consensus        82 ~~~~~~li~~aL~~~~p~~~~~r~~kr~l~~liS~~a~~~Lrd~v~~np~liG~t~~~~llAsddvD~~~KG~i~r~e~~  161 (425)
                                                                               ..++.+.++|.            
T Consensus        58 ---------------------------------------------------------~~f~~~~~W~p------------   68 (310)
T COG0573          58 ---------------------------------------------------------LFFLFGTEWNP------------   68 (310)
T ss_pred             ---------------------------------------------------------EEEEECCCCCC------------
T ss_conf             ---------------------------------------------------------11110675388------------


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH
Q ss_conf             05999999999999874566411220232134432110120266789999999999999999999999999864373024
Q gi|254780705|r  162 HRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF  241 (425)
Q Consensus       162 rrisd~ql~~~d~L~~~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~  241 (425)
                                                       +..++++|+++.+.||++++++|+++|+|+|+++|+|++||+++.|.
T Consensus        69 ---------------------------------~~~~~~~G~l~~i~GTli~s~iA~liAvP~gi~~Aifl~E~~~p~~~  115 (310)
T COG0573          69 ---------------------------------TNAQPQYGALPPIAGTLITSLIALLIAVPVGIGTAIFLSEYAPPRRL  115 (310)
T ss_pred             ---------------------------------CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH
T ss_conf             ---------------------------------88776556499999999999999999987888968887763582878


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCC-------HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHH
Q ss_conf             567898998876533699999999999986266-----630-------04689753345436689999999985110678
Q gi|254780705|r  242 SSFVQANINNLASVPSIVYGILGSAVLINFFKM-----PRS-------TALVGGLILALMTLPSIIIATGVALRTVPSSI  309 (425)
Q Consensus       242 ~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~-----~~~-------~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~  309 (425)
                      ++.++..+|.|||+||||||+||+.++.+++..     ...       +.++++++|++|++|++++.++|++++||+++
T Consensus       116 r~~l~~~iElLAgIPSVVYG~fgl~vl~P~l~~~~~~~~~~~~~~~g~~~L~a~ivL~IMIiP~i~Sls~da~~~VP~~l  195 (310)
T COG0573         116 RRVLKPAIELLAGIPSVVYGFFGLFVLAPFLRDVFGPPLGFNLGPFGISILTAGIVLAIMILPTIASLSRDALRAVPRSL  195 (310)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
T ss_conf             88899999998169711778999999999999985220001036455209999999999999999999999999587999


Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             98998707721277778839753325899999999998767799999854321013665613445579999998603665
Q gi|254780705|r  310 RSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAE  389 (425)
Q Consensus       310 ~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~  389 (425)
                      ||+||+|||||||++++|++|.++|||++|++||+|||+|||+++.|+.|++  .+.|.++++|.+|++..|-+..++..
T Consensus       196 reas~aLGaTkweti~kVilpaa~~GIv~a~iLglgRAiGETmAV~mv~Gn~--~~~~~slf~p~~Tits~ia~~~gea~  273 (310)
T COG0573         196 REAAYALGATKWETIRKVILPAARSGIVGAVILGLGRALGETMAVTMVIGNT--ARIPLSLFSPGTTLTSIIANEFGEAS  273 (310)
T ss_pred             HHHHHHCCCCCEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             9999873887100433653986687799999999889872899999996175--55775436886549999999863123


Q ss_pred             C-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             0-0699999999999999999999999999974104
Q gi|254780705|r  390 R-PFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       390 ~-~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      . .+....++.+++|+++.+.+|.+++++.+|.++|
T Consensus       274 ~~~~~~aL~~~glvLfvitl~~n~~a~~i~~r~~~~  309 (310)
T COG0573         274 GGLHTSALFALGLVLFVITLLLNILARYIVRRRRRK  309 (310)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             126899999999999999999999999997666336


No 7  
>pfam11812 DUF3333 Domain of unknown function (DUF3333). This family of proteins are functionally uncharacterized. This family is only found in bacteria. This presumed domain is typically between 116 to 159 amino acids in length.
Probab=100.00  E-value=0  Score=321.05  Aligned_cols=152  Identities=38%  Similarity=0.570  Sum_probs=142.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEECHHHHCCCCCCCCCHHHHHCCCHH
Q ss_conf             99888888865689999999999999999999999976144462168999998730888906576566798886304589
Q gi|254780705|r    7 NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYN   86 (425)
Q Consensus         7 ~~~~LkkR~~aEkrFr~yGi~AI~ial~fL~~Ll~sI~s~G~~AF~qT~I~l~V~~d~~~id~~~~~~~d~~~l~~~~~~   86 (425)
                      ++++|||||++|||||+||++||++|++||++||+||+++|||||+||+|++||++|++.+||++.+  +++++..+||+
T Consensus         1 v~~~LkkR~~aE~RFr~yG~~AI~~al~fL~iLl~sI~s~G~~AF~qT~I~l~V~~d~~~id~~~~~--~~~~l~~a~~~   78 (155)
T pfam11812         1 VDARLKKRYAAERRFRAYGLAAILIGLAFLVILLGSIVSNGYGAFQQTEITLEVTLDEEVLDPDGNR--DPKKLSTANYR   78 (155)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEECHHHCCCCCCC--CHHHHHHCCHH
T ss_conf             9347888999999999998999999999999999999985499887258888888289991988999--99999856599


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCHHHCCCEEEEEEEECCCCHHHHCCCCCC--CCH
Q ss_conf             99999999631456666034898998730016899999974063215974789997045302330345565--300
Q gi|254780705|r   87 LLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PAN  160 (425)
Q Consensus        87 ~li~~aL~~~~p~~~~~r~~kr~l~~liS~~a~~~Lrd~v~~np~liG~t~~~~llAsddvD~~~KG~i~r--~e~  160 (425)
                      +++++++++.||+...+++.++++++++|+++++++||++.+||+++|+|+++|++||||+|+|+||+++|  ||.
T Consensus        79 ~~v~~al~~~fp~~~~~~~~~~~l~~liS~~a~~~lr~~v~~nP~lig~t~~~~~~asddvD~~~KG~i~r~~pe~  154 (155)
T pfam11812        79 PLIKDALEELLPEVGDRSDLRSDLYSLISEGAAAQLRDFVLANPELIGTTVTFWLLASSDVDGYLKGRVDRESAAL  154 (155)
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHCHHHCCCEEEEEEEECCHHHHHHCCCCCCCCCCC
T ss_conf             9999999986765332368899999981553899999999959897398599998834145899838989889887


No 8  
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed
Probab=99.97  E-value=3.3e-29  Score=204.90  Aligned_cols=210  Identities=23%  Similarity=0.299  Sum_probs=172.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------H
Q ss_conf             026678999999999999999999999999986437302456789899887653369999999999998----------6
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN----------F  271 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~----------~  271 (425)
                      -.|.++..|+..+.+++++++++|+..|.++.++  +.+.+++++..+...-.+|++|.|+..+..|.+          +
T Consensus         6 ~~w~al~~Sl~~a~~s~~~~~~ig~~~A~~l~r~--~~~~~~~l~~l~~lp~~~P~iv~~~~~~~~~~~~g~~~~~l~~~   83 (229)
T PRK09421          6 PEWQAVLLSLKVSSVAVLFSLPFGILVAWLLARC--RFPGKSLLDSVVHLPLVLPPVVTGYLLLISMGRRGFIGQWLYEW   83 (229)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             9999999999999999999999999999999961--35308999999999999899999999999714458526789998


Q ss_pred             HCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             26663-00468975334543668999999998511067898998707721277778839753325899999999998767
Q gi|254780705|r  272 FKMPR-STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE  350 (425)
Q Consensus       272 ~~~~~-~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GE  350 (425)
                      +|... .++....++..++.+|++++..+++++++|++++|||..+||++||++++|++|+++||+++|.+++|.+++||
T Consensus        84 ~gi~~~~~~~g~~l~~~~~~~P~~~~~~~~~l~~i~~~l~EAA~~lGAs~~~~f~~V~lPl~~P~i~~~~il~F~~s~~e  163 (229)
T PRK09421         84 FGISFAFSWRGAALAAAVMAFPLMVRAIRLSLEAVDRKLEQAARTLGASPWRVFFTITLPLTLPGIIAGTVLAFARSLGE  163 (229)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             28222345999999999999999999999999859989999998859926467599899989999999999999999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       351 ta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      .+..++..+     +.|    +..+|+|++||...++++.  ...+++.+++++++.+.+..++.++.||.+||
T Consensus       164 f~~~~~l~~-----~~p----~~~~tl~~~iy~~~~~~~~--~~~aa~l~~v~i~~~~~~ll~~~~l~rR~~~r  226 (229)
T PRK09421        164 FGATITFVS-----NIP----GETQTIPSAMYTLIQTPGG--ESAAARLCIISIAIALASLLLSEWLARRSRKR  226 (229)
T ss_pred             HHHHHHHHC-----CCC----CCCEEHHHHHHHHHHCCCC--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             769998954-----899----8602179999999873896--89999999999999999999999999998765


No 9  
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry describes the permease protein, ModB, of the molybdate ABC transporter. This system has been characterised in Escherichia coli , Staphylococcus carnosus  Rhodobacter capsulatus  and Azotobacter vinlandii . Molybdate is chemically similar to sulphate, thiosulphate, and selenate. These related substrates, and sometimes molybdate itself, can be transported by the homologous sulphate receptor. Some apparent molybdenum transport operons include a permease related to this ModB, although less similar than some sulphate permease proteins and not included in this model.; GO: 0015098 molybdate ion transmembrane transporter activity, 0015689 molybdate ion transport, 0016021 integral to membrane.
Probab=99.97  E-value=7.2e-30  Score=209.07  Aligned_cols=197  Identities=26%  Similarity=0.303  Sum_probs=161.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------HCCC-C-C
Q ss_conf             99999999999999999999999864373024567898998876533699999999999986----------2666-3-0
Q gi|254780705|r  210 SLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF----------FKMP-R-S  277 (425)
Q Consensus       210 Tl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~----------~~~~-~-~  277 (425)
                      |+.++.+|+++.+|+|+.+|.+|...  +++.+.++|..+...=--|..|.|.+-+-.|.+-          ++.+ - .
T Consensus         3 Slk~A~~~Tl~~~~LGi~~A~~La~~--~f~gK~~le~L~~LPLVLPPtV~Gf~LL~~fG~~~G~~G~l~~~~~~~Gl~F   80 (212)
T TIGR02141         3 SLKVAVIATLLLLPLGIPVAWLLARS--RFRGKSLLEALVTLPLVLPPTVLGFYLLLAFGRNSGPIGKLLELLGISGLVF   80 (212)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHCCCHHH
T ss_conf             99999999999999999999999886--1760454464443266356378999999988035740778988650685246


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             04689753345436689999999985110678989987077212777788397533258999999999987677999998
Q gi|254780705|r  278 TALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV  357 (425)
Q Consensus       278 ~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~  357 (425)
                      +.-...++-.+..+|+++++.+.++++++++++|+|..||+|+|++++||+||+++|||++|++|+|+|++||+.+++|+
T Consensus        81 t~~g~vlAs~~VSfPl~v~~~~~a~~~~~~~~~~~ArtLGaS~~~~f~~v~LPL~~pG~l~G~vL~FAR~LGEFGAtlm~  160 (212)
T TIGR02141        81 TFAGAVLASVVVSFPLMVRTIRGAFEAVDPDLEEAARTLGASELRVFLKVTLPLAFPGLLAGAVLSFARALGEFGATLMF  160 (212)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             69999999999997768999999998627128999988278789989999857328999999999999750211344310


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             543210136656134455799999986036-650069999999999999999999999999997
Q gi|254780705|r  358 GMVAFVTDYPVGVTDIATAFPVQIYLWAAD-AERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       358 ~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~-~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                      |||     +|+    .++|+|..||+..++ ++   .+.|+...++++++.++.-..-.++.||
T Consensus       161 aGN-----IpG----kT~T~plaIY~~v~~lg~---~~~A~~l~l~ll~~s~~~ll~~~~~~~R  212 (212)
T TIGR02141       161 AGN-----IPG----KTRTIPLAIYDAVESLGD---YEAAHLLSLVLLALSLIVLLLVELLNKR  212 (212)
T ss_pred             CCC-----CCC----CCHHHHHHHHHHHHCCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             046-----979----630176778867705788---6789999999999999999999875059


No 10 
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only]
Probab=99.97  E-value=7.3e-32  Score=221.78  Aligned_cols=223  Identities=26%  Similarity=0.401  Sum_probs=187.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-H--HH---------
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999-9--99---------
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILG-S--AV---------  267 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~g-l--~~---------  267 (425)
                      ..-.-|-..||+-.+..|++++.|++++.|||.+-|...+ .++.++..|+.|-+.|++|.|+++ +  +-         
T Consensus       425 KfSL~Pi~FGTLKAA~yAMlfA~PlAvagAiYTAYFM~p~-mRRvVKPtIElMeAlPTViiGf~AGlwlAP~vE~hLpgv  503 (733)
T COG4590         425 KFSLVPIAFGTLKAAAYAMLFAMPLAVAGAIYTAYFMTPS-MRRVVKPTIELMEALPTVIIGFLAGLWLAPFVESHLPGV  503 (733)
T ss_pred             CEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH-HHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             3234000044689999999998589999899999953775-641100089997533188999988776667776433699


Q ss_pred             -------------------------------------HHHH-------------------HC-------------CCCCH
Q ss_conf             -------------------------------------9986-------------------26-------------66300
Q gi|254780705|r  268 -------------------------------------LINF-------------------FK-------------MPRST  278 (425)
Q Consensus       268 -------------------------------------~~~~-------------------~~-------------~~~~~  278 (425)
                                                           ++++                   ||             .-..+
T Consensus       504 l~L~lLlpl~ill~G~~wsRLp~~~~~~lPaGW~a~iLiPV~l~~galaLwlsp~Le~~~fggdlr~wL~~d~~~YDQRN  583 (733)
T COG4590         504 LALMLLLPLSILLLGFIWSRLPKAWLRRLPAGWHALILIPVLLGIGALALWLSPELENALFGGDLRVWLAQDGIGYDQRN  583 (733)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCHHHHHHHHCCCHHHHHHCCCCCCCCCC
T ss_conf             99999867899999777764508773569876234688899999879998717476666726637768652477723244


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46897533454366899999999851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       279 ~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      .|+-|+++.+-.+|+|-+..++++-+||+++-+++++||||+|||..+||+|.|.|||.+++++|+|||.|||+.++|-.
T Consensus       584 ALvVG~AMGFAvIP~IFsiAEDAiFSVP~sLs~GSLALGATPWQTL~~VVlltAspGIFSAiMiG~GRAVGETMIVLMAT  663 (733)
T COG4590         584 ALVVGFAMGFAVIPTIFSIAEDAIFSVPKSLSDGSLALGATPWQTLIYVVLLTASPGIFSAIMIGLGRAVGETMIVLMAT  663 (733)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             42334200022220345342244324785446673013687145401457504684188999975111106258999723


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCC--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             432101366561344557999999860366500--6999999999999999999999999999741049
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW  425 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~--~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~w  425 (425)
                      |+...  +-.++|+-.+||+..|.....+++-+  .+...+-+++||+.|++.+|.+|.|+|.|+++|+
T Consensus       664 GNtP~--~~~nIFeGmRtlaAniAvEmPEseVgs~HyRvLFL~ALvLltFTF~vNtLAE~vRqRLRekY  730 (733)
T COG4590         664 GNTPL--LDWNIFEGMRTLAANIAVEMPESEVGSAHYRVLFLAALVLLTFTFAVNTLAEWVRQRLREKY  730 (733)
T ss_pred             CCCCC--CCCCHHHHHHHHHHHHHHCCCHHHCCCCEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89852--12228777888765521217654406633426899999999999999899999999999886


No 11 
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism]
Probab=99.97  E-value=4.3e-30  Score=210.52  Aligned_cols=208  Identities=27%  Similarity=0.353  Sum_probs=175.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------HHH
Q ss_conf             2667899999999999999999999999998643730245678989988765336999999999999----------862
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI----------NFF  272 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~----------~~~  272 (425)
                      .|.++.=|+-++.+++++++|+|+..|.+++..  +.+.++.++..+-..--.|..|.|+.-+..|.          +++
T Consensus         5 ~~~~l~LSlkvA~ist~~~l~lgi~~a~~Lar~--~~~~k~ll~~lv~LPLVLPPtV~G~~LLi~fgr~g~iG~~l~~~~   82 (225)
T COG4149           5 ELTALLLSLKVALISTLLLLPLGIALAYLLARR--RFRGKSLLESLVLLPLVLPPVVLGFLLLVLFGRNGFIGQFLEDWF   82 (225)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHC
T ss_conf             888999999999999999999999999999725--577630999999732368953899999999747770678999975


Q ss_pred             CCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6663-004689753345436689999999985110678989987077212777788397533258999999999987677
Q gi|254780705|r  273 KMPR-STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET  351 (425)
Q Consensus       273 ~~~~-~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt  351 (425)
                      |.+- .++-.+.++-.++.+|++++..+.++++||++++|||+.|||||||++++|+||.++|||++|++++|+|++||.
T Consensus        83 g~~~~Fs~~gavlAs~vvslPlmv~~~~~a~~~id~~le~aA~tlGas~~~vf~~i~LPLalpGIlag~iLsFAralGEF  162 (225)
T COG4149          83 GLSLAFSWQGAVLASVVVSLPLMVRPLRLAFEAIDRELEEAARTLGASRWEVFFRITLPLALPGILAGVILSFARALGEF  162 (225)
T ss_pred             CCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHEEEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             97079844899999999988989999999998568459999998188802131001402210679999999999986205


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       352 a~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      .+++|.+|+     +|+    -+.|+|.+||...+.++   .+.++...++++++.+..-....++++|.++|
T Consensus       163 GAtlm~aGN-----IpG----~T~Tlp~aIY~~~q~g~---~~~A~~l~li~v~is~~~L~~~~~l~~~~~~~  223 (225)
T COG4149         163 GATLMFAGN-----IPG----ETQTLPLAIYTAVQAGN---YALAHRLVLILVVISLLVLFVSEWLARRSSKR  223 (225)
T ss_pred             CEEEEEECC-----CCC----CCEEEHHHHHHHHHCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             707987547-----888----53110699999998187---88999999999999999999999998764201


No 12 
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional
Probab=99.97  E-value=6.5e-28  Score=196.64  Aligned_cols=219  Identities=19%  Similarity=0.230  Sum_probs=178.4

Q ss_pred             CCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             12202321344321101202667899999999999999999999999998643730245678989988765336999999
Q gi|254780705|r  184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGIL  263 (425)
Q Consensus       184 ~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~  263 (425)
                      +..+.+|++        -..+.++..|+..+.++++++..+|+..|.+++.+.  -+.+++++..+...-.+|++|.|+-
T Consensus        45 ~ny~~~f~d--------p~~~~al~nTl~ia~~~t~i~~vlG~~~A~~l~r~~--f~gr~~l~~l~~lP~~iP~~V~g~~  114 (277)
T PRK10971         45 AQYWEVITN--------PQVVAAYKVTLLSAFVASIFNGVFGLLMAWILTRYR--FPGRTLLDALMDLPFALPTAVAGLT  114 (277)
T ss_pred             HHHHHHHCC--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999879--------889999999999999999999999999999999158--8738999999999999899999999


Q ss_pred             HHHHHH---------HHHCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             999999---------8626663-004689753345436689999999985110678989987077212777788397533
Q gi|254780705|r  264 GSAVLI---------NFFKMPR-STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAM  333 (425)
Q Consensus       264 gl~~~~---------~~~~~~~-~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~  333 (425)
                      ....|.         ..+|... .+...-.+++....+|++++...++++++|++++|||..+||++||++++|++|..+
T Consensus       115 ~~~lf~~~G~~~~~l~~~gi~~~~~~~giii~~~~~~~Pf~~~~~~a~l~~id~~leEAA~~lGAs~~~~f~~V~lPll~  194 (277)
T PRK10971        115 LASLFSVNGWYGEWLAKFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEEAAETLGATRWQSFRKVVLPELS  194 (277)
T ss_pred             HHHHCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             99984665426678997596410129999999999998999998789998489999999986499865730410398579


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25899999999998767799999854321013665613445579999998603665006999999999999999999999
Q gi|254780705|r  334 PAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA  413 (425)
Q Consensus       334 pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~  413 (425)
                      |||++|.++++.+++||.+..+++||.         +...++++|+.||...++.+   ...++|.+.+++++.+++..+
T Consensus       195 P~i~~g~ll~F~~s~~~f~~~~~l~G~---------~~~~t~tl~~~iy~~~~~~d---~~~a~Als~ill~~sli~~~~  262 (277)
T PRK10971        195 PALLAGVALSFTRSLGEFGAVIFIAGN---------IAWKTEVTSLMIFVRLQEFD---YPAASAIASVILAASLLLLFS  262 (277)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCC---------CCCCCCHHHHHHHHHHHCCC---HHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999876067500179---------98865149999999998768---899999999999999999999


Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999974104
Q gi|254780705|r  414 MLWLRNRFKKR  424 (425)
Q Consensus       414 a~~lr~r~~~~  424 (425)
                      ..++++|++||
T Consensus       263 ~~~l~~R~~Rr  273 (277)
T PRK10971        263 INTLQSRFGRR  273 (277)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999875


No 13 
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents a clade of ABC porter genes with relatively weak homology compared to its neighbour clades, the molybdate (IPR006229 from INTERPRO) and sulphate (IPR005667 from INTERPRO) porters. Neighbour-Joining, PAM-distance phylogenetic trees support the separation of these clades in this way. Included in this group are the NifC genes of Clostridium pasteurianum  and Pasteurella multocida, which are involved in the biosynthesis and/or control of nitrogenase. It would be reasonable to presume that NifC acts as a molybdate porter since the most common form of nitrogenase is a molybdoenzyme. Several other sequences falling within this group are annotated as molybdate porters and one, from Halobacterium, is annotated as a sulphate porter. There is presently no experimental evidence to support annotations with this degree of specificity.; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane.
Probab=99.96  E-value=1.1e-27  Score=195.28  Aligned_cols=194  Identities=23%  Similarity=0.286  Sum_probs=158.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC------
Q ss_conf             26678999999999999999999999999986437302456789899887653369999999999998626663------
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPR------  276 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~------  276 (425)
                      ...|+.-|+.++.+++++++-+|+..|..|+.+. +.+.++.++..+++.-..|.+|-|+--|..|...-.+..      
T Consensus        19 ~~~al~lSl~Ts~~sl~l~~~~g~P~A~~lar~~-n~pl~~~l~~ll~LP~VlPPlV~G~aLLl~FG~~g~lG~~l~~aG   97 (226)
T TIGR01581        19 LIKALRLSLLTSLASLLLAVVLGIPTAYVLARVR-NFPLKKLLDTLLDLPLVLPPLVAGIALLLLFGRLGLLGPYLEAAG   97 (226)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHCC
T ss_conf             9999999999999999999999988999998875-068547789998665424665888999999720212689998644


Q ss_pred             ----CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ----0046897533454366899999999851106789899870772127777883975332589999999999876779
Q gi|254780705|r  277 ----STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA  352 (425)
Q Consensus       277 ----~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta  352 (425)
                          .|.++=.++=.+...|+.+|+.|+++++||++|||+|+.+|+++.||++||.+|+++|++++|.+|+|+|++||++
T Consensus        98 i~~~Fs~~gvvlAQ~FVa~p~~vr~~r~~f~~v~~~ye~va~~lG~g~~~t~~~v~lPl~~~~ll~G~vLafaRalGEFG  177 (226)
T TIGR01581        98 IQVIFSTLGVVLAQTFVASPYLVRVARSTFESVDPDYEDVARSLGAGPLETFRKVTLPLARPGLLAGLVLAFARALGEFG  177 (226)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             16788889999999999999999999976730383489999880787226788875775336888879999999756567


Q ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999985432101366561344557999999860366500699999999999999999
Q gi|254780705|r  353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV  409 (425)
Q Consensus       353 ~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~  409 (425)
                      ++||.+|..         -.+++|+|++||....+.+   .+.+-+.++.|+++..+
T Consensus       178 ATL~~AG~~---------~g~TrTlPl~iY~~~~~d~---~~~aV~~a~~Ll~ia~~  222 (226)
T TIGR01581       178 ATLMFAGSL---------QGKTRTLPLAIYLNIESDD---IEAAVALAVLLLVIAFL  222 (226)
T ss_pred             HHHHHHCCC---------CCCCEEHHHHHHHHHHCCC---HHHHHHHHHHHHHHHHH
T ss_conf             899984367---------7753012788864574177---32799999999999999


No 14 
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones]
Probab=99.96  E-value=3.7e-28  Score=198.18  Aligned_cols=210  Identities=23%  Similarity=0.294  Sum_probs=175.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--H------
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986--2------
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF--F------  272 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~--~------  272 (425)
                      -+.+.++.-|+.+.+++.+++..+|+..|.++.+|.  -+-+++++..+|+..++|..|-|+.-+..+.+.  .      
T Consensus        53 ~~~~~a~~~S~~~a~~atl~~~vfg~~~a~vL~R~~--fpgk~lvdaivDlP~alP~~VaGiaLl~l~~~~g~~g~~~~~  130 (274)
T COG0555          53 PRVLAALKLTLLTAFAATLLNLVFGLPLAWVLVRYD--FPGKRLVDALVDLPFALPTAVAGIALLLLFGPNGLLGSLLAP  130 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCHHHHCC
T ss_conf             989999999999999999999999989989854035--884899999962761375489999999996678740355412


Q ss_pred             -CCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -666-300468975334543668999999998511067898998707721277778839753325899999999998767
Q gi|254780705|r  273 -KMP-RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE  350 (425)
Q Consensus       273 -~~~-~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GE  350 (425)
                       |.. ..+++.-.+++.++.+|+++++.+.++++++++++|+|.+||+++|||+++|++|.++|++++|.+++++|++||
T Consensus       131 ~gi~~~~t~~GVivA~~Fvs~Pf~vr~v~~~~~~id~~~EeaA~sLGas~~~tf~~V~lP~l~pall~G~~LsfaR~igE  210 (274)
T COG0555         131 LGIKFAFTPLGVIVAMFFVSLPFVVRTVQPVLEEIDREYEEAARSLGASPLQTFRRVILPLLLPALLAGFILSFARSIGE  210 (274)
T ss_pred             CCCEEECCHHHHHHHHHHHCCHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCEEEEEEEHHHCHHHHHHHHHHHHHHHHCC
T ss_conf             47567646789999999970336899889999855688999998648985511142446413389999999999998245


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       351 ta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      .+.+++++++.     |.    ..+++|+.||...++.+   .+.+.+.+.+|+++.+.+-...+.+..|..|+
T Consensus       211 fGavl~iAgn~-----p~----~t~~~pl~Iy~~~~~~d---~~~A~ais~vll~iS~~~l~~~r~~~~~~~r~  272 (274)
T COG0555         211 FGAVLIIAGNT-----PY----KTETLPLLIYTRLESYD---LEAAAAISVVLLLISFILLLVIRLLQSRARRR  272 (274)
T ss_pred             CCEEEEEECCC-----CC----CCCHHHHHHHHHHHHCC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             46499981477-----78----77303899999998379---35799999999999999999999998764205


No 15 
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry represents CysT, one of two homologous, tandem permeases in the sulphate ABC transporter system; the other is CysW (IPR011866 from INTERPRO). The sulphate transporter has been described in Escherichia coli as transporting sulphate, thiosulphate, selenate, and selenite. Sulphate transporters may also transport molybdate ion if a specific molybdate transporter is not present.; GO: 0015116 sulfate transmembrane transporter activity, 0008272 sulfate transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=99.96  E-value=1.9e-28  Score=200.10  Aligned_cols=209  Identities=23%  Similarity=0.299  Sum_probs=176.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHH
Q ss_conf             02667899999999999999999999999998643730245678989988765336999999999999---------862
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI---------NFF  272 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~---------~~~  272 (425)
                      -+..|..=|+-++++|.++..-+|+..|+=|..|.-.+  +|+++..+|+.-+.|+=|-|+=--++|-         ..+
T Consensus        47 ~vlaay~~sf~~Al~Aa~~N~vFG~l~AWVLVRY~FPG--Kri~DAlVDLPFALPTAVAGIaL~TlY~~NGWiG~~l~~l  124 (265)
T TIGR02139        47 RVLAAYKLSFGTALIAALINAVFGTLLAWVLVRYRFPG--KRIVDALVDLPFALPTAVAGIALATLYAPNGWIGSFLEPL  124 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH--HHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHC
T ss_conf             99999999999999999999999999988986124750--5777666233542034799999999962889401258554


Q ss_pred             CCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             666-3004689753345436689999999985110678989987077212777788397533258999999999987677
Q gi|254780705|r  273 KMP-RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET  351 (425)
Q Consensus       273 ~~~-~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt  351 (425)
                      |.. -++++.=.++|.+..||+|+|+.+-.|+..++++||||.+||||||||+|||++|.-.|.++||.-|+|+|++||.
T Consensus       125 GIKvAfTplGi~~Al~FvsLPFVVRTVQPVL~e~~~E~EEAA~~LGAS~w~tF~~vilP~L~PALLTG~ALaFARa~GEY  204 (265)
T TIGR02139       125 GIKVAFTPLGIVVALVFVSLPFVVRTVQPVLEEIEKELEEAAASLGASRWQTFWKVILPALLPALLTGFALAFARAVGEY  204 (265)
T ss_pred             CCEEEEECCCEEEEEEEECCCCEEEEECCCCCCCCHHHHHHHHHHCCCCHHEEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             98788720101434233258825731143000588648999765168820002223314440069997899887543233


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       352 a~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      +.++||+||     +|-.    ++..|+.|...-++-|   ++-|.+-+.|+|++-++|-+.-..++.+.+||
T Consensus       205 GSViFIAGN-----~P~~----tEI~PLLI~~kLEqYD---Y~gATaIA~vmL~~SF~~Ll~IN~lQ~~~~r~  265 (265)
T TIGR02139       205 GSVIFIAGN-----LPMK----TEIAPLLIFIKLEQYD---YAGATAIAVVMLLISFVLLLFINLLQWRALRY  265 (265)
T ss_pred             HCEEEECCC-----CCCH----HHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             300022268-----8806----7889999977754412---37899999999999999999999999975069


No 16 
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional
Probab=99.96  E-value=3.3e-26  Score=185.80  Aligned_cols=208  Identities=21%  Similarity=0.249  Sum_probs=165.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HCCCC-
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986---26663-
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF---FKMPR-  276 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~---~~~~~-  276 (425)
                      ...+.++..|+..+..+.+++..+|+.+|..+..|. +-+.++.++..+...-.+|++|.|+-.+..|...   ++++. 
T Consensus        59 ~~~~~a~~~Sl~ia~~~t~i~~~lG~~~A~~l~r~~-~~~g~~~~~~l~~~Pl~vP~iv~gl~l~~~f~~~g~~~g~~~~  137 (281)
T PRK10592         59 DAMMSAVGLSLTIAACAATMAAILGTIAAVVMVRFG-RFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALGHAIGWPAD  137 (281)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHH
T ss_conf             789999999999999999999999999999999805-5330699999999899867899999999999984632253200


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00468975334543668999999998511067898998707721277778839753325899999999998767799999
Q gi|254780705|r  277 STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF  356 (425)
Q Consensus       277 ~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~  356 (425)
                      .+...-.++...+.+|++++....+++++|++++|||..|||++||++++|++|+.+||+++|.+++|..++||....++
T Consensus       138 ~~~~~i~i~~~~~~~P~~~~~i~a~l~~id~~leEAA~~LGAs~~~~f~~V~LPli~Pgiiag~il~F~~s~~ef~~~~~  217 (281)
T PRK10592        138 RGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIISGWLLAFTLSLDDLVIASF  217 (281)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             23789999999999999999999999858927999998819998888343541711598999999999999987778862


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             85432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       357 ~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      +++..            .+|||+.||.....+....   ..|.+.++++++.++..+|.++.+|-|||
T Consensus       218 l~g~~------------~~TLpv~iy~~~~~~~~p~---~~A~~~l~~~v~~~~~~ia~~l~~R~~k~  270 (281)
T PRK10592        218 VSGPG------------ATTLPMLVFSSVRMGVNPE---INALATLILGVVGIVGFIAWYLMARAEKQ  270 (281)
T ss_pred             EECCC------------CCCHHHHHHHHHHCCCCHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             10899------------8456999999987179879---99999999999999999999999888988


No 17 
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional
Probab=99.96  E-value=1.5e-26  Score=187.90  Aligned_cols=209  Identities=21%  Similarity=0.166  Sum_probs=159.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HH
Q ss_conf             026678999999999999999999999999986437302456789899887653369999999999998---------62
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN---------FF  272 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~---------~~  272 (425)
                      ..+.++..|+..+++++.+++.+|+..|..++.+.  -+.+++++..+...-.+|++|.|+..+.++.+         .+
T Consensus        61 ~~~~al~~Tl~~a~~~~~i~lvlG~~lA~~l~r~~--f~gr~~~~~l~~lP~~ip~vV~g~~~~~l~~~~G~l~~~L~~~  138 (291)
T PRK11602         61 DMLHAIWLTVLIALIAVPVNLVFGILLAWLVTRFN--FPGRQLLLTLLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLDEH  138 (291)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHC
T ss_conf             89999999999999999999999999999999278--8608999999999886379999999999826443789999855


Q ss_pred             CCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6663-004689753345436689999999985110678989987077212777788397533258999999999987677
Q gi|254780705|r  273 KMPR-STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET  351 (425)
Q Consensus       273 ~~~~-~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt  351 (425)
                      +... .+...-.++.....+|+++....++++++|++++|||..+|||+||++++|++|+++|++++|.+|++.+++||.
T Consensus       139 ~~~~~~s~~giil~~v~~~~Pf~~~~~~a~l~~i~~~l~EAA~~lGAs~wq~F~~VtLPll~P~i~~g~iL~f~~al~~F  218 (291)
T PRK11602        139 NLQLMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEF  218 (291)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             83286778999999999999999999999998689589999987699987898986498309999999999999998756


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       352 a~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      +.+.+++|+         +...+.|+|++||....+.+..   .+.+++.+++++.+++-.+..++++|++||
T Consensus       219 g~v~~l~G~---------~~g~T~t~~~~i~~~~~~~~~~---~a~~~a~~l~~~~~i~l~l~~~lq~R~~r~  279 (291)
T PRK11602        219 GAVSVVSGS---------IRGETLSLPLQIELLEQDYNTV---GSFTAAALLTLMAIITLFLKSMLQWRLENQ  279 (291)
T ss_pred             CCHHEEECC---------CCCCCCHHHHHHHHHHHHCCHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             804311579---------9885010699999999812644---699999999999999999999999999707


No 18 
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV. This membrane component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=99.96  E-value=5e-26  Score=184.63  Aligned_cols=204  Identities=20%  Similarity=0.209  Sum_probs=167.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHCCCCCHHHH
Q ss_conf             667899999999999999999999999998643730-2456789899887653369999999999998-62666300468
Q gi|254780705|r  204 GVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FFSSFVQANINNLASVPSIVYGILGSAVLIN-FFKMPRSTALV  281 (425)
Q Consensus       204 ~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~-~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~-~~~~~~~~~l~  281 (425)
                      |.++..|+.+.+++.+++..+|+.+|+.+..|.+++ +.+++++......-.+|.+|.|+--+..|.. .+++.+ +...
T Consensus        67 ~~a~~~Sl~va~~~a~~a~~lg~~~a~~l~~~~~~~~~~~~~l~~l~~lPl~vP~iv~gl~ll~~f~~~~~~l~~-t~~~  145 (272)
T TIGR03255        67 FDALAASLEIGFCAAAFALACGLGAALALALEGRKRQGVGALLDALFMLPNAIPSVSLGLAILIAFHAGPLDLNG-SLAI  145 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC-HHHH
T ss_conf             899999999999999999999999999999862155548999999999899899999999999999956844255-7999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97533454366899999999851106789899870772127777883975332589999999999876779999985432
Q gi|254780705|r  282 GGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA  361 (425)
Q Consensus       282 g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~  361 (425)
                      -.++..+..+|++++...+++++++++++|||..|||++||++++|++|..+||+++|.+++|..++||....+++++..
T Consensus       146 liiah~~~~lP~~~~~v~a~l~~id~~leeAA~~LGAs~~~~f~~V~LPli~pgilag~~l~F~~S~~ef~~s~~l~~~~  225 (272)
T TIGR03255       146 VLFAHFALILAFCFRCAAAALAPELADIEEAAASLGAPPAMRLRHVLLPLLMPAIMAALALGFALSLGELGATLMIYPPG  225 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCC
T ss_conf             99999999999999999999973793099999886998999999998796799999999999999997761532341899


Q ss_pred             HCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             10136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       362 ~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
                                  .+|+|+.||...++++.+   .+.|.+.+++++.+++-++...+.||..|
T Consensus       226 ------------~~TLpv~i~~~~~~g~~~---~aaAls~ili~~s~v~li~~~~~~~R~g~  272 (272)
T TIGR03255       226 ------------FATLPIAIFGATDRGNIA---DAAALSILLLAASLLALIAIAAIAKRLGQ  272 (272)
T ss_pred             ------------CEEHHHHHHHHHHCCCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             ------------724799999998767848---89999999999999999999999976389


No 19 
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]
Probab=99.95  E-value=9.9e-26  Score=182.71  Aligned_cols=202  Identities=25%  Similarity=0.273  Sum_probs=164.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             02667899999999999999999999999998643730245678989988765336999999999999862666300468
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALV  281 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~  281 (425)
                      ..+.|+..|+.+.+++.+++..+|+.+|+.+..|  +-+.+..++..+...-.+|.||.|+--+.+|. ..|.++ +...
T Consensus        62 ~~~~a~~~Sl~IA~~s~~~s~~lg~~aA~al~r~--~~~g~~~~~~l~~~PlvvP~Iv~gi~ll~~f~-~~~~~~-~~~~  137 (267)
T COG1177          62 RLLSALWNSLLIALLSALLATLLGTLAALALARY--RFRGKNLLEGLILLPLVVPDIVTGIALLLLFA-ALGLPG-GFWT  137 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHH-HCCCCC-CHHH
T ss_conf             8999999999999999999999999999999970--40268999999974241509999999999999-868875-2999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97533454366899999999851106789899870772127777883975332589999999999876779999985432
Q gi|254780705|r  282 GGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA  361 (425)
Q Consensus       282 g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~  361 (425)
                      -.+++....+|++++....++++.|++++|||..|||++||++++|+||+.+|||++|.+++|...++|.....|+++..
T Consensus       138 ivlaH~~~~lP~v~~~v~a~l~~~d~~L~eAA~dLGAs~~~~f~~V~LP~i~PgIlsg~llaF~~S~Defvit~f~~gp~  217 (267)
T COG1177         138 IVLAHIVFALPFVVVVVSARLQGFDRSLEEAARDLGASPWQTFRRVTLPLILPGILSGALLAFTLSFDEFVITFFLAGPG  217 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCC
T ss_conf             99999999866899999999973896799999876998888989976975279999999999999986778631132899


Q ss_pred             HCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1013665613445579999998603665006999999999999999999999999999741
Q gi|254780705|r  362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       362 ~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                                  .+|||++||.....+.....   .|.+.+++.+.+.+-..+..+++|-+
T Consensus       218 ------------~~TLP~~i~s~~r~~~~P~i---~Alstll~~~~~ll~~~~~~~~~~~~  263 (267)
T COG1177         218 ------------FTTLPLQIYSMIRRGITPEI---NALSTLLLLLSLLLILLASRLLRRRA  263 (267)
T ss_pred             ------------CCCHHHHHHHHHHCCCCHHH---HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             ------------87218999998655898199---99999999999999999999864333


No 20 
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667   Bacterial binding protein-dependent transport systems ,  are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system. The integral inner-membrane proteins translocate the substrate across the membrane. It has been shown ,  that most of these proteins contain a conserved region located about 80 to 100 residues from their C-terminal extremity. This region seems  to be located in a cytoplasmic loop between two transmembrane domains. Apart from the conserved region, the sequence of these proteins is quite divergent, and they have a variable number of transmembrane helices,   This entry describes a subfamily of both CysT and CysW, paralogous and generally tandemly encoded permease proteins of the sulphate ABC transporter; GO: 0015563 uptake transmembrane transporter activity, 0006810 transport, 0016020 membrane.
Probab=99.95  E-value=1.5e-28  Score=200.77  Aligned_cols=204  Identities=24%  Similarity=0.251  Sum_probs=163.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHC
Q ss_conf             266789999999999999999999999999864373024567898998876533699999999---------99998626
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS---------AVLINFFK  273 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl---------~~~~~~~~  273 (425)
                      .-.|+.=|+.++++|..+..-.|+.+|.=|+.|--+|  +++.+..+|+.-++|++|-||.-.         +-+..-||
T Consensus        67 ~~~A~~lT~~~aliav~lN~vFG~~~AWvLtR~~FPG--r~lLda~~DLPFAlspvVAGL~l~llYg~~Gw~G~~~~~fg  144 (280)
T TIGR00969        67 AVSAYNLTLLMALIAVPLNGVFGLLIAWVLTRYQFPG--RKLLDALIDLPFALSPVVAGLTLALLYGSNGWLGSWLASFG  144 (280)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--HHHHHHHHHCCCCCCHHHHHHEEEEEECCCCCCCCHHHHCC
T ss_conf             9999999999999999999999999999997126982--58999986213342506753300045357785113230178


Q ss_pred             CCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             663-0046897533454366899999999851106789899870772127777883975332589999999999876779
Q gi|254780705|r  274 MPR-STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA  352 (425)
Q Consensus       274 ~~~-~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta  352 (425)
                      ..- .+.+.=.++..+.++|+++|+.+-.|++..++.+|||.+|||++|||+|||+||..+||+++|+.|+++||+||.+
T Consensus       145 iqI~F~~~G~~lAmiFvs~PFVvRev~PVL~Elg~e~EEAA~tLGA~~WQtFwRV~LP~i~w~llyGv~Lt~aRAlGEFG  224 (280)
T TIGR00969       145 IQIIFTWPGVALAMIFVSLPFVVREVQPVLEELGTEAEEAAATLGASGWQTFWRVTLPSIRWALLYGVVLTFARALGEFG  224 (280)
T ss_pred             CEEEEECCCEEEEEEEECCCCEEEEECCCHHHCCCCHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCE
T ss_conf             68998412146665342168045431001341385578999862899830267876688726788867876556543011


Q ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998543210136656134455799999986036650069999999999999999999999999997
Q gi|254780705|r  353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       353 ~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                      .+.+++++         +...+.++|++||.--   ++.++..+++++.||+.+-++.-++-..+..|
T Consensus       225 aV~~vSgn---------i~gkt~~lplli~~~l---~~Yd~~gA~~ia~vL~l~slv~L~~~~~Lq~R  280 (280)
T TIGR00969       225 AVVVVSGN---------IPGKTLTLPLLIFERL---EQYDYPGAYVIAAVLLLVSLVTLFLINLLQAR  280 (280)
T ss_pred             EEEEEECC---------CCCCCCCHHHHHHHHH---HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             07899446---------8863120156644476---60360789999999999999999999985039


No 21 
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed
Probab=99.95  E-value=6.1e-25  Score=177.70  Aligned_cols=202  Identities=21%  Similarity=0.210  Sum_probs=166.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986266630046
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTAL  280 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l  280 (425)
                      .+.+.++.+|+..+..+.+++..+|+.+|..+..+.  .|.++.++..+...-.+|.++.|+--+..+ ...|... +..
T Consensus        54 ~~~~~~~~nSl~ia~~~~~~~~~lg~~~A~~l~r~~--~~~~~~~~~l~~~p~~~P~~v~~i~l~~~~-~~~g~~~-~~~  129 (257)
T PRK09500         54 DSLLQAAQHSLTMAVFSATFATLIGSLTAVALYRYR--FRGKKFVSGMLFVVMMSPDIVMAISLLVLF-MLLGIQL-GFW  129 (257)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHCCHHH-HHH
T ss_conf             379999999999999999999999999999997526--774569999999999979999999999999-9735132-099


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89753345436689999999985110678989987077212777788397533258999999999987677999998543
Q gi|254780705|r  281 VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV  360 (425)
Q Consensus       281 ~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~  360 (425)
                      .-.++...+.+|+++.....+++++|++++|||..+||++||++++|++|+++||+++|.+++|..++||....+++++.
T Consensus       130 ~lil~~~~~~lP~~~~~i~~~l~~i~~~l~EAA~~lGAs~~~~f~~VilPl~~P~i~~~~il~F~~s~~ef~~~~~l~g~  209 (257)
T PRK09500        130 SLLFAHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEVTILRKIILPLAMPAVAAGWLLSFTLSMDDVVVSSFVTGP  209 (257)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99988888515027999999997179699999987299987963631298479999999999999999999999975289


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2101366561344557999999860366500699999999999999999999999999974
Q gi|254780705|r  361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF  421 (425)
Q Consensus       361 ~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~  421 (425)
                      .            .+|+|+.||.....++..   .++|.+.+++++.+++..++.++.||-
T Consensus       210 ~------------~~tlp~~i~~~~~~~~~~---~~~Ala~il~~i~~~~~~l~~~l~r~~  255 (257)
T PRK09500        210 S------------YEILPLKIYSMVKVGVSP---EVNALATILLVLSLVLVILSQLLARDK  255 (257)
T ss_pred             C------------CEEHHHHHHHHHHCCCCH---HHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9------------602899999998737875---999999999999999999999986654


No 22 
>PRK10782 DL-methionine transporter permease subunit; Provisional
Probab=99.94  E-value=1.9e-24  Score=174.49  Aligned_cols=204  Identities=18%  Similarity=0.170  Sum_probs=160.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             266789999999999999999999999999864-----373024567898998876533699999999999986266630
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF-----SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS  277 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~-----a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~  277 (425)
                      ++.++..|+++++++.++++.+|+..|+++.-.     .++.++..+++..+|.+.++|++++.+|.+.++-...|. ..
T Consensus         9 ll~g~~~Tl~mt~~s~~~~~iiglplGi~l~~~~~~~~~~~~~l~~~~~~~i~~~R~iP~lv~l~~~~~~~~~~~g~-~~   87 (217)
T PRK10782          9 LVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTLSAVVNIFRSIPFIILLVWMIPFTRVIVGT-SI   87 (217)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CC
T ss_conf             99999999999999999999999999999997320224434689999999999995068999999999999998446-62


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             04689753345436689999999985110678989987077212777788397533258999999999987677999998
Q gi|254780705|r  278 TALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV  357 (425)
Q Consensus       278 ~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~  357 (425)
                      ++.+|.++++++..|++.+.+++++++||++.+|||.++|+|+||+++|+++|.|+|+++.+....+--.++.|+-+-++
T Consensus        88 g~~aaiiaL~i~~~~~iar~~~~~i~~V~~g~~EAa~alG~s~~q~i~~viLPqAlp~ii~~~~~~~i~~i~~tsl~g~I  167 (217)
T PRK10782         88 GLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAV  167 (217)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             16899999999998999999999998399879999998398988994851079219999999999999999999999998


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             5432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       358 ~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      |+..        +.    .+..   +.....++  .+..+...+++++++..+..+...++||++||
T Consensus       168 G~gg--------LG----~~a~---~~~~~~~~--~~~~~~v~~l~~ilv~~i~~~~~~l~k~~~~r  217 (217)
T PRK10782        168 GAGG--------LG----QIGY---QYGYIGYN--ATVMNTVLVLLVILVYLIQFAGDRIVRAVTHK  217 (217)
T ss_pred             CCCH--------HH----HHHH---HHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             1047--------89----9999---99998515--10999999999999999999999999986379


No 23 
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein. This ABC transporter permease (membrane-spanning) component is found in a region of the salmonella typhimurium LT2 genome responsible for the catabolism of 2-aminoethylphosphonate via the phnWX pathway (GenProp0238).
Probab=99.93  E-value=4.6e-24  Score=172.10  Aligned_cols=209  Identities=18%  Similarity=0.124  Sum_probs=167.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998---------
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN---------  270 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~---------  270 (425)
                      .-..+.++..|+..++.++++++.+|+..|..++...  .+-++.++..+.....+|++|.++-...+|-+         
T Consensus        87 ~~~~~~al~nTl~~a~~~t~~~lvlG~~lA~~L~r~~--f~g~~~l~~ll~lp~~lP~~v~a~a~~~l~~~~G~ln~~L~  164 (312)
T TIGR03226        87 SHDFRDALGNTLQIAFAAAAGALLLGSALAAILFFIP--FPGAELIGRFLDLFIAFPSFLIAFAFIFIYGSAGLLNGALM  164 (312)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             9679999999999999999999999999999999623--76289999999999998899999999999835770779999


Q ss_pred             -HHCCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -626663------0046897533454366899999999851106789899870772127777883975332589999999
Q gi|254780705|r  271 -FFKMPR------STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS  343 (425)
Q Consensus       271 -~~~~~~------~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~  343 (425)
                       .+++..      .+...-.++.....+|++++...++++++|++++|||..+||++||++++|++|+.+||+++|.+|+
T Consensus       165 ~l~gl~~~p~~~l~s~~gVvla~i~~~~Pf~~l~~~a~l~~id~~l~EAA~~lGAs~~~~Fr~VtLPll~P~i~ag~lL~  244 (312)
T TIGR03226       165 RAFAFDAPPLDFLFGAGGVILAEITFFTPFVMRPLLAAFAQIDKRLLEAASILGAHGLMLAGQVIFPAALPAIAAGGILC  244 (312)
T ss_pred             HHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             96286677457774099999999999899999999999996897899999884999888678742784689999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99987677999998543210136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       344 ~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
                      |.+++||.....++|+..            ..|+|+.||+.....  .....+++.+++|+++++.+-.+-++++||..+
T Consensus       245 Fi~~~~~F~~~~~lgg~~------------~~tl~~~Iy~~~~~~--~d~~~AaAlavillv~~l~l~~l~r~~~rR~~~  310 (312)
T TIGR03226       245 FLLTLNEFGILLFIGAAG------------LITLPMAIYSKAILD--IDLPAAAAGALIMIALSLALFALYRLAARRAGE  310 (312)
T ss_pred             HHHHHHHHCCEEEEECCC------------CEEHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999997754113440899------------701799999999875--798999999999999999999999999876348


Q ss_pred             C
Q ss_conf             4
Q gi|254780705|r  424 R  424 (425)
Q Consensus       424 ~  424 (425)
                      .
T Consensus       311 ~  311 (312)
T TIGR03226       311 G  311 (312)
T ss_pred             C
T ss_conf             9


No 24 
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein.
Probab=99.93  E-value=1.3e-23  Score=169.16  Aligned_cols=209  Identities=16%  Similarity=0.139  Sum_probs=168.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---H-CCC
Q ss_conf             120266789999999999999999999999999864373024567898998876533699999999999986---2-666
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF---F-KMP  275 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~---~-~~~  275 (425)
                      ..+.+.++.+|+..+.++.+++..+|+..|.....+..++++++.++...-..-++|++|.|+--+..|...   + ++.
T Consensus       327 ~~~~~~a~~nSl~la~~aa~i~~~l~~~~ay~i~r~r~~~~~~~~l~~l~~lp~aiPgiVlalg~i~~f~~~~~~l~~Ly  406 (546)
T TIGR03262       327 DGGGWEAYKNSLRLAATTALIGTILVFGGAYLIEKTRGFGLLRGVLRFLAILPMAVPGLVLGLGYIFFFNAPTNPLNGLY  406 (546)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             35689999999999999999999999999999998214126799999999853516899999999999852220367888


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             30046897533454366899999999851106789899870772127777883975332589999999999876779999
Q gi|254780705|r  276 RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL  355 (425)
Q Consensus       276 ~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll  355 (425)
                      + +...=.++..+..+|+..+..+.+++++|++++|||..+|+++|+++++|++|+.+||+++|.++.|..+++|-...+
T Consensus       407 g-T~~iLilay~vr~lp~~~~~i~a~l~qI~~~leeAA~~lGas~~~~~~rI~lPLl~p~ilag~~lvFi~~m~El~~tl  485 (546)
T TIGR03262       407 G-TMALLVLCTVVHFYTVSHLTAVTALKQIDSEFEAVSASLKVPFYKTFLRVTLPVCLPAILDIARYLFVNSMTTVSAVV  485 (546)
T ss_pred             H-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHEHHHHHHHHHHHHHHHHHHHHHHHHCEEE
T ss_conf             8-999999999999999989999999874895099999875979666725320780289999999999999998768787


Q ss_pred             HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  356 FVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       356 ~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      +...       |+     .+|++++||.+.++++   .+.+++.+++++++..+...+..++.||++||
T Consensus       486 lL~~-------~~-----~~tl~~~i~~~~~~g~---~~~Aaa~s~ilvli~~i~~~l~~~~~rr~~~r  539 (546)
T TIGR03262       486 FLYS-------PD-----TKLASVAILNMDDAGD---IAPAAAMATLIVLTSAVAKLLFALASRRLLRR  539 (546)
T ss_pred             EECC-------CC-----CEEHHHHHHHHHHCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8739-------99-----8029999999865877---58899999999999999999999999884468


No 25 
>CHL00187 cysT sulfate transport protein; Provisional
Probab=99.92  E-value=1.5e-23  Score=168.83  Aligned_cols=175  Identities=22%  Similarity=0.262  Sum_probs=145.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HH
Q ss_conf             202667899999999999999999999999998643730245678989988765336999999999999---------86
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI---------NF  271 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~---------~~  271 (425)
                      ...+.++..|+..+.++.+++..+|+..|.++.++.  .+.+++++..+...-.+|++|.|+-.+..+.         ..
T Consensus        49 ~~~~~~~~~Sl~~s~~~t~i~~~ig~~~A~~l~r~~--~~gk~~~~~l~~lP~~iP~~v~a~~~~~~f~~~G~~~~~l~~  126 (235)
T CHL00187         49 PIALSAYSLTVSMALIAALINGIFGLLIAWVLVRYN--FPGKRFLDAAVDLPFALPTSVAGLTLATVYGDNGWIGHILSS  126 (235)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             999999999999999999999999999999999843--761899999999999978999999999996446617689997


Q ss_pred             HCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             26663-00468975334543668999999998511067898998707721277778839753325899999999998767
Q gi|254780705|r  272 FKMPR-STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE  350 (425)
Q Consensus       272 ~~~~~-~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GE  350 (425)
                      ++... .+...-.+++.+..+|++++..+++++++|++++|||..+|||+||++++|++|+.+||+++|.++.+.+++||
T Consensus       127 ~~~~~~~~~~giii~~~~~~~P~~~~~~~~~l~~i~~~leEAA~~lGAs~~~~f~~I~lPll~p~i~a~~~l~f~~~~~e  206 (235)
T CHL00187        127 LGIKIVFTKLGVLLAMIFVSLPFVVRTIQPVLQEIEKELEEAAWSLGASPWETFWKVIFPPLIPALLTGLALTFSRAIGE  206 (235)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             07651230999999999988799999899999860299999998739995041131217846899999999999999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             799999854321013665613445579999998603
Q gi|254780705|r  351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA  386 (425)
Q Consensus       351 ta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~  386 (425)
                      .+..+++||+     .|.    .++|+|+.||+.-+
T Consensus       207 Fg~~~~lgGn-----~~~----~~~t~~~~iy~~~~  233 (235)
T CHL00187        207 YGSIVLISSN-----IPF----KDLVASVLIFQSLE  233 (235)
T ss_pred             HHHHHEEECC-----CCC----CCCHHHHHHHHHHH
T ss_conf             8789802568-----898----42048999999986


No 26 
>PRK09433 thiP thiamine transporter membrane protein; Reviewed
Probab=99.91  E-value=2.7e-22  Score=160.78  Aligned_cols=205  Identities=18%  Similarity=0.175  Sum_probs=159.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-C
Q ss_conf             120266789999999999999999999999999864--3730245678989988765336999999999999862666-3
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF--SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMP-R  276 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~--a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~-~  276 (425)
                      ....|.++..|+.++..+.+++..+|+..+....+.  ..+++.++.++......-++|++|.|+ |+.++.+.+..+ .
T Consensus       324 ~~~~~~a~~nSl~iA~~aa~la~~lal~la~~~~~~~~r~~~~~~~~l~~~~~lplaiPgiVlg~-Gl~ll~~~~~~~~~  402 (536)
T PRK09433        324 QPALWQALWTSLRIALLAALLAVLLAMALLLSSRELRLRQKALAAQALELSGMLILAMPGLVLAT-GLFLLLRNFTDLPQ  402 (536)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCHHHHHH-HHHHHHHHHCHHHH
T ss_conf             38899999999999999999999999999999999998501068899999999887332999999-99999862024568


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00468975334543668999999998511067898998707721277778839753325899999999998767799999
Q gi|254780705|r  277 STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF  356 (425)
Q Consensus       277 ~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~  356 (425)
                      .....-.++.+++.+|+.++....+++++|++++|+|.+||+++|+++++|++|..+|++++|..++|..++||....++
T Consensus       403 ~~~~ivil~~~l~~lP~a~r~l~~~l~~i~~~le~aA~sLGas~~~~f~~I~lPll~p~i~~a~~l~F~~smgEl~a~~l  482 (536)
T PRK09433        403 SALGIVILVNALMALPYALRVLEPPMRDIAARYGRLCQSLGIRGWSRLRLVEWRALRRPLAQAFAFACALSLGDFGVIAL  482 (536)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHE
T ss_conf             89999999999999999999999999970175999998869998789698539830999999999999999875370213


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8543210136656134455799999986036650069999999999999999999999999997
Q gi|254780705|r  357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       357 ~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                      .+..       +     .+|||++||...++.+   .+.+++.+++|+++++....+...+.+|
T Consensus       483 l~~~-------~-----~~TLp~~iy~~~~~~~---~~~Aa~~allL~ll~~~~f~l~er~~~~  531 (536)
T PRK09433        483 FGSQ-------D-----FRTLPYLLYQQLGSYR---SQDAAVTALLLLLLCLLLFTLIERLPGR  531 (536)
T ss_pred             ECCC-------C-----CCCHHHHHHHHHHCCC---HHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             3399-------9-----8618999999872767---6889999999999999999999986135


No 27 
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed
Probab=99.91  E-value=1.2e-22  Score=163.11  Aligned_cols=207  Identities=18%  Similarity=0.138  Sum_probs=158.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHH
Q ss_conf             0266789999999999999999999999999864373024567898998876533699999999999---------9862
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL---------INFF  272 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~---------~~~~  272 (425)
                      ..+.++..|++.+++++++++.+|...|.+++...  .+.+++++..+-....+|++|-+.....++         ...+
T Consensus        60 ~~~~~l~nSl~~a~~~tvi~~~ig~~~A~~l~~~~--~~~r~~~~~l~~~P~~~p~~v~~~~~~~~~~~~G~ln~~l~~l  137 (285)
T PRK09497         60 LYAEVLLHSLNMALIATLACLVLGYPFAWFLAKLP--HKVRPLLLFLLIVPFWTNSLIRIYGLKIFLGTKGYLNEFLLWL  137 (285)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHC
T ss_conf             99999999999999999999999999888630167--5438999999999998799999999999814330788999981


Q ss_pred             CCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6663------0046897533454366899999999851106789899870772127777883975332589999999999
Q gi|254780705|r  273 KMPR------STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR  346 (425)
Q Consensus       273 ~~~~------~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~r  346 (425)
                      |+..      .+..+-.+++....+|+++.....+++++|++++|||..+|||+||+++||++|+.+||+++|.++.+..
T Consensus       138 g~~~~p~~~l~~~~~vii~~v~~~lPf~~l~l~a~l~~i~~~l~EAA~~lGAs~~~~F~~I~lPl~~Pgi~~~~il~fi~  217 (285)
T PRK09497        138 GVIDTPIRIMFTESAVIIGLVYILLPFMVLPLYSSIEKLDKPLLEAARDLGANKLQTFIRIIIPLTMPGIIAGCLLVLLP  217 (285)
T ss_pred             CCCCCCHHHHCCHHHHHHHHHEEECHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHEEHHEEEHHHHHHHHHHHHHHHHH
T ss_conf             57566235423498887875313120677437878840896899999875999789132022081089999999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             876779999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       347 a~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      ++||.....+.||..            ..++|..||.+.....  +...++|.+.+|++++.++-......+|+++||
T Consensus       218 s~~~F~~~~~lgG~~------------~~~l~~~i~~~~~~~~--~~~~aaA~svil~~i~~~~~~i~~r~~k~~~kk  281 (285)
T PRK09497        218 AMGMFYVSDLLGGAK------------NLLIGNVIKSQFLNIR--DWPFGAATSITLTIVMGLMLLVYYRASKLLNKK  281 (285)
T ss_pred             HHHHHHEEEECCCCC------------CCHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH
T ss_conf             988762100104897------------5529999999998706--906999999999999999999999999995301


No 28 
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry represents CysW, one of two homologous, tandem permeases in the sulphate ABC transporter system; the other is CysT (IPR011865 from INTERPRO). The sulphate transporter has been described in Escherichia coli as transporting sulphate, thiosulphate, selenate, and selenite. Sulphate transporters may also transport molybdate ion if a specific molybdate transporter is not present.; GO: 0015116 sulfate transmembrane transporter activity, 0008272 sulfate transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=99.90  E-value=5.7e-24  Score=171.48  Aligned_cols=203  Identities=27%  Similarity=0.245  Sum_probs=150.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HH----HCCC
Q ss_conf             667899999999999999999999999998643730245678989988765336999999999999----86----2666
Q gi|254780705|r  204 GVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI----NF----FKMP  275 (425)
Q Consensus       204 ~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~----~~----~~~~  275 (425)
                      ..|+.=|+.+++|++.+..-.||.+|.-+++|--+|  ++++-..||..-+|=.||-|+.-...|.    ..    -|..
T Consensus        46 ~sA~~LTlLv~~I~VPlN~~FGv~~Aw~~~rf~FpG--k~lL~t~iDlPFSVSPVvAGL~~~LLyGrqGW~~PliedGvr  123 (275)
T TIGR02140        46 LSAIKLTLLVALIVVPLNTVFGVAAAWVLTRFQFPG--KRLLLTIIDLPFSVSPVVAGLIFVLLYGRQGWSQPLIEDGVR  123 (275)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--HHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCHHHCCCC
T ss_conf             999989886676533078899999999987431674--576777776044322489999999984310013622343420


Q ss_pred             CCHH---------------HHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3004---------------6897-53345436689999999985110678989987077212777788397533258999
Q gi|254780705|r  276 RSTA---------------LVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG  339 (425)
Q Consensus       276 ~~~~---------------l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g  339 (425)
                      .+.+               +.|. ++-.+.|.|+++|-..--|++.-++-||||..||||.|||+|||+||..|.|.+-|
T Consensus       124 fsG~lG~~l~~~d~~IiF~~PGivLAT~FVT~PFVAREliPvl~~qG~~~EeAAltLGAs~WqtFwrVTLPnIkWgLlYG  203 (275)
T TIGR02140       124 FSGWLGPWLEDRDIKIIFSLPGIVLATIFVTLPFVARELIPVLEEQGTEQEEAALTLGASWWQTFWRVTLPNIKWGLLYG  203 (275)
T ss_pred             EECCCHHHHHHCCCEEEECCHHHHHHHHHHCCCEEEEECCHHHHHCCCHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHH
T ss_conf             00420278886288588714134102343258801220011363159468999987277622333566168715789854


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999998767799999854321013665613445579999998603665006999999999999999999999999999
Q gi|254780705|r  340 STVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN  419 (425)
Q Consensus       340 ~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~  419 (425)
                      ++|+-|||+||.+++-.+.|         ++...+.|||.||=..-.   +.+.+.|+|++-+|..+-++--++-.++-+
T Consensus       204 ~~LcnARamGEFGAVsVVSG---------~IrG~TnTLPL~Ve~lY~---~Y~~~AAFA~AslLal~Al~TL~lK~~LE~  271 (275)
T TIGR02140       204 VILCNARAMGEFGAVSVVSG---------HIRGKTNTLPLHVELLYN---EYQSEAAFAAASLLALLALVTLVLKAILER  271 (275)
T ss_pred             HHHHCCHHHCCCCCEEEEEC---------CCCCCCCCCHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             67751302002112568852---------689998763243232324---013478899999999999999999999986


Q ss_pred             H
Q ss_conf             7
Q gi|254780705|r  420 R  420 (425)
Q Consensus       420 r  420 (425)
                      |
T Consensus       272 r  272 (275)
T TIGR02140       272 R  272 (275)
T ss_pred             H
T ss_conf             4


No 29 
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein.
Probab=99.90  E-value=1.2e-20  Score=150.28  Aligned_cols=204  Identities=18%  Similarity=0.062  Sum_probs=160.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHCC
Q ss_conf             2026678999999999999999999999999986437302456789899887653369999999999998------6266
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN------FFKM  274 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~------~~~~  274 (425)
                      -+.+.++.+|++.+..+.+++.++|+..|.+++.+.  -+.+++++...-..-.+|++|.++-....+.+      .++.
T Consensus        50 ~~~~~~l~nTl~l~~~~~~~~~~lg~~~A~~~~r~~--~~gr~~~~~~~~lPl~~P~~v~a~~~~~l~~~~G~~~~~l~~  127 (546)
T TIGR03262        50 PGLLQSLGNSLTVSAIVTAIVVPLAFAFAYALTRSR--IPGKGAFRLVALLPLLAPSLLPAISLIYLFGNQGLLKGLLGG  127 (546)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             689999999999999999999999999999998055--646999999999999999999999999998316378999863


Q ss_pred             -CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -6300468975334543668999999998511067898998707721277778839753325899999999998767799
Q gi|254780705|r  275 -PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP  353 (425)
Q Consensus       275 -~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~  353 (425)
                       .-.+.....+++++...|++....+.+++++|++++|||..+|+++|+++++|++|+++|+|.+|.++.+..+++|.+.
T Consensus       128 ~~iy~~~gii~~~~~~~~P~~~l~~~~al~~~d~~l~eaA~~lGa~~~~~f~~i~lPl~~P~i~~~~lLvf~~~l~~Fg~  207 (546)
T TIGR03262       128 FSIYGFWGIVIGEVFYTFPHALMILVTALSLADGRLYEAARAMGASPWRTFFTVTLPGAKYGLISAAFVVFTLVITDFGV  207 (546)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             71547999999999999999999999999719989999998729998899999447865799999999999999753325


Q ss_pred             HHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99985432101366561344557999999860366500699999999999999999999999999974
Q gi|254780705|r  354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF  421 (425)
Q Consensus       354 ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~  421 (425)
                      ..+.|+.             ..+++++||......  .+.+.+.+.+++|+++.+.+-....++++|-
T Consensus       208 p~ilG~~-------------~~tltt~Iy~~~~~~--~d~~~aa~ls~~ll~~~~~~~~~~~~~~~~~  260 (546)
T TIGR03262       208 PKVIGGD-------------YNVLATDIYKQVIGQ--QNFPMGAVVGVLLLLPALLAFGIDRAIQRRQ  260 (546)
T ss_pred             HHHHCCC-------------CCCHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8884387-------------111279999999627--8868999999999999999999999996313


No 30 
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism]
Probab=99.90  E-value=1.9e-21  Score=155.38  Aligned_cols=203  Identities=24%  Similarity=0.268  Sum_probs=159.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCC
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986266---630
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM---PRS  277 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~---~~~  277 (425)
                      ...|.++..|+.....+.+++..+|+..+....+.  ++++++.++......-++|.+|.|+--+..|-...+.   +-.
T Consensus       329 ~~~~~a~~nSl~~a~~aa~l~~~~~l~~a~~~~r~--~~~~~~~~~~l~~l~~avPG~Vla~g~l~~~~~~~~~~~~~~~  406 (540)
T COG1178         329 PQFWQALLNSLLLALAAALLAVVLALLLAYAVRRL--RSRLSRLLERLSMLPLAVPGVVLALGLLLLFRAPDGLLYQPLY  406 (540)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCHHCCCHH
T ss_conf             88999999999999999999999999999999973--2348899999988786336999999999998512200003056


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             04689753345436689999999985110678989987077212777788397533258999999999987677999998
Q gi|254780705|r  278 TALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV  357 (425)
Q Consensus       278 ~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~  357 (425)
                      +.+.=.++.+++-+|+..++.+.+++++|++++|||.+||+++||++++|++|..+||+++|..+.|..+++|....++.
T Consensus       407 t~~ilv~a~~~~~~p~a~r~~~a~l~qi~~~leeaa~sLG~~~~~~~~~I~lPll~p~l~~a~~l~F~~s~~Elsat~lL  486 (540)
T COG1178         407 TLLILVLAYALRFLPFAVRSLRAALRQIDPSLEEAARSLGASGLRRFRRITLPLLRPGLLAAAALVFALSIGELSATLLL  486 (540)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEE
T ss_conf             89999999999998899999999998779749999988599787798998787305889999999999997553768786


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             543210136656134455799999986036650069999999999999999999999999997
Q gi|254780705|r  358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       358 ~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                      +.       |+     .+|+|+.||...++++   .+.+++.+++|+++.+........+.++
T Consensus       487 ~~-------~~-----~~TL~~~iy~~~~~~~---~~~Aaa~a~il~~~~~~~~~~~~~~~~~  534 (540)
T COG1178         487 GS-------PG-----TRTLTVYIYNLLSDGR---YGDAAALALILLVVSLLLFLLLDRLGEG  534 (540)
T ss_pred             CC-------CC-----CEEHHHHHHHHCCCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             38-------99-----6109999999803611---6888999999999999999999996402


No 31 
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism]
Probab=99.89  E-value=2.7e-20  Score=148.13  Aligned_cols=204  Identities=24%  Similarity=0.259  Sum_probs=160.8

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------H
Q ss_conf             0120266789999999999999999999999999864373024567898998876533699999999999---------9
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL---------I  269 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~---------~  269 (425)
                      -....+..+..|++.+..+.+++..+|+..|..++.|.-+  -+++++...-..-.+|+.|-++-....+         .
T Consensus        50 ~~~~~~~~l~nTl~la~~~~~ls~~lG~~~A~l~~r~~fp--Gr~~l~~l~~lPl~iP~~V~a~~~~~l~G~~G~~~~l~  127 (540)
T COG1178          50 SDPYLWRVLANTLILAVLVTLLSVVLGIPLAWLLSRYDFP--GRRLLRWLLALPLVIPPFVVALAWISLFGPSGPLAALL  127 (540)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             1238999999999999999999999999999999986277--17999999999988879999999999976763499999


Q ss_pred             HHHCCCC--CHHHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8626663--0046897-533454366899999999851106789899870772127777883975332589999999999
Q gi|254780705|r  270 NFFKMPR--STALVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR  346 (425)
Q Consensus       270 ~~~~~~~--~~~l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~r  346 (425)
                      ..+|...  .-.+.|. +++++...|++....+.+++++|++++|+|..||+++||++++|++|.++|+|.+|..|.|-.
T Consensus       128 ~~~G~~~~~iyg~~Giil~~~~~~~P~~~l~~~~al~~i~~~~~EaAr~LGa~~~~~F~~V~lPllrPai~~~~~Lvf~~  207 (540)
T COG1178         128 ELLGFESPSIYGLGGILLALVFFNYPLAYLLVLAALETIPPSLEEAARTLGASRWQVFRKVTLPLLRPAIAAGALLVFML  207 (540)
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87446876646689999999999825999999999983894699999875998322888867887778999999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8767799999854321013665613445579999998603665006999999999999999999999999999
Q gi|254780705|r  347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN  419 (425)
Q Consensus       347 a~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~  419 (425)
                      .+.|.+..++.|+.             .+|++++||.......  ....+...+.+++.+++.+-..-.+.++
T Consensus       208 ~l~dFg~p~~LG~~-------------~~Tl~t~IY~~~~~~~--~~~~Aa~la~lll~~~~~ll~~~~~~~~  265 (540)
T COG1178         208 CLADFGTPLILGGG-------------YTTLETAIYQAIMSSF--DLARAALLALLLLLITAALLLLERRLRR  265 (540)
T ss_pred             HHHHHHHHHHHCCC-------------CCEEHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99864469997698-------------7332999999998458--8256999999999999999999999850


No 32 
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional
Probab=99.88  E-value=1.7e-20  Score=149.44  Aligned_cols=192  Identities=19%  Similarity=0.160  Sum_probs=145.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHH
Q ss_conf             02667899999999999999999999999998643730245678989988765336999999999999---------862
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI---------NFF  272 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~---------~~~  272 (425)
                      --+.++..|+..+.+++++++.+|...|.+++.+.  .+.++++...+-..--+|.+|-+.-...++.         ..+
T Consensus        94 ~y~~a~~nSL~iA~~sT~i~lliG~P~Ay~iar~~--~~~r~~l~~lvilP~~~s~lVr~~aw~~iL~~~G~ln~~L~~l  171 (317)
T PRK10683         94 LYFDAYLQSLQVAAISTICCLLIGYPLAWAVAHSK--PSTRNILLLLVILPSWTSFLIRVYAWMGILKNNGVLNNFLLWL  171 (317)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             89999999999999999999999999999999388--6178999999999970679999999999973143487899996


Q ss_pred             CC---CC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66---63---0046897533454366899999999851106789899870772127777883975332589999999999
Q gi|254780705|r  273 KM---PR---STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR  346 (425)
Q Consensus       273 ~~---~~---~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~r  346 (425)
                      |.   |.   .+..+-.+.+....+|+++.....+++++|++++|||..|||++||++++|++|+++|||++|.++.|..
T Consensus       172 Gli~~pl~ll~t~~aViig~v~~~lPfmvL~l~a~L~~id~~L~EAA~~LGAs~~~~F~~VtLPL~~PGIiag~lLvFi~  251 (317)
T PRK10683        172 GVIDQPLTILHTNLAVYIGIVYAYLPFMVLPIYTALTRIDYSLVEAALDLGARPLKTFFSVIVPLTKGGIIAGSMLVFIP  251 (317)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHEEEEECCCHHHHHHHHHHHHHH
T ss_conf             04467632256458999999999999999999999985890899999876998655400232062189999999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             876779999985432101366561344557999999860366500699999999999999999
Q gi|254780705|r  347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV  409 (425)
Q Consensus       347 a~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~  409 (425)
                      ++||.+.-.+.||..            ..+++..||+.... ... ...++|.+.+|++++++
T Consensus       252 a~g~F~iP~lLGG~~------------~~~i~~~i~~~f~~-~~d-wp~aaAlavvLl~i~iv  300 (317)
T PRK10683        252 AVGEFVIPELLGGPD------------SIMIGRVLWQEFFN-NRD-WPVASAVAIIMLLLLIV  300 (317)
T ss_pred             HHHHHHHHHHHCCCC------------CCCHHHHHHHHHHH-HCC-HHHHHHHHHHHHHHHHH
T ss_conf             988877686642998------------56299999999987-468-05899999999999999


No 33 
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. For these transporters the ABCs and TMs are on independent polypeptide chains. These systems transport a diverse range of substrates. Most are specific for a single substrate or a group of related substrates; however some transporters are more promiscuous, transporting structurally diverse substrates such as the histidine/lysine and arginine transporter in Enterobacteriaceae. In the latter case, this is achieved through binding different PBPs with different specificities to the TMs. F
Probab=99.88  E-value=2.8e-20  Score=148.01  Aligned_cols=153  Identities=31%  Similarity=0.432  Sum_probs=133.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCHHHHHHH
Q ss_conf             899999999999999999999999998643730245678989988765336999999999999862666--300468975
Q gi|254780705|r  207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMP--RSTALVGGL  284 (425)
Q Consensus       207 i~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~--~~~~l~g~~  284 (425)
                      +.+|++.++++.++++++|+..|+++..+  +++.++.++..++....+|+++.++..+..+.......  ....+.+.+
T Consensus         1 l~nSl~i~~~~~~i~~~ig~~~a~~~~~~--~~~~~~~~~~~~~i~~~iP~~v~~~~~~~~~~~~~~~~~~~~~~~~~i~   78 (190)
T cd06261           1 LLNTLLLALIATLLALVLGLLLGIILARK--RGKLDRLLRRIIDLLLSLPSLVLGLLLVLLFGVLLGWGILPGLGLPALI   78 (190)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             98799999999999999999999999951--8508899999999999803999999999999841232214789999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             33454366899999999851106789899870772127777883975332589999999999876779999985432
Q gi|254780705|r  285 ILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA  361 (425)
Q Consensus       285 ~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~  361 (425)
                      .+.+...|++....+++++++|++++|||..+|+++||+++||++|.++|+++++.++.+.++++|++...++++..
T Consensus        79 ~~~~~~~p~~~~~~~~~l~~i~~~~~eaA~~~Ga~~~~~~~~i~lP~~~p~i~~~~~l~~~~~~~~~~~~~~l~~~~  155 (190)
T cd06261          79 LALLLIAPFARLIRRAALESIPKDLVEAARALGASPWQIFRRIILPLALPPILTGLVLAFARALGEFALVSFLGGGE  155 (190)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999999999983899999999986997346569987996399999999999999999999999996899


No 34 
>PRK09433 thiP thiamine transporter membrane protein; Reviewed
Probab=99.85  E-value=2.8e-18  Score=135.24  Aligned_cols=206  Identities=18%  Similarity=0.055  Sum_probs=158.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------H
Q ss_conf             1202667899999999999999999999999998643730245678989988765336999999999999---------8
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI---------N  270 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~---------~  270 (425)
                      ..-.|.++..|++.++.+.++++.+|+..|..+..+  +-+.+++++..+...-.+|++|..+-...++.         .
T Consensus        49 d~~~~~~~~~t~~~a~~st~ls~~lg~~~A~~l~r~--~f~gr~~l~~l~~lp~~~P~~v~a~~~~~~~g~~G~l~~~l~  126 (536)
T PRK09433         49 DSYLWHVVRFSFWQAFLSALLSVLLAIPLARALYRR--RFPGRGLLLRLCAMTLVLPVLVAVFGLLSVYGRSGWLASLLQ  126 (536)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             888999999999999999999999999999999955--873499999999999876999999999999821644999999


Q ss_pred             HHCCCCC---HHHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6266630---046897-533454366899999999851106789899870772127777883975332589999999999
Q gi|254780705|r  271 FFKMPRS---TALVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR  346 (425)
Q Consensus       271 ~~~~~~~---~~l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~r  346 (425)
                      .+|....   -.+.|. +++.+..+|++++...++++++|++++|+|..||+++||++++|++|..+|++.+|..+.|-.
T Consensus       127 ~~g~~~~~~iyg~~gil~a~~~~~~P~~~~~~~~~l~~i~~~~~e~A~~LG~~~~~~f~~v~lP~~~pai~~~~~LVF~~  206 (536)
T PRK09433        127 SLGLEWPFSIYGLQGILLAHVFFNLPLATRLLLQSLESIPSEQRQLAAQLGMRGWQFFRLVEWPWLRRQLPPVAALIFML  206 (536)
T ss_pred             HCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             82887786401299999999999999999999999981999999999875989868888634898878899999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             87677999998543210136656134455799999986036650069999999999999999999999999997
Q gi|254780705|r  347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       347 a~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                      ++++.+.++..||.      |.     .+|+++.||+.... + .+...+...+++++++++.+......+++|
T Consensus       207 ~~~sF~~vl~LGGg------p~-----~~Tlev~IYq~~~~-~-~D~~~Aa~La~i~l~i~~~l~~l~~~~~~~  267 (536)
T PRK09433        207 CFTSFATVLTLGGG------PK-----ATTIELAIYQALSF-D-FDLARAALLALLQLVLCLLLVLLSQRLSKA  267 (536)
T ss_pred             HHHHHHHHHHHCCC------CC-----CHHHHHHHHHHHHH-C-CCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99988899995588------64-----03689999999986-4-799999999999999999999999998224


No 35 
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein.
Probab=99.83  E-value=2.1e-18  Score=136.10  Aligned_cols=151  Identities=21%  Similarity=0.348  Sum_probs=131.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             01202667899999999999999999999999998643730245678989988765336999999999999862666300
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST  278 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~  278 (425)
                      ..-|.|..-+-|++++.+|.++++-+|+..||+...   +.+..++++...|.+..+||.+|=    ...+.+||.   +
T Consensus        80 ~~~G~W~~am~Tlalv~~av~la~~iGiPlGI~~~~---s~~~~~~l~pild~mQTiP~fvyL----ip~i~lfGi---G  149 (267)
T TIGR03416        80 INQGYWEETVETLALVLSATVVCMVIGVPLGIAAAH---RPWLYAIMRPVLDLMQTLPTFVYL----IPALVLFGL---G  149 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---CHHHHHHHHHHHHHHHCCCHHHHH----HHHHHHHCC---C
T ss_conf             987158999999999999999999999999999981---699999999999874315467999----999999488---7


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46897533454366899999999851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       279 ~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      ..++-++..+..+|.+++.|..++|+||+++.|||.++|+|+||+++||.+|.|+|.|++|+=.+.--+++=....-|+|
T Consensus       150 ~~~aiia~~iya~~P~ir~T~~Gir~V~~~~iEaa~~~G~s~~q~l~~V~lPlA~P~Il~G~nq~i~~al~mvviaa~IG  229 (267)
T TIGR03416       150 MVPGLISTVIFAIPAPIRLTHLGISSVPQELVEAGEAFGATPSQLLWKVELPYAMPQIMAGLTQTIMLSLSMVVIAALVG  229 (267)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             05699999999988999999999985676899999983998988979941841589999999999999999999999967


Q ss_pred             H
Q ss_conf             4
Q gi|254780705|r  359 M  359 (425)
Q Consensus       359 ~  359 (425)
                      +
T Consensus       230 a  230 (267)
T TIGR03416       230 A  230 (267)
T ss_pred             C
T ss_conf             8


No 36 
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism]
Probab=99.83  E-value=5.8e-18  Score=133.22  Aligned_cols=204  Identities=22%  Similarity=0.221  Sum_probs=166.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH-
Q ss_conf             0266789999999999999999999999999864373024567898998876533699999999999986266630046-
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTAL-  280 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l-  280 (425)
                      -.|..+..|+++.++++.++.++|+.-|..+.-.  +.|-++++...+|.+-++|+++.|++-|..+..--.+.....+ 
T Consensus        20 ~l~~iv~~tl~vSl~~i~laalv~~pLa~vl~~~--~frgkr~i~~i~~tl~s~PTVlvGLlLylLlSr~GPlG~f~LLf   97 (227)
T COG4662          20 ELIGIVATTLYVSLISIFLAALVGVPLAFVLALR--EFRGKRFIKMIINTLLSMPTVLVGLLLYLLLSRSGPLGWFNLLF   97 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             9999999999999999999997532899999983--47547999999988631639999999999996469986303676


Q ss_pred             -HHHH--HHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -8975--3345436689999999985110678989987077212777788397533258999999999987677999998
Q gi|254780705|r  281 -VGGL--ILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV  357 (425)
Q Consensus       281 -~g~~--~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~  357 (425)
                       .+++  --+++.+|.++...-.++++++|..+|-|..+|+|+.+.... +..-++-|+++.+++|+||+++|....||+
T Consensus        98 T~~amILGq~iL~lPlvia~~l~ale~~dpr~~ela~~lgas~~kl~~t-~~~Earf~l~aav~agfgR~V~EvG~Ammv  176 (227)
T COG4662          98 TQDAMILGQAILILPLVIAFVLTALESVDPRLKELARSLGASPLKLAST-VFREARFGLMAAVAAGFGRAVAEVGVAMMV  176 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             2106998879999999999999999845978999999809958999999-999998679999999861799986277603


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             543210136656134455799999986036650069999999999999999999999999997
Q gi|254780705|r  358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       358 ~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                      ||+-         ..-+++++..|-....-   +..+...+..+||+.+-+.+|+.-.+++.|
T Consensus       177 GGnI---------~g~TR~itTAIslET~k---G~fa~gIaLgiVLlaial~ln~vl~~l~~~  227 (227)
T COG4662         177 GGNI---------RGRTRVITTAISLETNK---GNFAQGIALGIVLLAIALALNFVLTALQGK  227 (227)
T ss_pred             CCCC---------CCEEEEEHHHHHHHHCC---CCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             5751---------11223300244356034---529885899999999999999999984469


No 37 
>PRK10952 glycine betaine transporter membrane protein; Provisional
Probab=99.82  E-value=4.5e-18  Score=133.92  Aligned_cols=200  Identities=21%  Similarity=0.322  Sum_probs=147.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
                      .-|.|..-+-|+.+.++|+++++-+|+..+|+...   ..+..++++...|.+..+|+-||=+    ..+.+||.   ..
T Consensus       138 ~~G~W~~aM~TLalvlvav~~~~iiGiplGI~~ar---s~r~~~il~PiLD~mQT~P~FVYLi----P~vmlFGi---G~  207 (354)
T PRK10952        138 AIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR---SPRAAKIIRPLLDAMQTTPAFVYLV----PIVMLFGI---GN  207 (354)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---CHHHHHHHHHHHHHHHCCHHHHHHH----HHHHHHCC---CC
T ss_conf             96632999999999999999999999999999974---6999999999998731130799999----99999279---71


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68975334543668999999998511067898998707721277778839753325899999999998767799999854
Q gi|254780705|r  280 LVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM  359 (425)
Q Consensus       280 l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~  359 (425)
                      ..|.++..+..+|.++|.|..++++||+++.|||.+.|+|+||.+++|-+|+|+|.|+.|+=-+.--+++=....-|+|+
T Consensus       208 vpaviAtviyAlpP~iR~T~lGir~Vp~~viEAa~~~G~T~~Q~L~kVeLPlA~P~ImaGvNQtimlaLsMvVIAa~IGa  287 (354)
T PRK10952        208 VPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAV  287 (354)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             45999999997358999999999608888999999849998889898336024999999999999999999999999578


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHCCC
Q ss_conf             3210136656134455799999986036650069999999999999999999--99999999741049
Q gi|254780705|r  360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN--TAMLWLRNRFKKRW  425 (425)
Q Consensus       360 ~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n--~~a~~lr~r~~~~w  425 (425)
                      ..               |-..||.-....+.+ .-...+.++|++.+++==-  ..+.--|+|=.|||
T Consensus       288 gG---------------LG~~Vl~gi~~~d~G-~gl~aGl~IVlLAIiLDRiTqa~g~~~r~~~~~~w  339 (354)
T PRK10952        288 GG---------------LGQMVLRGIGRLDMG-LATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRW  339 (354)
T ss_pred             CC---------------CHHHHHHHHHHCCHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCE
T ss_conf             86---------------618999998622436-89999999999999999988985620002688610


No 38 
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism]
Probab=99.82  E-value=4.6e-20  Score=146.59  Aligned_cols=206  Identities=23%  Similarity=0.223  Sum_probs=147.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC------
Q ss_conf             26678999999999999999999999999986437302456789899887653369999999999998626663------
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPR------  276 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~------  276 (425)
                      -+.|+.-|+.++.|++.+....|+.+|..+++|.-++  ++++...||+.-+|-.+|-|+.-+.+|.. -|+-+      
T Consensus        63 alsAi~LTllva~I~VPlN~vFGv~aAW~iakf~F~G--k~lL~tlIDlPFsVSPVvaGl~~vLl~g~-~g~lG~wl~~~  139 (287)
T COG4208          63 ALSAIKLTLLVALIAVPLNVVFGVAAAWAIARFEFPG--KALLLTLIDLPFSVSPVVAGLVYVLLFGS-NGWLGGWLEAH  139 (287)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCC--HHHHHHHHCCCCCCCHHHHHHHHHHHHCC-CCCCHHHHHHC
T ss_conf             8999999999998630078999999999999705884--44665654377742279987899998705-66320788857


Q ss_pred             ----CHHHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ----0046897-53345436689999999985110678989987077212777788397533258999999999987677
Q gi|254780705|r  277 ----STALVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET  351 (425)
Q Consensus       277 ----~~~l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt  351 (425)
                          ...+.|. ++-.+.+.|++.|-...-+++...+-+|||..||||.|||+|+|+||..+.|.+-|++|+-+||+||.
T Consensus       140 ~iqIiFa~PGiVLaT~FVT~PFVaREliPlmq~qG~~eEeAA~~LGAsgWQtFwrVTLPnIkWgLlYGvvL~nARamGEF  219 (287)
T COG4208         140 DIQIIFAVPGIVLATIFVTCPFVARELIPLMQEQGTDEEEAALTLGASGWQTFWRVTLPNIRWGLLYGVVLTNARAMGEF  219 (287)
T ss_pred             CCEEEEECCCCEEEEEEECCCHHHHHHHHHHHHHCCCHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHCHHHHCCC
T ss_conf             94699954741354522216128989879998839848899987262301102567547307999888987160554167


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999998543210136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       352 a~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
                      .++-.+.         +++...+.|||.|+-..-.+-   ....+++++-.|..+-++--.+-.++-+|.++
T Consensus       220 GAVsVVS---------G~IrG~TnTlPL~VEily~eY---~~~~AFa~AslLallAlvTL~lK~~le~r~~~  279 (287)
T COG4208         220 GAVSVVS---------GHIRGETNTLPLHVEILYNEY---NTVGAFAAASLLALLALVTLVLKTILEWRQGK  279 (287)
T ss_pred             CCEEEEE---------CCCCCCCCCCCHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7369984---------452477665230169887644---68899999999999999999999999987666


No 39 
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism]
Probab=99.81  E-value=5.6e-18  Score=133.32  Aligned_cols=211  Identities=23%  Similarity=0.292  Sum_probs=164.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             211012026678999999999999999999999999986437-----302456789899887653369999999999998
Q gi|254780705|r  196 SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH-----KGFFSSFVQANINNLASVPSIVYGILGSAVLIN  270 (425)
Q Consensus       196 ~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~-----~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~  270 (425)
                      .+.-...+|.|..-|+|++.++.++++.+|+..++.|.--.|     +..+.+++...+|.+-++|=|+. +..+.-+..
T Consensus         7 ~~~~~~~l~~a~~eTlyMv~~s~~~~~~iGlplGvlL~~T~~g~i~~n~~~~~il~~ivNi~Rs~PFiIL-lv~liP~Tr   85 (222)
T COG2011           7 SNDLWQLLWRATLETLYMVFVSTLFAFLIGLPLGVLLFLTGPGGLLENKLLYRILSAIVNILRSIPFIIL-LVALIPLTR   85 (222)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEECCCCCCCCHHHHHHHHHHHHHHHHCCHHHHH-HHHHHHHHH
T ss_conf             0657999999999999999999999999987663436781788613008899999999998751209999-999998899


Q ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             62666300468975334543668999999998511067898998707721277778839753325899999999998767
Q gi|254780705|r  271 FFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE  350 (425)
Q Consensus       271 ~~~~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GE  350 (425)
                      +.-.....+-++.+.|++-..|++.|..+.++++||+.+-|||.++|||+||.++++.||-|+|+++.|..+.+---+|.
T Consensus        86 ~ivGTsiG~~AAivPL~i~a~PF~ARlve~aL~EVd~GvIEAA~amGAs~~~II~kVlLpEa~p~li~g~Tvt~I~LIg~  165 (222)
T COG2011          86 LIVGTSIGTTAAIVPLTIGAAPFVARLVESALREVDKGVIEAAQAMGASPWQIIRKVLLPEALPGLVSGITVTLISLIGY  165 (222)
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99726525304774167888889999999999744725899999849988888787326213678998899999999808


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             79999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       351 ta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      ||-.=.+|+..        +    ..+..+ |-+    ++-..+-.+.+..++++++.....+-.++-||++||
T Consensus       166 SAMAGaIGgGG--------L----GdlAir-yGY----~Rf~~~Vm~~~viillilVq~iQ~~Gd~l~~r~~kr  222 (222)
T COG2011         166 SAMAGAIGGGG--------L----GDLAIR-YGY----QRFNTDVMVVAVVILLILVQLIQSLGDRLVRRLDKR  222 (222)
T ss_pred             HHHHCCCCCCC--------H----HHHHHH-HHH----HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             88830226673--------3----699999-878----855883157999999999999999989999997149


No 40 
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism]
Probab=99.81  E-value=2e-17  Score=129.74  Aligned_cols=199  Identities=22%  Similarity=0.256  Sum_probs=140.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHH---------
Q ss_conf             026678999999999999999999999999986437302456789899887653369999999----9999---------
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILG----SAVL---------  268 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~g----l~~~---------  268 (425)
                      --+..+..|+.++.++++++.-+|...|.|++...  .+.+...-.    +--+|--+-.+.-    ..++         
T Consensus        63 ~y~~v~~~Sl~iA~~~T~~~lligyP~Ay~la~~~--~~~r~~ll~----lvilPfwts~LiR~yawi~iL~~~G~iN~~  136 (287)
T COG1176          63 LYLTVLLRSLWIAALVTLICLLLGYPVAYFLARSP--PRWRNLLLL----LVILPFWTSLLIRTYAWIVILGRNGLINQA  136 (287)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--HHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             89999999999999999999999999999999677--379999999----999999899999999999998347716488


Q ss_pred             HHHHCCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98626663------004689753345436689999999985110678989987077212777788397533258999999
Q gi|254780705|r  269 INFFKMPR------STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV  342 (425)
Q Consensus       269 ~~~~~~~~------~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il  342 (425)
                      +...|+..      .+..+--+.+.-..+|+++-....+++.+|+++.|||..|||++||+++||++|+++|||++|+++
T Consensus       137 L~~lGl~~~p~~ll~~~~aV~igmvy~~lPfmiLPly~al~~id~~L~eAA~dLGA~~~~~F~~VilPLs~pGi~aG~~l  216 (287)
T COG1176         137 LLALGLIDEPLRLLYTETAVIIGMVYIYLPFMILPLYAALEKIDPSLLEAARDLGASPFQTFRRVILPLSLPGIIAGSLL  216 (287)
T ss_pred             HHHCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHEEECCCHHHHHHHHHH
T ss_conf             99768878867988053367689999865999999999998399789999987599765476420321771899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999876779999985432101366561344557999999860366500699999999999999999999999999974
Q gi|254780705|r  343 SLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF  421 (425)
Q Consensus       343 ~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~  421 (425)
                      .|--++|+.+.--+.||..            ...++..|+++..+ ..++ ..++|.+++|+++++.+ .......+|.
T Consensus       217 VFi~alG~fi~P~lLGG~~------------~~~ig~lI~~q~~~-~~nw-p~asA~sv~L~~i~~~~-~~~~~~~~~~  280 (287)
T COG1176         217 VFIPALGSFVTPALLGGPK------------VLMIGNLIYQQFLS-ARNW-PFASALAVVLLLVVLLL-LLLYLLFRRR  280 (287)
T ss_pred             HHHHHHHHHHHHHHHCCCC------------CCCHHHHHHHHHHH-HCCC-CHHHHHHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             9897758899889856975------------25399999999852-0584-47899999999999999-9999999987


No 41 
>PRK10998 malG maltose transporter permease; Provisional
Probab=99.79  E-value=4.6e-16  Score=121.13  Aligned_cols=204  Identities=15%  Similarity=0.075  Sum_probs=142.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH-
Q ss_conf             1202667899999999999999999999999998643730245678989988765336999999999999862666300-
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST-  278 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~-  278 (425)
                      ...++..+.+|++++.++.++++.+|+.+|..++.|..|  .++.+...+-....+|+++..+--+ .....+|+..+- 
T Consensus        78 ~~~~~~~~~NSl~va~~~~v~~l~~~~~aaYalar~~f~--g~~~l~~~~l~~~~iP~~~~~ip~~-~~~~~lgl~~~~~  154 (296)
T PRK10998         78 PFPVLLWLWNSVKIAGITAIGIVALSTTCAYAFARMRFP--GKATLLKGMLIFQMFPAVLSLVALY-ALFDRLGQYIPFI  154 (296)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEECC--CHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHCCCCCCH
T ss_conf             437899999999999999999999999999987312155--5899999999999988999999999-9999960202201


Q ss_pred             --HHHHHHHH-HHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHH
Q ss_conf             --46897533-45436689999999985110678989987077212777788397533258999999999987677-999
Q gi|254780705|r  279 --ALVGGLIL-ALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET-APL  354 (425)
Q Consensus       279 --~l~g~~~l-~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt-a~l  354 (425)
                        -..+++.+ .+..+|+.+-..+..++++|++++|||.-.|||+||++++|++|+++|++++..++.+-.+..|. -|+
T Consensus       155 ~l~t~~~ii~~~~~~~~~~i~ll~~ff~~iP~el~EAA~iDGas~~~~f~~IilPl~~P~i~t~~i~~fi~~WNef~~~l  234 (296)
T PRK10998        155 GLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVAS  234 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             33224999999999999999999999862979899999985997777978767862599999999999999999999999


Q ss_pred             HHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99854321013665613445579999998603665006999999999999999999999999999741
Q gi|254780705|r  355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       355 l~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                      +++..            ....|+|+.++...++....+...++++.+..+=.++    +-.+++|++-
T Consensus       235 l~l~~------------~~~~tl~v~l~~~~~~~~~~~g~~~A~~~i~~lP~lI----~f~~~qr~~i  286 (296)
T PRK10998        235 LLLRD------------VNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSALPITL----VFLLAQRWLV  286 (296)
T ss_pred             HHHCC------------CCCEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH----HHHHHHHHHH
T ss_conf             99089------------5430099999998662356499999999999999999----9999999999


No 42 
>PRK10160 taurine transporter subunit; Provisional
Probab=99.77  E-value=1.1e-15  Score=118.81  Aligned_cols=195  Identities=17%  Similarity=0.253  Sum_probs=155.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986266630046
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTAL  280 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l  280 (425)
                      +-++..+.-|+.-.++..+++.-+|+..|+.+..+   .++.+.++..++.+..+|++.+--    +++.+||....+. 
T Consensus        74 g~l~~~~~~Tl~r~~~Gf~la~~~Gv~lGil~g~~---~~~~~~l~P~l~~l~~iP~ial~P----l~ilwfG~g~~~~-  145 (275)
T PRK10160         74 ATLWQHLAASLTRIVLALLAAVVIGIPVGIAMGLS---PTVRGILDPLIELYRPVPPLAYLP----LMVIWFGIGETSK-  145 (275)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHCCHHHHHH----HHHHHHCCCCCCH-
T ss_conf             54999999999999999999999999999999987---999999999999998588999999----9998535784006-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89753345436689999999985110678989987077212777788397533258999999999987677999998543
Q gi|254780705|r  281 VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV  360 (425)
Q Consensus       281 ~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~  360 (425)
                        ..+.++..+|.++.++.+++++||+++.|.|.++|+|+||.++|+.+|.++|.+++|.-++++.+.--....=|+++.
T Consensus       146 --i~vv~l~~~fpi~~nt~~Gvr~vd~~l~e~ar~~gas~~q~~~~V~lP~alP~i~~GlRi~~~~a~~~~v~aE~l~~~  223 (275)
T PRK10160        146 --ILLIYLAIFAPVAMSALAGVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAAT  223 (275)
T ss_pred             --HEEEHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             --101028754089999999997189999999998299999999998888789999999999999999999999998347


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             21013665613445579999998603665006999999999999999999999999999741
Q gi|254780705|r  361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       361 ~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                                    .-+-..|+...+   ....+..+++++++.++-+.++.+..++.||+-
T Consensus       224 --------------~GLG~~I~~a~~---~~~~~~~~a~ii~i~llg~~l~~~~~~lerrl~  268 (275)
T PRK10160        224 --------------RGLGFMVQSAGE---FLATDVVLAGIAVIAIIAFLLELGLRALQRRLT  268 (275)
T ss_pred             --------------CCHHHHHHHHHH---HCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             --------------987899999998---637899999999999999999999999998918


No 43 
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional
Probab=99.77  E-value=9.1e-16  Score=119.23  Aligned_cols=198  Identities=18%  Similarity=0.205  Sum_probs=155.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
                      .+..+..+.-|+.-+++...++..+|+..|+.+..+   .+..+.++..++.+..+|.+.+--    +++-+||....+.
T Consensus        55 ~g~l~~~~~~Tl~r~~~Gf~l~~~~Gi~lGil~g~~---~~~~~~~~P~~~~l~~iP~ia~~P----l~ilwfG~g~~~~  127 (263)
T PRK11365         55 SGELWQHLAISSWRALIGFSIGGSLGLILGLISGLS---RWGERLLDTSIQMLRNVPHLALIP----LVILWFGIDESAK  127 (263)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHCHHHHHHHHCCHHHHHH----HHHHHHCCCCCHH
T ss_conf             845999999999999999999999999999999986---999987585999997657999999----9999971574204


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68975334543668999999998511067898998707721277778839753325899999999998767799999854
Q gi|254780705|r  280 LVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM  359 (425)
Q Consensus       280 l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~  359 (425)
                      +   .+..+..++.++.++.++++++|+++.|.+.++|+|+||.++|+.+|.+.|.+++|.-++++.+.--...-=|+|+
T Consensus       128 i---~~i~~~~~~pi~~nt~~Gv~~v~~~~~~~ar~~g~s~~~~l~~V~lP~alP~i~~glria~~~a~~~~v~aE~i~~  204 (263)
T PRK11365        128 I---FLVALGTLFPIYINTWHGIRNIDRGLVEMARSYGLSGIPLFIHVILPGALPSIMVGVRFALGLMWLTLIVAETISA  204 (263)
T ss_pred             H---HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             4---7886510428899998887549999999998729999999999898006889999999999999999999999844


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             321013665613445579999998603665006999999999999999999999999999741049
Q gi|254780705|r  360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW  425 (425)
Q Consensus       360 ~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~w  425 (425)
                      .              .-|-..|..-.+.   ...+..+++++++-++-+.+|....++.||+-| |
T Consensus       205 ~--------------~GLG~~i~~a~~~---~~~~~v~a~ii~i~llg~~l~~~~~~lerrll~-W  252 (263)
T PRK11365        205 N--------------SGIGYLAMNAREF---LQTDVVVVAIILYALLGKLADVSAQLLERLWLR-W  252 (263)
T ss_pred             C--------------CCHHHHHHHHHHH---HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-C
T ss_conf             6--------------9888999999987---068899999999999999999999999999388-8


No 44 
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism]
Probab=99.76  E-value=1.2e-15  Score=118.56  Aligned_cols=153  Identities=24%  Similarity=0.372  Sum_probs=133.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             01202667899999999999999999999999998643730245678989988765336999999999999862666300
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST  278 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~  278 (425)
                      +....+......+.++.+++++++-+|+..||++..+   .+++..+....|++..+||+  .+|  +++++.+|...  
T Consensus        20 ~~~~~~~~~~~Hl~l~~~a~~~a~~igVplGIl~~r~---~~~~~~v~~v~nv~qTiPsl--All--allipv~GiG~--   90 (221)
T COG1174          20 RQDYLLALTLQHLLLVLLAVLIAILIGVPLGILVTRS---RRLAGLVLGVANVLQTIPSL--ALL--ALLIPVLGIGL--   90 (221)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHCHHH--HHH--HHHHHHHCCCC--
T ss_conf             1879999999999999999999999997889998734---88888999999998616089--999--99999856886--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46897533454366899999999851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       279 ~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                       ..+-++|.+..+.-++++|..++++||++++|||.++|.|+||.+++|-+|.|+|-|++|+=.+.-..+|-...--++|
T Consensus        91 -~PAiiAL~lYsLLPIvrNT~~GL~~V~~~v~EAa~gmGMT~~Q~L~~VelPlAlPvIlaGIR~a~V~~ig~Atiaa~IG  169 (221)
T COG1174          91 -TPAIIALFLYSLLPIVRNTYTGLASVPPSVIEAARGMGMTRWQRLLKVELPLALPVILAGIRTAVVINIGTATIAALIG  169 (221)
T ss_pred             -CHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             -3899999999971999999999814987789998865998787989741200189998648999999999999999982


Q ss_pred             HHH
Q ss_conf             432
Q gi|254780705|r  359 MVA  361 (425)
Q Consensus       359 ~~~  361 (425)
                      ..+
T Consensus       170 AGG  172 (221)
T COG1174         170 AGG  172 (221)
T ss_pred             CCC
T ss_conf             774


No 45 
>pfam00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component. The alignments cover the most conserved region of the proteins, which is thought to be located in a cytoplasmic loop between two transmembrane domains. The members of this family have a variable number of transmembrane helices.
Probab=99.76  E-value=3.9e-16  Score=121.60  Aligned_cols=180  Identities=27%  Similarity=0.316  Sum_probs=136.3

Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999986437302456789899887653369999999999998626663004689753345436689999999
Q gi|254780705|r  221 SFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV  300 (425)
Q Consensus       221 a~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~g~~~l~~m~lP~i~~~~~~  300 (425)
                      ++|+|+.+|.    | ++++..++++...+.+.++|++++++.-+.++..  ...+...+.......+...|++.....+
T Consensus         1 Gv~lG~~~a~----~-~~~~~d~~~~~~~~~~~~iP~~~l~~~l~~~~~~--~~~~~~~~~~i~~~~~~~~~~~~~~~~~   73 (183)
T pfam00528         1 GIPLGIIAAL----R-RGRRLDRLLRPLIDLLQALPSFVLAILLVVISIL--SILGHGILPAIILALLGWAGYARLIRRA   73 (183)
T ss_pred             CHHHHHHHHH----H-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9869999995----0-7858999999999999983499999999999842--3667899999999999999999999999


Q ss_pred             HHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             98511067898998707721277778839753325899999999998767799999854321013665613445579999
Q gi|254780705|r  301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ  380 (425)
Q Consensus       301 al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~  380 (425)
                      +++++|+++.|+|.++|+|+||++++|++|.+.|.++++..++++.+++++..+-+++..      |+        +...
T Consensus        74 ~l~~~~~~~v~aA~~~G~s~~~i~~~~~lP~~~p~ii~~~~~~~~~~~~~~~~~e~l~~~------~G--------lG~~  139 (183)
T pfam00528        74 ALRSLPSDLVEAARALGASRWQIFRKIILPNALPPILTGLALAFGGALGGAVLLEFLGSW------PG--------LGLL  139 (183)
T ss_pred             HHHHCCHHHHHHHHHCCCCCCEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC------CC--------HHHH
T ss_conf             997068999999998699843412992189899999999999999999999999999368------96--------7599


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99860366500699999999999999999999999999974104
Q gi|254780705|r  381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       381 Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      +..   .....+.+...+..++..++.+.+|.++.++++.+++|
T Consensus       140 ~~~---a~~~~d~~~~~~~~~~~~~~~~~~~~~~d~l~~~ldpr  180 (183)
T pfam00528       140 LIE---AILGYDYPEIQGPVLAAALILLLLNLLVDILQRLLDPR  180 (183)
T ss_pred             HHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999---99977099999999999999999999999999873910


No 46 
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism]
Probab=99.74  E-value=4.9e-15  Score=114.57  Aligned_cols=210  Identities=18%  Similarity=0.152  Sum_probs=159.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------
Q ss_conf             2026678999999999999999999999999986437302456789899887653369999999999998----------
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN----------  270 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~----------  270 (425)
                      .-.|.++..|++-+.+++.+.+.+|+..|+.+..-   -+.+++.+..+-....+|+++.|+....++-+          
T Consensus        64 ~~f~~al~nT~~~~~~~v~~~~~lgl~lAlll~~~---~~g~~~~r~~~~lP~~~~~vv~~~iw~~l~~~~~G~~n~~l~  140 (295)
T COG1175          64 PTFWNALKNTLVFTVISVPLQLVLGLLLALLLNRK---LRGRGFFRTLFFLPWAISSVVAGLIWKWLFNPSFGLLNSLLL  140 (295)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             47999999999999999999999999999998470---447999999999998999999999999998876358999999


Q ss_pred             HHCCCC-CHHH--------HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             626663-0046--------8975334543668999999998511067898998707721277778839753325899999
Q gi|254780705|r  271 FFKMPR-STAL--------VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGST  341 (425)
Q Consensus       271 ~~~~~~-~~~l--------~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~i  341 (425)
                      .+|+.. ..++        +-.++-.-...|+.....-++|+++|+++.|||.-=||++||.++||++|+.+|.+..-.+
T Consensus       141 ~~gl~~~~~wl~~~~~A~~~iii~~vW~~~~f~mli~lAgLq~Ip~~lyEAA~iDGA~~~q~f~~ItlP~l~p~i~~~~i  220 (295)
T COG1175         141 LLGLIPDINWLSDPNTALFAVIIVSVWKGTGFVMLLFLAGLQSIPKELYEAARIDGASPWQRFRKITLPLLRPVIFFVLI  220 (295)
T ss_pred             HHCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             80575556341390699999999999999849999999999569999999995899964365454104410279999999


Q ss_pred             HHHHHHHHHHHHHH-HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999876779999-98543210136656134455799999986036650069999999999999999999999999997
Q gi|254780705|r  342 VSLARALGETAPLL-FVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       342 l~~~ra~GEta~ll-~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                      +.+..++.-..... +|+         ++|.+.++++...+|..+-+..  ..-.++|.+.++.++++++-.......+|
T Consensus       221 ~~~i~~~~~Fd~i~~lT~---------GGP~~~T~~l~~~~y~~af~~~--~~G~asA~avil~~i~~~~~~~~~~~~~~  289 (295)
T COG1175         221 LRTIFAFQVFDLIYLLTG---------GGPGNATTTLAYYIYRTAFGGL--DFGYAAAIAVILFLIVLILTVVQLRLLRR  289 (295)
T ss_pred             HHHHHHHHHHHHHHHHHC---------CCCCCHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999997369999807---------9996225599999999987006--66489999999999999999999999874


Q ss_pred             HHCC
Q ss_conf             4104
Q gi|254780705|r  421 FKKR  424 (425)
Q Consensus       421 ~~~~  424 (425)
                      .+++
T Consensus       290 ~~~~  293 (295)
T COG1175         290 KERR  293 (295)
T ss_pred             HHHC
T ss_conf             3531


No 47 
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed
Probab=99.74  E-value=2.2e-14  Score=110.39  Aligned_cols=215  Identities=15%  Similarity=0.146  Sum_probs=157.7

Q ss_pred             CCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             12202321344321101202667899999999999999999999999998643730245678989988765336999999
Q gi|254780705|r  184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGIL  263 (425)
Q Consensus       184 ~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~  263 (425)
                      .|||.++.+.      .--++..+..|+.+++++.++++++|+..|+.-  ..+...++.+.+..++..-++|-+|.=+|
T Consensus         2 ~fdw~~i~~~------~p~ll~Gl~~Tl~l~~~s~~~g~~lG~~~a~~r--~~~~~~l~~~~~~yv~~~RgtPlLv~lf~   73 (219)
T PRK09494          2 QFDWSAIWPA------IPLLLEGAKMTLWISVLGLAGGLVIGLLAGFAR--AYGGWIANHIALVFIELIRGTPIVVQVMF   73 (219)
T ss_pred             CCCHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             7879999998------999999999999999999999999999999999--88968999999999999976489999999


Q ss_pred             HHHHHHHHH-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999862-6663004689753345436689999999985110678989987077212777788397533258999999
Q gi|254780705|r  264 GSAVLINFF-KMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV  342 (425)
Q Consensus       264 gl~~~~~~~-~~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il  342 (425)
                      .+..+-..+ +...+...+|.+++++..-.++.-..|.++++||+...|||.++|.|+||++++|++|+|.+-.+-...-
T Consensus        74 ~yfglp~l~~~i~~~~~~~~vi~l~l~~~Ay~aEi~R~gi~sVp~GQ~EAA~alG~s~~q~~r~IilPQa~r~~lP~l~n  153 (219)
T PRK09494         74 IYFALPMAFNDLRIDPFSAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRRETLRYVIGPLALRRMLPPLGN  153 (219)
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99989985467774899999999999999999999999999831879999988598988898964699879998878899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998767799999854321013665613445579999998603665006999999999999999999999999999741
Q gi|254780705|r  343 SLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       343 ~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                      -+--.+.+|+-+..+|...        +    +.-.-++..   ... ...|.-..++++-++++..+...+.++-||++
T Consensus       154 ~~i~liK~Tsl~s~Igv~E--------l----~~~a~~i~~---~t~-~~~e~~~~~a~iY~~l~~~l~~~~~~lErrl~  217 (219)
T PRK09494        154 QWIISIKDTSLFIVIGVAE--------L----TRQGQEIIA---GNF-RALEIWSAVAVIYLIITLVLSFILRRLERRMK  217 (219)
T ss_pred             HHHHHHHHHHHHHHHHHHH--------H----HHHHHHHHH---CCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999879999998999--------9----999999997---107-18999999999999999999999999998771


No 48 
>PRK10561 glycerol-3-phosphate transporter permease; Provisional
Probab=99.73  E-value=3.8e-15  Score=115.30  Aligned_cols=200  Identities=16%  Similarity=0.095  Sum_probs=142.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------H
Q ss_conf             026678999999999999999999999999986437302456789899887653369999999999998----------6
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN----------F  271 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~----------~  271 (425)
                      ..+.++..|+.-+.+++++.+++|+..|..+.+- .  |.+++.+..+-....+|+++.|+....+|-+          .
T Consensus        52 ~f~~~~~ntl~~~~~~~~~~~~l~l~lA~ll~~~-~--~~~~~~r~~~~lP~~i~~vv~~~~w~~l~~~~~G~~n~~l~~  128 (280)
T PRK10561         52 YYLDSFWTTIKFSALVTVSGLLVSLFFAALVDYV-V--RGSRFYQTLMLLPYAVAPAVAAVLWIFLFNPGRGLITHFLAE  128 (280)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-C--CHHHHHHHHHHHHHHCHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             7999999999999999999999999999998610-2--078999999998755319999999999969871089999986


Q ss_pred             HCCCCC---H---HHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             266630---0---46897-5334543668999999998511067898998707721277778839753325899999999
Q gi|254780705|r  272 FKMPRS---T---ALVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL  344 (425)
Q Consensus       272 ~~~~~~---~---~l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~  344 (425)
                      +|.+..   .   .+.+. ++..-...|+......++++++|+++.|||.-.||++||.++||++|+.+|.+....++.+
T Consensus       129 ~g~~~~~~~~~~~a~~~vi~~~vW~~~g~~~li~lagL~~Ip~~l~EAA~iDGA~~~q~f~~ItlPll~p~~~~~~i~~~  208 (280)
T PRK10561        129 FGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLVEAAAIDGAGPIRRFFKLALPLIAPVSFFLLVVNL  208 (280)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHEEEEEEHHHHHHHHHHHHHHHH
T ss_conf             57777544674899999999999999899999999998579977999999769977523312304610599999999999


Q ss_pred             HHH-HHHHHHH-HHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             998-7677999-9985432101366561344557999999860366500699999999999999999999999
Q gi|254780705|r  345 ARA-LGETAPL-LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML  415 (425)
Q Consensus       345 ~ra-~GEta~l-l~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~  415 (425)
                      ..+ .+....+ .+++         ++|...+++++.++|..+-...  +...++|.+.+++++++++..+..
T Consensus       209 i~~~~~~f~~i~~~t~---------GGP~~~t~~l~~~iy~~~f~~~--~~g~asA~svil~~i~~~~~~i~~  270 (280)
T PRK10561        209 VYAFFDTFPVIDAATS---------GGPVQATTTLIYKIYREGFTGL--DLSSSAAQSVVLMFLVIVLTVVQF  270 (280)
T ss_pred             HHHHHHHHHHHHHCCC---------CCCCCHHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999965688864368---------8885288999999999998759--961999999999999999999999


No 49 
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]
Probab=99.72  E-value=3.9e-14  Score=108.86  Aligned_cols=202  Identities=23%  Similarity=0.217  Sum_probs=145.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             02667899999999999999999999999998643730245678989988765336999999999999862666300468
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALV  281 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~  281 (425)
                      +.+..+.+|++++..++++++-+|.++|.-++.+.-++  ++.+-..+-..--+|.++. +..+......+|+-. +...
T Consensus        70 ~~~~~~~NS~iva~~~t~l~~~~~~laaYalar~~f~g--~~~l~~~~l~~~m~P~~v~-~iPl~~~~~~lgl~n-t~~g  145 (281)
T COG0395          70 GFLRYFLNSLIVAVGSTVLSLLLSSLAAYALARFRFKG--RKLLFLLLLLTLMLPAQVL-LIPLYLLMRKLGLLN-TYWG  145 (281)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH--HHHHHHHHHHHHHHHHHHH-HHHHHHHHHHCCCHH-HHHH
T ss_conf             89999998999999999999999999899999853360--9999999999998569999-998999999826610-4799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH
Q ss_conf             9753345436689999999985110678989987077212777788397533258999999999987677-999998543
Q gi|254780705|r  282 GGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET-APLLFVGMV  360 (425)
Q Consensus       282 g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt-a~ll~~~~~  360 (425)
                      -.+......+|+.+-..+.-++++|++++|||.-=|||+||.++||++|+++|++.+-.|+++--+..|. -|++++.. 
T Consensus       146 lil~~~~~~~pf~ifl~~~ff~~iP~eLeEAA~iDGas~~~if~kI~lPl~~P~iaa~aI~~fi~~WN~fl~pli~~~~-  224 (281)
T COG0395         146 LILPYLAFGLPFAIFLLRQFFRTIPKELEEAARIDGASEFQIFFKIVLPLAKPGLAAVAIFTFIGAWNEFLWPLILLSS-  224 (281)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC-
T ss_conf             9999999988899999999998698999999998289657899999987037899999999999999999999999188-


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             210136656134455799999986036-65006999999999999999999999999999
Q gi|254780705|r  361 AFVTDYPVGVTDIATAFPVQIYLWAAD-AERPFVERTFGAILLLLIFLAVINTAMLWLRN  419 (425)
Q Consensus       361 ~~~~~~p~~~~~p~~tlp~~Iy~~~~~-~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~  419 (425)
                                 +...|+|+.+....++ ....+....+++.+..+-.++..-..-+++.+
T Consensus       225 -----------~~~~tl~v~l~~~~~~~~~~~w~~~~A~~vi~~lP~li~f~~~Qr~~v~  273 (281)
T COG0395         225 -----------PNLLTLPVGLNSFGGSEGGTDWGLIMAAAVLAILPVLIVFLFFQRYFVR  273 (281)
T ss_pred             -----------CCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             -----------7642199999996343356668999999999999999999999999999


No 50 
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism]
Probab=99.72  E-value=4.2e-14  Score=108.63  Aligned_cols=209  Identities=19%  Similarity=0.150  Sum_probs=164.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             01202667899999999999999999999999998643730245678989988765336999999999999862666300
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST  278 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~  278 (425)
                      ...-++..+.-|+.++.+++++++++|+..|+.-.  .+...++......++..-++|-+|-=++.+....+.+|...+.
T Consensus        14 ~~~~ll~G~~~Tl~ls~~~~~~g~vlG~~la~~r~--s~~~~l~~~~~~Yv~~~RgtPlLvqlf~~yfg~lp~~gi~~~~   91 (222)
T COG0765          14 YLPFLLKGLLVTLLLTLLSIVLGLVLGLLLALMRL--SGNKPLRWLARAYVEIFRGTPLLVQLFFIYFGLLPLLGIELDP   91 (222)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             58999999999999999999999999999999997--7847899999998877617419999999999857984467779


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46897533454366899999999851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       279 ~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      ..+|.+++++-.=-++.-..|.++++||+...|||.+||.|+||+.++|++|+|.+-++-...--+-.-+.||+-+..+|
T Consensus        92 ~~aavial~l~~~AY~aEi~R~GI~sV~kGQ~EAA~aLGls~~q~~r~IIlPQAlr~~lP~l~n~~i~liK~TSl~svIg  171 (222)
T COG0765          92 FTAAVIALSLNSGAYLAEIVRAGIQSVPKGQWEAARALGLTYWQTMRYVILPQALRVILPPLGNQFISLIKDTSLVSVIG  171 (222)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999961888689999985999866866300235699865176899999999829999998


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             4321013665613445579999998603665006999999999999999999999999999741049
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW  425 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~w  425 (425)
                      ...        ++    .-.-+|..   ... ...|.-..++++-++++..+.....++-||+.+++
T Consensus       172 v~E--------L~----~~a~~i~~---~t~-~~~e~~~~~a~iY~~l~~~ls~~~~~lErr~~~~~  222 (222)
T COG0765         172 VVE--------LT----RAAQIIAA---RTF-RPFEVYLLAALIYLILCLPLSLLSRRLERRLARYG  222 (222)
T ss_pred             HHH--------HH----HHHHHHHH---HHC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             999--------99----99999998---665-17999999999999999999999999998852379


No 51 
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism]
Probab=99.71  E-value=3e-16  Score=122.33  Aligned_cols=151  Identities=24%  Similarity=0.400  Sum_probs=126.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             01202667899999999999999999999999998643730245678989988765336999999999999862666300
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST  278 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~  278 (425)
                      ...|.|..-+-|+-+++.|.++++.+|+..+|+..   .++++.++++...|.|..+|+-||=+-.    +.+||+   +
T Consensus        86 ~~~GlW~~tM~TLaLVl~a~~isivIGiPlGI~~a---r~~~~~~i~~PiLDlMQTmP~FVYLIPa----v~lFGl---G  155 (290)
T COG4176          86 GNLGLWDQTMQTLALVLTATLISIVIGIPLGIWAA---RSPRVYRIVRPILDLMQTMPTFVYLIPA----VMLFGL---G  155 (290)
T ss_pred             HHHCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH---CCHHHHHHHHHHHHHHHCCCHHHHHHHH----HHHCCC---C
T ss_conf             98150899999999999999999998004899985---3688999996899998605427999999----999078---8


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46897533454366899999999851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       279 ~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      ...|-++-.+..+|.++|.|.-++++||.++-||+.+.|+|+||..++|-||.|+|.|++|+-=++=-|+.=....-|+|
T Consensus       156 ~VPg~iAtvIfA~PP~IRlT~LGIrqVp~eliEA~~AFG~t~~Q~L~kVqLPlA~PtIMaGiNQtIMlALsMVVIAsMIG  235 (290)
T COG4176         156 NVPGLIATVIFAMPPMIRLTNLGIRQVPAELIEAADAFGATPRQKLFKVQLPLALPTIMAGINQTIMLALSMVVIASMIG  235 (290)
T ss_pred             CCCEEEEEEEEECCCHHHHHHCCCCCCCHHHHHHHHHCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             87634136565368158776324101789999999970898888978720743077899866799999999999999875


Q ss_pred             H
Q ss_conf             4
Q gi|254780705|r  359 M  359 (425)
Q Consensus       359 ~  359 (425)
                      .
T Consensus       236 a  236 (290)
T COG4176         236 A  236 (290)
T ss_pred             C
T ss_conf             7


No 52 
>PRK11123 arginine transporter permease subunit ArtQ; Provisional
Probab=99.71  E-value=5.5e-14  Score=107.91  Aligned_cols=204  Identities=17%  Similarity=0.142  Sum_probs=150.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHH---------
Q ss_conf             26678999999999999999999999999986437302456789899887653369999999999---998---------
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAV---LIN---------  270 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~---~~~---------  270 (425)
                      +...+.-|+.++++++++++++|+..|+.-  ..+...++......++..-++|-+|.=+|.+.-   ++.         
T Consensus         7 Ll~G~~~Tl~l~~~a~~~g~~lG~~la~~r--~s~~~~l~~~~~~yv~~~RgtP~lv~l~~~yfg~p~l~~~l~~~~~~~   84 (238)
T PRK11123          7 LASAAGMTVGLAVCALIVGLALAMFFAVWE--SAKWRPVAWPGTALVTLLRGLPEILVVLFIYFGSSQLLLTLSDGFTLN   84 (238)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999999999999999999999--888688999999999999167599999999995289887631000001


Q ss_pred             -----------HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -----------626663004689753345436689999999985110678989987077212777788397533258999
Q gi|254780705|r  271 -----------FFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG  339 (425)
Q Consensus       271 -----------~~~~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g  339 (425)
                                 ..+...+...+|.+++++..-.++.-..|.++++||+...|||.+||.|+||+.++|++|+|.+-.+-+
T Consensus        85 ~~~~~~~~~~~~~~~~~~~f~~avial~l~~~Ay~aEi~R~gi~sVp~GQ~EAa~alGms~~q~~r~IilPQa~r~~lP~  164 (238)
T PRK11123         85 LGFVQIPVQMDIENFEVSPFLCGVIALSLLYAAYASQTLRGALKAVPVGQWESGQALGLSKSAIFFRLVMPQMWRHALPG  164 (238)
T ss_pred             CHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             00111010012134564699999999999999999999999998399999999998498999999999989999999738


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999998767799999854321013665613445579999998603665006999999999999999999999999999
Q gi|254780705|r  340 STVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN  419 (425)
Q Consensus       340 ~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~  419 (425)
                      ..--+--.+.+|+-+..+|...        ++..+..+.       +...+. .|.-..++++-++++..+.....++-|
T Consensus       165 l~n~~i~liK~TSL~s~Igv~E--------l~~~a~~i~-------~~t~~~-~e~y~~~a~iYlii~~~l~~~~~~lEk  228 (238)
T PRK11123        165 LGNQWLVLLKDTALVSLISVND--------LMLQTKSIA-------TRTQEP-FTWYIIAAAIYLVITLISQYILKRIDL  228 (238)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHH-------HHHCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999849999998999--------999999999-------713456-999999999999999999999999999


Q ss_pred             HHHCC
Q ss_conf             74104
Q gi|254780705|r  420 RFKKR  424 (425)
Q Consensus       420 r~~~~  424 (425)
                      |+.|.
T Consensus       229 R~~r~  233 (238)
T PRK11123        229 RFTRF  233 (238)
T ss_pred             HHCCC
T ss_conf             85422


No 53 
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional
Probab=99.70  E-value=6.1e-14  Score=107.59  Aligned_cols=191  Identities=20%  Similarity=0.170  Sum_probs=138.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             01202667899999999999999999999999998643730245678989988765336999999999999862666300
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST  278 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~  278 (425)
                      ...+.+..+.+|++++..++++++.++..+|.-++.+..|  .++.+-..+-..--+|..+. +..+.....-+|+..+ 
T Consensus        69 ~~~~f~~~~~NSliva~~~~~~~~~~~~~aaYalsr~~f~--~~~~~~~~~l~~~~iP~~~~-~iP~~~~~~~lgl~~t-  144 (281)
T PRK10973         69 NSAPFGRMLLNSFVMAFSITVGKITVSMLSAFAIVWFRFP--LRNLFFWMIFITLMLPVEVR-IFPTVEVIANLKMLDS-  144 (281)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHCCCCC-
T ss_conf             2015999999999999999999999999999999984054--19999999999999899999-9999999999397110-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHH
Q ss_conf             46897533454366899999999851106789899870772127777883975332589999999999876779-99998
Q gi|254780705|r  279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA-PLLFV  357 (425)
Q Consensus       279 ~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta-~ll~~  357 (425)
                       . .|+.+..+..|+-+-..+.-++++|++++|||.-=|||+||+++||++|+++||+.|-.++++--+.+|.- |++++
T Consensus       145 -~-~glil~~~~~~~~i~l~~~f~~~IP~el~EAA~iDGas~~~~f~~IilPl~kP~i~tv~i~~fi~~WNef~~p~~~~  222 (281)
T PRK10973        145 -Y-AGLTLPLMASATATFLFRQFFMTLPDELVEAARIDGAGPMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPLLIT  222 (281)
T ss_pred             -H-HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHEECCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             -8-99999999999999999999976888899999981986777815410026599999999999999999798778862


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCC--CHHHHHHHHHHHHHHHH
Q ss_conf             543210136656134455799999986036650--06999999999999999
Q gi|254780705|r  358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAER--PFVERTFGAILLLLIFL  407 (425)
Q Consensus       358 ~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~--~~~~~~~aa~lvLl~~~  407 (425)
                      ..            +...++++.++....+++.  .+....+++.++.+=.+
T Consensus       223 ~~------------~~~~t~~~~l~~~~~~~~~~~~~~~~~A~~vl~~lP~l  262 (281)
T PRK10973        223 TD------------ASLGTAVAGIKGMIATGEGTTEWNQVMAAMLLTLIPPV  262 (281)
T ss_pred             CC------------CCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             78------------53011999999998546776359999999999999999


No 54 
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism]
Probab=99.68  E-value=1.2e-13  Score=105.81  Aligned_cols=196  Identities=21%  Similarity=0.326  Sum_probs=151.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986266630046
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTAL  280 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l  280 (425)
                      ++++..+.-|+.-+++...++.-+|+..|+.+.-+   ....+.++..+..+..+|.+.+-    =+++-+||....+  
T Consensus        57 g~L~~~~~~Sl~rv~~Gf~la~~~gi~lgil~g~~---~~~~~~l~P~i~~l~~iP~lA~~----Pl~ilwfG~g~~s--  127 (258)
T COG0600          57 GELFQHLLASLLRVLLGFALAAVLGIPLGILMGLS---RLLERLLDPLVQVLRPIPPLALA----PLAILWFGIGETS--  127 (258)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHCCCHHHHH----HHHHHHHHCCCCH--
T ss_conf             55999999999999999999999999999999857---99999996999999317779999----9999999079611--


Q ss_pred             HHHHHHHH-HHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89753345-43668999999998511067898998707721277778839753325899999999998767799999854
Q gi|254780705|r  281 VGGLILAL-MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM  359 (425)
Q Consensus       281 ~g~~~l~~-m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~  359 (425)
                        .+++++ .++..++.++.+++|+||++++|.+..+|+|+||.++|+.+|.|+|.|++|.=++.+-+.=-...-=|+++
T Consensus       128 --~i~i~~~~~ffpi~int~~Gvr~v~~~~~~~ar~lgas~~~~l~~v~lP~AlP~i~tgLRia~g~aw~~~VvaE~l~a  205 (258)
T COG0600         128 --KIVIAVLGAFFPILINTLDGVRSVDPDLLELARTLGASRWQILRKVILPAALPYIFTGLRIAIGLAWIGLVVAELLGA  205 (258)
T ss_pred             --HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             --999999999999999999998718999999999809897778776205300789999999999999999999999705


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             321013665613445579999998603665006999999999999999999999999999741049
Q gi|254780705|r  360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW  425 (425)
Q Consensus       360 ~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~w  425 (425)
                      .              .-+-..|.+   ..+..+.+..+++++++-++-+.++....++.||.-| |
T Consensus       206 ~--------------~GLG~~i~~---a~~~~~~~~v~a~i~~i~~lgll~d~~v~~~er~~~~-w  253 (258)
T COG0600         206 S--------------SGLGYLILD---ARNNLQTDLVFAAILVIALLGLLLDRLVRLLERRLLR-W  253 (258)
T ss_pred             C--------------CCHHHHHHH---HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-C
T ss_conf             6--------------668799999---9985167899999999999999999999999999852-1


No 55 
>COG4132 ABC-type uncharacterized transport system, permease component [General function prediction only]
Probab=99.65  E-value=1.3e-13  Score=105.47  Aligned_cols=211  Identities=21%  Similarity=0.224  Sum_probs=160.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH---HHHHHHHHHHH-----HHHHHHH-HHHHHH-
Q ss_conf             0266789999999999999999999999999864373024567898---99887653369-----9999999-999986-
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA---NINNLASVPSI-----VYGILGS-AVLINF-  271 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~---~i~~la~vPSI-----v~Gl~gl-~~~~~~-  271 (425)
                      -+..|+.-|+-+.+.+.+++..+|+..+.-+.--.+.+|+++++-.   ...|.+|||--     +.|--|+ .+|++. 
T Consensus        53 ~~l~a~~~Sikis~aSsl~G~lig~~~a~alv~~~~ps~ir~~lltfsgvaSnFaGVPLAfAFiatLG~~G~vtv~Lk~~  132 (282)
T COG4132          53 FILQAYWISIKISFASSLLGLLIGFLLAWALVLGGLPSWIRSFLLTFSGVASNFAGVPLAFAFIATLGRNGLVTVFLKTL  132 (282)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999999986799998899999999999999779478888778423145541368719999999965441699999984


Q ss_pred             HCC----CCCHHHH---HHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             266----6300468---975334543668999999998511067898998707721277778839753325899999999
Q gi|254780705|r  272 FKM----PRSTALV---GGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL  344 (425)
Q Consensus       272 ~~~----~~~~~l~---g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~  344 (425)
                      +|.    ++.+.++   -.++-...-+|.++.....+++...++.||||--||++.||--++|.+|.-.|..+.-.++=+
T Consensus       133 ~g~~~~~~~fnl~s~~GltitY~yFQIPL~vlil~PA~dgLk~ewreaa~~LGa~~~qYWrmva~PiL~PsllGt~vlLf  212 (282)
T COG4132         133 GGFNLYSTGFNLLSFFGLTITYVYFQIPLMVLILTPAFDGLKKEWREAAAILGATGWQYWRMVALPILWPSLLGTFVLLF  212 (282)
T ss_pred             CCCCEECCCCHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             27430046504888625257757886568999897666667899999999867742899999989985199988899999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99876779999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  345 ARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       345 ~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      +-|+|..|-..-..+..            -...|+.+|-+....-....+.++|.++++.+++.+.|.+.+|+|+| +.|
T Consensus       213 ANAfGA~ATayaLtgss------------lNivPI~l~AqIrGDVl~np~lg~ALa~~mi~it~v~n~~~~wlr~r-s~r  279 (282)
T COG4132         213 ANAFGAYATAYALTGSS------------LNIVPILLYAQIRGDVLHNPNLGYALAFGMIVITGVANLLYIWLRKR-SER  279 (282)
T ss_pred             HHHHHHHHHHHHHCCCC------------CCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-HHH
T ss_conf             98775778787750687------------54168999999821456895189999999999999999999999987-777


Q ss_pred             C
Q ss_conf             9
Q gi|254780705|r  425 W  425 (425)
Q Consensus       425 w  425 (425)
                      |
T Consensus       280 ~  280 (282)
T COG4132         280 W  280 (282)
T ss_pred             H
T ss_conf             3


No 56 
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional
Probab=99.62  E-value=2.1e-12  Score=97.83  Aligned_cols=155  Identities=19%  Similarity=0.156  Sum_probs=125.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHH-----H-C
Q ss_conf             2667899999999999999999999999998643730245678989988765336999999999---99986-----2-6
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA---VLINF-----F-K  273 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~---~~~~~-----~-~  273 (425)
                      ++..+..|+.+++++.++++++|+..|+..  ..+...++......++..-++|-+|-=++.+.   .+...     + +
T Consensus         8 ll~G~~~Tl~l~~~s~~~~~~lG~~la~~r--~~~~~~l~~~~~~yv~~~Rg~PlLv~lf~~yfg~~~~~~l~~~~~~~~   85 (222)
T PRK11122          8 LLKGLHTSLTLTVASLLVALVLALIFTIIL--TLKTPVLVWLVRGYITLFTGTPLLVQIFLIYYGPGQFPWLQEYPWLWH   85 (222)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             999999999999999999999999999999--879778999999999999564699999999981488877750303532


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66300468975334543668999999998511067898998707721277778839753325899999999998767799
Q gi|254780705|r  274 MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP  353 (425)
Q Consensus       274 ~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~  353 (425)
                      ...+...+|.++|++..-.++.-..|.++++||+...|||.++|.|+||+. +|++|+|.+-.+.+..--+--.+.+|+-
T Consensus        86 ~~~~~~~~~viaL~l~~~Ay~aEi~R~gi~sV~~GQ~EAA~slGls~~q~~-rIilPQa~r~~lP~l~n~~i~liK~TsL  164 (222)
T PRK11122         86 LLSQPWLCAMLALALNSAAYSTQLFYGAIRAIPEGQWQSCSALGMSKKQTL-AILLPYAFKRALSSYSNEVVLVFKGTSL  164 (222)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             022599999999999999999999999996099879999998698999999-9899999999866889999999998499


Q ss_pred             HHHHHHH
Q ss_conf             9998543
Q gi|254780705|r  354 LLFVGMV  360 (425)
Q Consensus       354 ll~~~~~  360 (425)
                      +..+|..
T Consensus       165 ~s~Igv~  171 (222)
T PRK11122        165 AYTITLM  171 (222)
T ss_pred             HHHHHHH
T ss_conf             9999899


No 57 
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism]
Probab=99.62  E-value=1.1e-12  Score=99.73  Aligned_cols=200  Identities=20%  Similarity=0.237  Sum_probs=163.3

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             101202667899999999999999999999999998643-7302456789899887653369999999999998626663
Q gi|254780705|r  198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS-HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPR  276 (425)
Q Consensus       198 ~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a-~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~  276 (425)
                      .+..-++.++.-|+.++...++++..+++.-+++.++-- |+.++...++..++.+=++|++|+++    +|+..+|.  
T Consensus        82 ~~~~~~~~~ll~Tl~ma~~gT~l~~i~aipl~flaa~n~~~~~~~~~~~r~ll~~iR~iP~iv~a~----ifv~~~g~--  155 (283)
T COG3639          82 SQLPDILTALLQTLAIAFAGTLLAAILAIPLAFLAARNLSPKRWISFPVRRLLDFIRTIPELVWAL----LFVAAFGL--  155 (283)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHCC--
T ss_conf             003157999999999999999999999999999973125864128999999999997642999999----99998578--


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00468975334543668999999998511067898998707721277778839753325899999999998767799999
Q gi|254780705|r  277 STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF  356 (425)
Q Consensus       277 ~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~  356 (425)
                       ++.+|.+++.+-+.-.......|+++++++...|+-.+.|+|+.|..++-++|..+|..++-++.-+-..+-..+.+=+
T Consensus       156 -G~~agilAl~i~t~g~LgKl~~e~iE~id~~p~e~l~a~Gas~~~~~~~~vlPqv~p~f~s~~lyrfE~n~R~a~VlG~  234 (283)
T COG3639         156 -GPFAGVLALGIYTIGILGKLYAEALESIDTGPGEALRATGASRLQLILFGVLPQIKPNFISYSLYRFESNIRAAAVLGL  234 (283)
T ss_pred             -CHHHHHHHHHHHHCHHHHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHEECHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             -5477899999980219999999999845776789999836861453311200124188999999999987578899873


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             854321013665613445579999998603665006999999999999999999999999999741
Q gi|254780705|r  357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       357 ~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                      +|+..               +-..++...+.   .+.+..+...+.++++++++..+..++|+|+-
T Consensus       235 vGaGG---------------IG~~L~~~~~~---~~~d~v~~i~l~i~v~V~~id~iS~~iR~r~~  282 (283)
T COG3639         235 VGAGG---------------IGQRLMNSISL---FQWDKVATIILPILVLVILIDLISAKIRKRLL  282 (283)
T ss_pred             CCCCH---------------HHHHHHHHHHH---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             25542---------------77999988744---04757699999999999999999999999850


No 58 
>PRK10999 malF maltose transporter membrane protein; Provisional
Probab=99.61  E-value=2e-13  Score=104.30  Aligned_cols=211  Identities=17%  Similarity=0.160  Sum_probs=146.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------H
Q ss_conf             26678999999999999999999999999986437302456789899887653369999999999998-----------6
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN-----------F  271 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~-----------~  271 (425)
                      .+..+.=|+.-+++++++.+-+|+..|+-+..  ++=|-+++.|..+=+..++|+++-++..-..|=+           .
T Consensus       283 f~~v~~WT~~fa~~sv~~~~~lGl~lAllln~--~~~rgr~~~R~l~ilP~avP~~is~lvw~~mfn~~~G~iN~~L~~l  360 (520)
T PRK10999        283 FIAIFVWTVVFSLLTVVFTVAVGMVLACLVQW--EALKGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSAL  360 (520)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHC
T ss_conf             56667667899999999999999999998287--5666076899999999899999999999984288865799999980


Q ss_pred             HCCC---CCHHHHHHHHH----HHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2666---30046897533----4543668999999998511067898998707721277778839753325899999999
Q gi|254780705|r  272 FKMP---RSTALVGGLIL----ALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL  344 (425)
Q Consensus       272 ~~~~---~~~~l~g~~~l----~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~  344 (425)
                      +|..   .+.+..+-.++    .=+..|++...+-.+|+++|+++.|||--=||++||.++||++|+.+|.+.--.|+++
T Consensus       361 ~g~~~~Wl~dp~~A~~~viiv~~W~g~p~~~i~~la~Lq~IP~~lyEAA~iDGA~~~~~f~~ITlPll~~~~~~lli~~~  440 (520)
T PRK10999        361 FGIKPAWFSDPTTARTMILIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASF  440 (520)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCHHHHEEEEECCCCHHHHHHHHHHHH
T ss_conf             59998634796999999999999951729999999987159989999998529656504514672023588999999999


Q ss_pred             HHHHHHHH-HHHHHHHHHHCCCCC--CCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99876779-999985432101366--5613445579999998603665006999999999999999999999999999
Q gi|254780705|r  345 ARALGETA-PLLFVGMVAFVTDYP--VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN  419 (425)
Q Consensus       345 ~ra~GEta-~ll~~~~~~~~~~~p--~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~  419 (425)
                      +-.+.-.. +-+||+|.   ++.+  ..+...+..|-..+|..+-+...+ .+-.+|+++..++|++++-+.++.+|+
T Consensus       441 i~~fn~F~~I~llT~GG---P~~~~~~~pag~TdiLv~y~Y~~aF~~~~~-~~~G~ASAis~iiFiiv~~~s~i~fr~  514 (520)
T PRK10999        441 AFNFNNFVLIQLLTNGG---PDMIGTTTPAGYTDLLVSYTYRIAFEGGGG-QDFGLAAAIATLIFLLVGALALLNLKA  514 (520)
T ss_pred             HHHHHCHHHHHHHCCCC---CCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99962525776434899---887778888850767999999999824776-455099999999999999999999999


No 59 
>COG1173 DppC ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=99.53  E-value=1.8e-11  Score=91.87  Aligned_cols=203  Identities=20%  Similarity=0.245  Sum_probs=140.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
                      ..|...++.-.+..+++++++++.+|..+|     |. .+++.+++.-.+|.+-++|+++.-+.    +...+|   .+.
T Consensus        82 i~G~r~SL~I~~~~~~~~~~iG~~lG~iaG-----y~-gG~vD~ilmri~di~ls~P~lll~i~----l~~~lg---~~~  148 (289)
T COG1173          82 LYGARISLLIGLLAVLISLVIGTLLGLLAG-----YF-GGWVDRVLMRITDIFLAFPSLLLAIL----LVAILG---PGL  148 (289)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HC-CCHHHHHHHHHHHHHHHCCHHHHHHH----HHHHHC---CCH
T ss_conf             999999999999999999999999999998-----80-76199999999999997659999999----999977---248


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCH-HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             689753345436689999999985110-6789899870772127777883975332589999999999876779999985
Q gi|254780705|r  280 LVGGLILALMTLPSIIIATGVALRTVP-SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       280 l~g~~~l~~m~lP~i~~~~~~al~~vp-~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      ..-.+++++.--|...|..|....++- ++|-|||..+|+++|+.+++|++|...|-++....+.++.++---+.+-|.|
T Consensus       149 ~~iiial~i~~W~~~AR~vR~~vl~~k~~eyV~AAr~~G~~~~~Ii~rhIlPn~~~~iiv~~~l~~~~aIl~ea~LSFLG  228 (289)
T COG1173         149 LNLILALALVGWPGYARIVRGQVLSLREREYVEAARALGASTLRIIFRHILPNVLPPLIVLATLDIGGAILAEAGLSFLG  228 (289)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             98999999994399999999999998776899999984999201249886230289999999999999999999999906


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      -..     |    -|..+.-..+..-...-....--....-++.++++++.+|.+...+|+.++.|
T Consensus       229 LG~-----~----pp~pswG~ml~~~~~~~~~~~~w~~l~Pgl~i~l~vl~fnllgdgLrd~~dpr  285 (289)
T COG1173         229 LGV-----Q----PPTPSWGTMLAEGRNYLLTGAWWLVLFPGLAILLTVLAFNLLGDGLRDALDPR  285 (289)
T ss_pred             CCC-----C----CCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHH
T ss_conf             889-----9----89998999999999988704859999989999999999999998899874801


No 60 
>PRK09881 ATP-dependent peptide transporter membrane subunit; Provisional
Probab=99.51  E-value=1.4e-11  Score=92.50  Aligned_cols=202  Identities=17%  Similarity=0.177  Sum_probs=142.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
                      ..|....+.-.+..+.++++++..+|+.+|.    |  .+++..++.-.+|.+-++|+++..+.-.+    .++   .+.
T Consensus        90 l~G~r~sL~i~l~~~~i~~~iG~~lG~~aGy----~--gG~~D~il~ri~Dv~~aiP~lll~i~l~~----~~g---~~~  156 (296)
T PRK09881         90 LVGSQQSILAGLVVVAIAGMIGSLLGCLSGV----L--GGRADAIIMRIMDIMLSIPSLVLTMALAA----ALG---PSL  156 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----H--CCHHHHHHHHHHHHCCCCCCHHHHHHHHH----HHC---CCH
T ss_conf             8879999999999999999999999998888----1--76076655677763015860577788876----516---751


Q ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68975334543668999999-99851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  280 LVGGLILALMTLPSIIIATG-VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       280 l~g~~~l~~m~lP~i~~~~~-~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      ....+++++...|...+.+| +.++.-.++|-|||..+|+++|+.+++|++|...|-++.-..+.++.++-.-+.+-|.|
T Consensus       157 ~~~il~i~l~~w~~~aR~vR~~~l~i~~~~yV~AAr~~G~s~~~Ii~rhiLPni~~~liv~~~~~~~~aIl~ea~LsFLG  236 (296)
T PRK09881        157 FNAMLAIAIVRIPFYVRLARGQALVVRQYTYVQAAKTFGASRWHLINWHILRNSLPPLIVQASLDIGSAILMAATLGFIG  236 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCHHHEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             68889999987999999999999999634999999983988678541427666188999999999999999999999903


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      ...   +.      |+.+.-..|..-...-...+ -....-++.+.+.++.+|.+..-+|..+.-|
T Consensus       237 lG~---~p------p~~sWG~mi~~~~~~~~~~~-w~~~~Pg~~i~l~vl~~nllgdgLrd~ldPr  292 (296)
T PRK09881        237 LGA---QQ------PSAEWGAMVANGRNYVLDQW-WYCAFPGAAILLTAVGFNLFGDGIRDLLDPK  292 (296)
T ss_pred             CCC---CC------CCCCHHHHHHHHHHHHHHCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             789---99------99859999999999998772-9999999999999999999999999981965


No 61 
>PRK10417 nikC nickel transporter permease NikC; Provisional
Probab=99.47  E-value=7e-11  Score=88.12  Aligned_cols=206  Identities=15%  Similarity=0.075  Sum_probs=140.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
                      ...++.....|+...+++.++++.+|+..++.-.-|  +++..+++.-..|.+.++|+++..++-.    ..++-   +.
T Consensus        59 ~srll~G~r~sl~i~l~~~~~~~~iG~~lG~~ag~~--gg~~d~~~~~~~d~~~~iP~lll~i~l~----~~~g~---~~  129 (272)
T PRK10417         59 FSRLMAGTRVSLGSVMACLLLVLALGLVIGGSAGLL--GGRVDQATMRVADMFMTFPTSILSFFMV----GVLGT---GL  129 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCCHHHHHHHHHHHCCCHHHHHHHHH----HHCCC---CC
T ss_conf             999999999999999999999999999999999971--8761247777788986286287788888----64489---72


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6897533454366899999999-851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  280 LVGGLILALMTLPSIIIATGVA-LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       280 l~g~~~l~~m~lP~i~~~~~~a-l~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      ..-.+++++.-.|...+..|.. ++.-.++|-|||..+|+++|+.+++|++|...|-++.-..+.++.++-.-+.+-+.|
T Consensus       130 ~~~il~l~l~~w~~~ar~iR~~~l~~~~~~yV~AAr~~G~s~~~I~~rhilPni~~~i~v~~~~~~~~~Il~~a~LsFLG  209 (272)
T PRK10417        130 TNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVFVDHLLGAVIPSLLVLATLDIGHMMLHVAGLSFLG  209 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             58999999988999999999999999989999999983958778322017676378999999999999999999999904


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      ..   .+.      |..+.-..|..-.+.-.... -..+.-++.+...++.+|.+...+|..+.-|
T Consensus       210 lG---~~p------p~~~WG~ml~~~~~~l~~~p-w~~~~P~~~i~l~vl~~nllgd~Lrd~ldP~  265 (272)
T PRK10417        210 LG---VTA------PTAEWGVMINDARQFIWTQP-LLMFWPGLALFISVMAFNLLGDALRDHLDPH  265 (272)
T ss_pred             CC---CCC------CCCCHHHHHHHHHHHHHHCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             78---999------99889999999999999784-9999999999999999999999999960966


No 62 
>PRK10913 dipeptide transporter; Provisional
Probab=99.47  E-value=3.5e-11  Score=90.00  Aligned_cols=202  Identities=17%  Similarity=0.278  Sum_probs=140.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
                      ..|....+.-.+..++++++++.++|+.+|.    |  ++++..++.-.+|.+-++|+++..+.-    ...+|   .+.
T Consensus        95 l~G~r~Sl~ial~~~~i~~~iG~~iG~iaGy----~--gG~vD~~i~r~~di~~aiP~lll~l~l----~~~~g---~~~  161 (300)
T PRK10913         95 MYGARLSLLVGCLVVVLSLVMGVILGLIAGY----F--GGLVDNIIMRVVDIMLALPSLLLALVL----VAIFG---PSI  161 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----C--CCCHHHHHHHHHHHHHCCCHHHHHHHH----HHCCC---CCH
T ss_conf             9999999999999999999999999999980----3--884078887776666068848776875----53048---746


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6897533454366899999999-851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  280 LVGGLILALMTLPSIIIATGVA-LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       280 l~g~~~l~~m~lP~i~~~~~~a-l~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      ....+++++...|...|.+|.. ++.-.++|-|||..+|+|+|+.+++|++|...|-++.-..+.++.++-.-+.+-|.|
T Consensus       162 ~~~~lal~~~~w~~~aR~vR~~vl~~~~~~yV~AAr~~G~s~~rIi~~hIlPnv~~~iiv~~~l~~~~aIl~ea~LsFLG  241 (300)
T PRK10913        162 GNAALALTFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLGFSNAILDMAALGFLG  241 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             89999999998999999999999998615899999984999747864334266588999999999999999999999924


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      -.   .+.|      ..+.-..|..-...-...+ -....-++.+.+.++.+|.+..-+|+-+.-|
T Consensus       242 lG---~~pp------~~sWG~ml~~~~~~~~~~p-w~~~~Pg~~i~l~vl~~nllgdgLrdaldPr  297 (300)
T PRK10913        242 MG---AQPP------TPEWGTMLSDVLQFAQSAW-WVVTFPGLAILLTVLAFNLMGDGLRDALDPK  297 (300)
T ss_pred             CC---CCCC------CCCHHHHHHHHHHHHHHCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             78---9999------8839999999999998483-9999999999999999999999999871910


No 63 
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism]
Probab=99.42  E-value=4.9e-10  Score=82.73  Aligned_cols=199  Identities=20%  Similarity=0.226  Sum_probs=135.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             66789999999999999999999999999864373024567898998876533699999999999986266630046897
Q gi|254780705|r  204 GVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG  283 (425)
Q Consensus       204 ~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~g~  283 (425)
                      +.=+.+|++++++++++.+-+...+|.-.+.|.-++|-....  ..-.+.-+|. +.++-.+.++...+|+-.+  + ++
T Consensus        72 ~~W~~Nsliva~~t~~i~v~~~~~~aYafSR~rF~GRk~~L~--~~Li~qMfP~-~~aliAlY~l~~~lgllnt--~-~g  145 (282)
T COG3833          72 LLWLWNSLIVALITAAITVALVTLAAYAFSRYRFKGRKYLLK--FFLILQMFPG-VAALIALYVLLKLLGLLNT--L-WG  145 (282)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH--HHHHHHHHHH-HHHHHHHHHHHHHHCCHHH--H-HH
T ss_conf             999999999999999999999999898899862655899999--9999999899-9999999999999657116--7-89


Q ss_pred             HHHHH--HHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             53345--4366899999999851106789899870772127777883975332589999999999876779999985432
Q gi|254780705|r  284 LILAL--MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA  361 (425)
Q Consensus       284 ~~l~~--m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~  361 (425)
                      ++++-  =..|.=....+.-++++|+|++|||.==|||+||++++|+||+++|.+.--.+++|--..||..-.-++    
T Consensus       146 Lil~Y~gG~ip~n~~l~Kgy~DTIP~sldEaA~iDGAt~~q~F~~IvLPLs~P~lavvaL~~FiGp~~dfiLa~~l----  221 (282)
T COG3833         146 LILAYLGGAIPMNTWLIKGYFDTIPKSLDEAAKIDGATRFQIFRRILLPLSKPILAVVALLAFIGPFGDFILASLL----  221 (282)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----
T ss_conf             9999964732688999984450389567999865485068999999986000599999999987577999999999----


Q ss_pred             HCCCCCCCCCCH-HHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             101366561344-557999999860366500-69999999999999999999999999997
Q gi|254780705|r  362 FVTDYPVGVTDI-ATAFPVQIYLWAADAERP-FVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       362 ~~~~~p~~~~~p-~~tlp~~Iy~~~~~~~~~-~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                              +.+| ..|+++-+|.....+... +..-++||.+.-+=++++.-+.-+++++-
T Consensus       222 --------L~~~~~~TlavGL~~~~~~~~~~~~~~FAAgAvL~alPi~iLF~~lQk~~VsG  274 (282)
T COG3833         222 --------LRDPENYTLAVGLQSFLNGPQNTNWGLFAAGAVLIALPITILFLVLQKYLVSG  274 (282)
T ss_pred             --------HCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCC
T ss_conf             --------74815542599999993672102699999999998641999999999999723


No 64 
>PRK10352 nickel transporter permease NikB; Provisional
Probab=99.42  E-value=5e-10  Score=82.64  Aligned_cols=217  Identities=14%  Similarity=0.066  Sum_probs=159.4

Q ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             23213443211012026678999999999999999999999999986437302456789899887653369999999999
Q gi|254780705|r  188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAV  267 (425)
Q Consensus       188 ~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~  267 (425)
                      +|.++..+..|-..-|...+--|+.+++.++++++.+|+..|++-.-+ ++++..+.+....-...++|+-+.|+.-+.+
T Consensus        79 D~G~S~~~~~pV~~~I~~~lp~Tl~L~~~a~~l~~~igi~lGi~aa~~-~~~~~D~~~~~~~~~~~siP~F~la~lli~~  157 (314)
T PRK10352         79 DFGISFATQRPVLDDMLNFLPATLELAGAALVLILLTSVPLGIWAARH-RDRLPDFAVRFIAFLGVSMPNFWLAFLLVMA  157 (314)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             578766368860898887637889999999999999985999998720-7972101310589987873199999999999


Q ss_pred             HHHHHCCC---CC----HHHHHHHHHHHHHHHHHHHHHHHHH-HHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99862666---30----0468975334543668999999998-5110678989987077212777788397533258999
Q gi|254780705|r  268 LINFFKMP---RS----TALVGGLILALMTLPSIIIATGVAL-RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG  339 (425)
Q Consensus       268 ~~~~~~~~---~~----~~l~g~~~l~~m~lP~i~~~~~~al-~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g  339 (425)
                      |...+++.   +.    ..+.=.+++++...+...+.+|+++ +...++|-+.|.+-|.++++.+++|++|.|.+-++|.
T Consensus       158 fa~~l~~~P~~g~~~~~~liLP~l~l~l~~~a~~~r~~R~~~~e~l~~dyv~~ArakGls~~~i~~rh~lrnal~P~it~  237 (314)
T PRK10352        158 FSVYLQWLPAMGYGGWQHIILPAVSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLSDRQVERRHILRNASLPMITA  237 (314)
T ss_pred             HHHHCCCCCCCCCCCHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEHHHHHHHHHHHHHHH
T ss_conf             99964767876778336541119999999999999999999999863299999998698931360865287429889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999998767799999854321013665613445579999998603665006999999999999999999999999999
Q gi|254780705|r  340 STVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN  419 (425)
Q Consensus       340 ~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~  419 (425)
                      .-+.++..+|-+..+=-      +-++|+        +-..+++-..+.   ++....+..++.-++++..|+++..+-.
T Consensus       238 ~~~~~~~ll~GavivE~------iF~~pG--------lG~ll~~Ai~~r---D~p~v~g~~l~~~~~~v~~nli~Dily~  300 (314)
T PRK10352        238 VGMHIGELIGGTMIIEN------IFAWPG--------VGRYAVSAIFNR---DYPVIQCFTLMMVVVFVVCNLIVDLLNA  300 (314)
T ss_pred             HHHHHHHHHCCHHHEEH------HHCCCC--------HHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999998477610018------754767--------599999999813---8899999999999999999999999999


Q ss_pred             HHH
Q ss_conf             741
Q gi|254780705|r  420 RFK  422 (425)
Q Consensus       420 r~~  422 (425)
                      ...
T Consensus       301 ~lD  303 (314)
T PRK10352        301 ALD  303 (314)
T ss_pred             HCC
T ss_conf             648


No 65 
>PRK10914 dipeptide transporter permease DppB; Provisional
Probab=99.42  E-value=2.4e-09  Score=78.38  Aligned_cols=217  Identities=13%  Similarity=0.130  Sum_probs=152.7

Q ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             23213443211012026678999999999999999999999999986437302456789899887653369999999999
Q gi|254780705|r  188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAV  267 (425)
Q Consensus       188 ~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~  267 (425)
                      +|.++..++.|-..=|..++-.|+.+.+.++++++.+|+..|++-.-+ +.+++.+.+....-...++|+-+.|+.-+.+
T Consensus        77 d~G~S~~~~~pV~~~i~~~lp~Tl~L~~~a~il~~~igi~lGi~aa~~-~~~~~D~~~~~~~~~~~siP~F~lallli~i  155 (339)
T PRK10914         77 DLGISLKSRIPVWEEFVPRFKATLELGVCAMIFATAVGIPVGVLAAVK-RGSIFDHTAVGLALTGYSMPIFWWGMMLIML  155 (339)
T ss_pred             CCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             888734268836999987272589999999999999999999999985-2751113678889861230699999999999


Q ss_pred             HHHHHCCC---C----------CH-------------------------HHHHHHHHHHHHHHHHHHHHHHHH-HHCHHH
Q ss_conf             99862666---3----------00-------------------------468975334543668999999998-511067
Q gi|254780705|r  268 LINFFKMP---R----------ST-------------------------ALVGGLILALMTLPSIIIATGVAL-RTVPSS  308 (425)
Q Consensus       268 ~~~~~~~~---~----------~~-------------------------~l~g~~~l~~m~lP~i~~~~~~al-~~vp~~  308 (425)
                      |...+++.   +          ..                         .+.=.++|++..++...+.+|+++ +...++
T Consensus       156 f~~~l~~~P~~G~~~~~~~~~~~~p~~g~~~~~~~~~g~~~~~~~~l~hliLP~l~L~l~~~a~~~r~~R~~~~~~l~~d  235 (339)
T PRK10914        156 VSVHWNLTPVSGRVSDMVFLDDSNPLTGFMLIDTAIWGEDGNFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGED  235 (339)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99995747776767653124666665541001114204511378899999999999999999999999999999998349


Q ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             89899870772127777883975332589999999999876779999985432101366561344557999999860366
Q gi|254780705|r  309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADA  388 (425)
Q Consensus       309 ~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~  388 (425)
                      |-+.|.+-|.++++.+++|++|.|.+-++|..-+.++..+|-+..+=.+      -++|+        +-..+++-..+.
T Consensus       236 yV~~ArakGl~~~~i~~~h~lrnal~P~it~~g~~~~~ll~GsvivE~v------F~~pG--------iG~l~~~Ai~~r  301 (339)
T PRK10914        236 YIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETI------FSWPG--------LGRWLIDALQRR  301 (339)
T ss_pred             HHHHHHHCCCCHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HCCCC--------HHHHHHHHHHHC
T ss_conf             9999998594933140498398609989999999999999769998698------67757--------699999999835


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5006999999999999999999999999999741
Q gi|254780705|r  389 ERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       389 ~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                         ++....+..++.-+++++.|+++..+-....
T Consensus       302 ---D~pvi~g~~l~~~~~~i~~nli~Dil~~~lD  332 (339)
T PRK10914        302 ---DYPVVQGGVLLVATMIILVNLLVDLLYGVVN  332 (339)
T ss_pred             ---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             ---8899999999999999999999999998628


No 66 
>COG4215 ArtQ ABC-type arginine transport system, permease component [Amino acid transport and metabolism]
Probab=99.39  E-value=2.9e-10  Score=84.16  Aligned_cols=205  Identities=22%  Similarity=0.268  Sum_probs=143.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHH----H-
Q ss_conf             202667899999999999999999999999998643730245678989988765336999999---99999986----2-
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGIL---GSAVLINF----F-  272 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~---gl~~~~~~----~-  272 (425)
                      .-+..+-.-|+-++..++++++.+|...|..  |-++....+..-+....+.-|+|-++.=++   |....++.    + 
T Consensus         8 ~~l~~ga~~Tl~lAv~sl~lgl~lGl~~A~~--kls~~r~lr~~~~~YtTv~RGvPELl~illiyfG~~~lL~~~~~~~~   85 (230)
T COG4215           8 DELLQGALVTLELAVCSLILGLLLGLLGALG--KLSKNRLLRLLGNVYTTVIRGVPELLLILLIYFGGQILLNTLADVTG   85 (230)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999999999999999999--86666067897543535542671999999999830999999998730


Q ss_pred             --C--CCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             --6--663004-68975334543668999999998511067898998707721277778839753325899999999998
Q gi|254780705|r  273 --K--MPRSTA-LVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA  347 (425)
Q Consensus       273 --~--~~~~~~-l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra  347 (425)
                        |  .-..++ .+|.++|++.-=.|..-+.|.|+++||+...||+.++|.||||++++|++|..++--+-|.---+--.
T Consensus        86 ~~g~~~idi~~FvaGviaL~~i~gAYatEt~RGA~~AVp~GQ~EAa~AlGms~~~~frrI~lPqm~R~ALPGlgN~Wlvl  165 (230)
T COG4215          86 ALGVGFIDISPFVAGVIALGLIFGAYATETLRGAFKAVPKGQIEAARALGLSRSQTFRRIVLPQMWRHALPGLGNLWLVL  165 (230)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHH
T ss_conf             14777455674999999999999999899999999728965188999809987688999998889998278853026777


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             7677999998543210136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       348 ~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
                      +.+||-+-.+|-+.             .....++.  +.+....| .--.+++++-+.+.++-|..-.++-||+.|
T Consensus       166 lKDTALVSvIGl~d-------------l~~~a~~a--a~~Tk~pF-tfy~~aa~iYL~~t~vS~~~l~~lErr~~r  225 (230)
T COG4215         166 LKDTALVSLIGLND-------------LMRQTQLA--AGSTKEPF-TFYIVAALIYLVITLVSNVVLLFLERRASR  225 (230)
T ss_pred             HHCCHHHHHHCHHH-------------HHHHHHHH--HCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             63003542115999-------------99999987--34555543-999999999999999999999999998542


No 67 
>PRK09471 oppB oligopeptide transporter permease; Reviewed
Probab=99.35  E-value=7.2e-09  Score=75.30  Aligned_cols=207  Identities=13%  Similarity=0.047  Sum_probs=149.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---
Q ss_conf             10120266789999999999999999999999999864373024567898998876533699999999999986266---
Q gi|254780705|r  198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM---  274 (425)
Q Consensus       198 ~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~---  274 (425)
                      |-.-=|..++--|+.+++.|+++++++|+..|++-.-. +++++.+.+....-...++|+-+.|++-+.+|...+++   
T Consensus        85 ~V~~~i~~~lp~Tl~L~~~a~~i~~~lgi~lGi~aa~~-~~~~~D~~~~~~~~~~~siP~F~la~lli~iF~~~l~~~P~  163 (306)
T PRK09471         85 SVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALK-QNTKWDYTVMGFAMTGVVIPSFVVAPLLVMIFAIILHWLPG  163 (306)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             88999998889999999999999999999999999983-47516199999999999989999999998899972176377


Q ss_pred             CCC---H---HHHHHHHHHHHHHHHHHHHHHHHH-HHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             630---0---468975334543668999999998-511067898998707721277778839753325899999999998
Q gi|254780705|r  275 PRS---T---ALVGGLILALMTLPSIIIATGVAL-RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA  347 (425)
Q Consensus       275 ~~~---~---~l~g~~~l~~m~lP~i~~~~~~al-~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra  347 (425)
                      .+.   .   ..--.+++++...+...+.+|+++ +...++|-+.|.+-|.++++.+++|++|.|.+-++|..-+.++-.
T Consensus       164 ~g~~~~~~~~liLP~~~l~l~~~~~~~r~~R~~~~~~l~~dyV~~ArakGl~~~~i~~rh~lrnal~P~it~~~~~~~~l  243 (306)
T PRK09471        164 GGWNGGALKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGI  243 (306)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88875207887536999999999999999999999998779999999869984007300129842999999999999998


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             767799999854321013665613445579999998603665006999999999999999999999999999741
Q gi|254780705|r  348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       348 ~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                      +|-+..+=-      +-++|+        +-..++.-..+.   +....-+..++.-++.+..|.++..+-.-.+
T Consensus       244 l~GsvivE~------iF~~PG--------iG~l~~~Ai~~~---D~p~v~g~~l~~a~~~i~~nll~Dil~~~lD  301 (306)
T PRK09471        244 ITGSMVIET------IFGLPG--------IGQLFVNGALNR---DYSLVLSLTILVGALTILFNAIVDVLYAVID  301 (306)
T ss_pred             HCCHHHHHH------HHCCCC--------HHHHHHHHHHHC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             458712109------864767--------599999999804---9899999999999999999999999999729


No 68 
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=99.34  E-value=1.1e-08  Score=74.16  Aligned_cols=216  Identities=18%  Similarity=0.157  Sum_probs=155.2

Q ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             32134432110120266789999999999999999999999999864373024567898998876533699999999999
Q gi|254780705|r  189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL  268 (425)
Q Consensus       189 f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~  268 (425)
                      |.++--+..|-..=|...+-.|+.+++.++++++.+|+..|++-.-+ ++++..+.++...-...++|+-+.|+.-..+|
T Consensus        77 fG~S~~~~~pV~~~I~~~lp~Tl~L~~~a~iis~~lgi~LG~~aa~~-~~~~~D~~~~~~~~~~~siP~F~~~~lli~~f  155 (317)
T COG0601          77 FGTSFVYKRPVADLILERLPATLELALVALILAVLLGIPLGILAALK-RGSWIDRLLRVLSLLGISIPSFWLGLLLILLF  155 (317)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87335679968999998849999999999999999999999999944-89759999999999999602999999999999


Q ss_pred             HHHHCC---CC--------------CHHHHHHHHHHHHHHHHHHHHHHHHH-HHCHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             986266---63--------------00468975334543668999999998-5110678989987077212777788397
Q gi|254780705|r  269 INFFKM---PR--------------STALVGGLILALMTLPSIIIATGVAL-RTVPSSIRSAALGLGASKVQTVFHHVLP  330 (425)
Q Consensus       269 ~~~~~~---~~--------------~~~l~g~~~l~~m~lP~i~~~~~~al-~~vp~~~~eaa~~LGas~~~~~~~v~lp  330 (425)
                      ...+++   .+              ...+.-.++|++..++.+.+.+|+++ +...++|-+.|.+-|.++++.++||.+|
T Consensus       156 ~~~l~~~P~~g~~~~~~~~~~~~~~~h~iLP~~~L~~~~~a~~~r~~R~~~~e~l~~dyV~~AraKGl~~~~i~~kH~lr  235 (317)
T COG0601         156 SVKLGWLPVGGRGSAGSWDSFLDALKHLILPALTLGLVSLAGIARLTRSSMLEVLNQDYVRTARAKGLSERRILFKHALR  235 (317)
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEHHHHHHH
T ss_conf             99967689888788651567999999999999999999999999999999999986689999998799925103986337


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             53325899999999998767799999854321013665613445579999998603665006999999999999999999
Q gi|254780705|r  331 LAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI  410 (425)
Q Consensus       331 ~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~  410 (425)
                      .|.--++|..-+.++-.+|-+..+=      .+-++|+        +-...++-..+.   ++....+..++..++.+..
T Consensus       236 Na~iP~vt~~~~~~~~ll~GavivE------~iF~~pG--------iG~l~~~Ai~~~---D~p~i~g~~~~~~~~~i~~  298 (317)
T COG0601         236 NALLPVITVLGLQLGGLLGGAVVVE------TVFSWPG--------LGRLLVDAILNR---DYPVVQGIVLVIALLVILG  298 (317)
T ss_pred             HHHHHHHHHHHHHHHHHHHCHHHHH------HHCCCCC--------HHHHHHHHHHCC---CHHHHHHHHHHHHHHHHHH
T ss_conf             6488899999999999984687873------5408778--------499999999824---8499999999999999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999741
Q gi|254780705|r  411 NTAMLWLRNRFK  422 (425)
Q Consensus       411 n~~a~~lr~r~~  422 (425)
                      |.++..+-.-..
T Consensus       299 nli~Dily~~lD  310 (317)
T COG0601         299 NLLVDILYALLD  310 (317)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999999649


No 69 
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism]
Probab=99.23  E-value=5e-09  Score=76.31  Aligned_cols=207  Identities=18%  Similarity=0.126  Sum_probs=126.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------HC
Q ss_conf             66789999999999999999999999999864373024567898998876533699999999999986----------26
Q gi|254780705|r  204 GVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF----------FK  273 (425)
Q Consensus       204 ~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~----------~~  273 (425)
                      +--+-+|+....+-+++++|+.+..|+-++|.. +.++++.++..+-..-=+-=+|..-+-..++..-          +|
T Consensus        78 f~i~rNTl~~s~~~li~gf~~pI~lAillnElr-~~~~kk~~QT~~y~PhFlSWVVv~~~v~~fls~d~GiiN~ll~~~g  156 (309)
T COG4209          78 FIILRNTLLYSVLFLILGFPVPIILAILLNELR-NKVFKKVVQTISYLPHFLSWVVVSGFVFAFLSIDGGIINQLLMSLG  156 (309)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHCHHEEEHHHHHHHHHHHCCCCCHHHHHHHHCC
T ss_conf             999999999999999995379999999999998-7778888766333000210030565788763667518999999828


Q ss_pred             -C-------CCCHHHHHHHHHH-H-HHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -6-------6300468975334-5-4366899999999851106789899870772127777883975332589999999
Q gi|254780705|r  274 -M-------PRSTALVGGLILA-L-MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS  343 (425)
Q Consensus       274 -~-------~~~~~l~g~~~l~-~-m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~  343 (425)
                       .       +...+.  -+..+ + =-.-+-.+.--+++..|+|++-|||.-=||||||.++||++|..+|-|+-=.||.
T Consensus       157 ~~pi~fl~~~~wf~~--i~i~~~vWK~~G~~SIiylAai~~Idpt~YEAA~vDGA~rwqqiwhITlP~i~P~ivIllIL~  234 (309)
T COG4209         157 GDPINFLTNPDWFRP--IIIFSSVWKGAGWNSIIYLAAIAGIDPTLYEAAMVDGASRWQQIWHITLPAIRPLIVILLILN  234 (309)
T ss_pred             CCCEEHHCCCCCHHH--HHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHCCCHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             983102158860267--887898884236788999999972799999999805488778888211032314999999998


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCC-CCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999876779999985432101366561-3445579999998603665006999999999999999999999999999741
Q gi|254780705|r  344 LARALGETAPLLFVGMVAFVTDYPVGV-TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       344 ~~ra~GEta~ll~~~~~~~~~~~p~~~-~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                      +|..+.-        +-...-.+|.+. .+-++.+.+.+|....  ..++...+.|+++-=-++.+++-.+|.++.||+.
T Consensus       235 iG~i~~~--------gFe~~yll~~~~~~~v~~vldtYVy~~gl--~~Gd~s~sTAaGlf~svVg~iLl~~aN~iakr~~  304 (309)
T COG4209         235 IGNIFNA--------GFELFYLLPNPSGYDVTEVLDTYVYRGGL--VTGDYSYSTAAGLFQSVVGFILLFLANRIAKRFD  304 (309)
T ss_pred             HHHHHHC--------CHHHEEEECCCCCCCHHHHHHHHHHHHCC--CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             5237653--------72560660576687489899999998101--3575118999999999999999999999999706


Q ss_pred             C
Q ss_conf             0
Q gi|254780705|r  423 K  423 (425)
Q Consensus       423 ~  423 (425)
                      .
T Consensus       305 ~  305 (309)
T COG4209         305 N  305 (309)
T ss_pred             C
T ss_conf             2


No 70 
>TIGR03004 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, permease protein EhuC; InterPro: IPR014342   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    Members of this entry are presumed to act as permease subunits of ectoine ABC transporters. Operons containing this gene also contain other genes of the ABC transporter and are typically found next to either ectoine utilization or ectoine biosynthesis operons. Permease subunits EhuC and EhuD are homologues..
Probab=98.91  E-value=1.2e-06  Score=61.13  Aligned_cols=196  Identities=17%  Similarity=0.157  Sum_probs=134.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCHHHHHHHH
Q ss_conf             9999999999999999999999999864373024567898998876533699999999999986--26663004689753
Q gi|254780705|r  208 VGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF--FKMPRSTALVGGLI  285 (425)
Q Consensus       208 ~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~--~~~~~~~~l~g~~~  285 (425)
                      +-|+-+++.+.++++.++..+|+---|  .-..++.+.-..+++.=|. |+..=||++.+-+|+  +|+..+-.-+|.++
T Consensus        12 wVT~~iTl~gs~la~V~Af~aglgr~s--~~~~lr~~a~~YiE~FRGT-SllVQLFW~yfvLPlPP~gl~l~P~t~gv~~   88 (216)
T TIGR03004        12 WVTLQITLAGSVLAVVVAFLAGLGRLS--RFRILRALAVVYIEVFRGT-SLLVQLFWLYFVLPLPPIGLELDPLTVGVLA   88 (216)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
T ss_conf             999999999999999999999887523--5358877777875442037-8999999999972579998402518999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             34543668999999998511067898998707721277778839753325899999999998767799999854321013
Q gi|254780705|r  286 LALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD  365 (425)
Q Consensus       286 l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~  365 (425)
                      |++-+=-|=.-..|.|+++|-++.+||+.||-.+|+|+++||+||+|.+..+..----.---+..|+-+-+|.-.    |
T Consensus        89 Lglh~GaYGAEivRGA~~sv~~~Q~EAc~ALNftrfq~~rrI~LPQAl~~mmp~fgNlaIElLK~tslVSLIsla----D  164 (216)
T TIGR03004        89 LGLHVGAYGAEIVRGAVKSVSKEQLEACIALNFTRFQALRRIVLPQALVEMMPAFGNLAIELLKLTSLVSLISLA----D  164 (216)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHH----H
T ss_conf             997326501688888899743658999998415367799876326799974386615899999878999999998----6


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHC
Q ss_conf             66561344557999999860366500699999999999-99999999999999997410
Q gi|254780705|r  366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL-LIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       366 ~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvL-l~~~~~~n~~a~~lr~r~~~  423 (425)
                      +         |-..|--.   + ....--+-++.++.+ .++-..+|..-+++-||.+|
T Consensus       165 l---------tF~Aq~~r---~-~T~~tl~~fa~~LL~YFvMa~~i~l~~R~lEr~v~R  210 (216)
T TIGR03004       165 L---------TFRAQSVR---A-LTLDTLKVFALILLLYFVMALIISLAMRVLERRVAR  210 (216)
T ss_pred             H---------HHHHHHHH---H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             7---------69999999---8-410027999999999999999999999988666406


No 71 
>COG4160 ArtM ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism]
Probab=98.88  E-value=1.8e-08  Score=72.81  Aligned_cols=129  Identities=22%  Similarity=0.235  Sum_probs=92.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHH------HCCC
Q ss_conf             678999999999999999999999999986437302456789899887653369999999---9999986------2666
Q gi|254780705|r  205 VAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILG---SAVLINF------FKMP  275 (425)
Q Consensus       205 ~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~g---l~~~~~~------~~~~  275 (425)
                      .-+.-|+.++.+++++++.+++..|+-..  ..+.+++-.....+-+.-|.|=.|-=++-   ++-|-..      ..+.
T Consensus        15 ~Gl~~TL~Ll~~S~~iG~~LAvpla~~r~--s~~~~v~~~a~~y~~~fRGTPLLvQlfLiYyGlgqf~~ir~s~~lW~~l   92 (228)
T COG4160          15 SGLATTLWLLIISLVIGFVLALPLALARV--SKNRWVSWPARAYTYVFRGTPLLVQLFLIYYGLGQFEWIRESIFLWPFL   92 (228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCCEEHHHHHEEEEEECCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             31999999999999999999999999997--2885001112501456538749999999994643146888406658998


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
Q ss_conf             300468975334543668999999998511067898998707721277778839753325
Q gi|254780705|r  276 RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPA  335 (425)
Q Consensus       276 ~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pg  335 (425)
                      +.....|.+++++=+--+..-..+.++++||....|||-++|.||+|++++|+||.|..-
T Consensus        93 r~~w~Ca~lAltLNtaAY~~Ei~rGAi~avP~Gq~Eaa~AlGmsr~~~~r~IiLP~Alr~  152 (228)
T COG4160          93 REAWFCAVLALTLNTAAYTTEIFRGAIRAVPRGQWEAARALGMSRFKTLRRIILPSALRR  152 (228)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             252889999999977999999998898528941789999819629999999997799998


No 72 
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry represents thiamine ABC transporter, permease protein in bacteria, believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane. The protein belongs to the larger ABC transport system. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate (TMP) or thiamine pyrophosphate (TPP).   Thiamine pyrophosphate (TPP)1 is a required cofactor synthesized de novo in Salmonella typhimurium. The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and -ketoglutarate dehydrogenase (1.2.4.2 from EC). Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism.; GO: 0005215 transporter activity, 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=98.81  E-value=2.2e-06  Score=59.50  Aligned_cols=268  Identities=16%  Similarity=0.122  Sum_probs=178.3

Q ss_pred             CCCCHHHHHHHHHHHCCHHHHHHHHHHHHCHHHCCCE-EEEEEEECCCCHHHHCCCCCCCCHHCCCCHHHHHH-------
Q ss_conf             6666034898998730016899999974063215974-78999704530233034556530000599999999-------
Q gi|254780705|r  100 SDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKT-VEVSLLASANIDSALKGYLYSPANVHRMSDYQWKW-------  171 (425)
Q Consensus       100 ~~~~r~~kr~l~~liS~~a~~~Lrd~v~~np~liG~t-~~~~llAsddvD~~~KG~i~r~e~~rrisd~ql~~-------  171 (425)
                      .|..|.-.=.+-.++---.-.-+-+.+-+.. ..|.+ .+.|.--+|+             ..-||-|..+-.       
T Consensus       231 yD~~~AAllAlLQ~V~CL~L~~L~~RlS~~~-~~G~~~~~~W~~P~~~-------------~~~~I~~~~~~~~~~llLl  296 (519)
T TIGR01253       231 YDLAKAALLALLQFVFCLILVLLSSRLSKAI-ANGLSLLNIWFDPDDK-------------LAVKIFDILLLLLALLLLL  296 (519)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCHHCCCCCCCCC-------------HHHHHHHHHHHHHHHHHHH
T ss_conf             6846899999999999999999988787640-5775201145588752-------------2789999999999999986


Q ss_pred             -------HHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCHHHH
Q ss_conf             -------99998745664112202321344321101202667899999999999999999999999998643--730245
Q gi|254780705|r  172 -------FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS--HKGFFS  242 (425)
Q Consensus       172 -------~d~L~~~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a--~~~~~~  242 (425)
                             +|.+.++...+-.              .+.-.|-|+.-|+-++..+-++++-+.+.-=.--.|..  .+.+..
T Consensus       297 ~P~L~~~~~~~~s~~L~~V~--------------~~~~LW~AL~~SL~IA~~~~~L~~~l~~~LL~~SR~L~~~~~~~~~  362 (519)
T TIGR01253       297 SPLLAVLVDALSSRNLLEVL--------------ANSVLWRALGYSLRIALLAALLALVLAIALLLLSRRLRALQKQKIS  362 (519)
T ss_pred             HHHHHHHHHHHHHHHHHHHH--------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             47999999753123468887--------------3247899998899999999999999999999875889999878898


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHH
Q ss_conf             6789899887653369999999999998-626663004689753345436689999999985110678989987077212
Q gi|254780705|r  243 SFVQANINNLASVPSIVYGILGSAVLIN-FFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKV  321 (425)
Q Consensus       243 ~~i~~~i~~la~vPSIv~Gl~gl~~~~~-~~~~~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~  321 (425)
                      ++++..==+.-++|.||... |+..+++ ..+.+.+.-..-..+=++|.+|++.+..++-++..-..|+.=..+||...|
T Consensus       363 Q~~~~~GM~ILA~P~~VLA~-GlFLLL~~~~~~~~~~~~IV~F~NAL~A~Py~L~~L~~P~~~~~~~Y~~LC~SLGI~GW  441 (519)
T TIGR01253       363 QVLINAGMLILAIPILVLAT-GLFLLLNDRIFLNIDLDIIVVFTNALSAIPYVLKVLEAPFRDITARYENLCNSLGIVGW  441 (519)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCH
T ss_conf             89998428999977999999-89998613467775420101345477763599998405157889999875532173300


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             77778839753325899999999998767799999854321013665613445579999998603665006999999999
Q gi|254780705|r  322 QTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAIL  401 (425)
Q Consensus       322 ~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~l  401 (425)
                      |.+.-|-+..-+.-.-.+.-+|.+-.+||...+-+=|.            |-.+|||...|++.++-...+   ++-++.
T Consensus       442 ~Rl~~~E~~~L~~PL~~AlAl~~~LS~GDF~~~ALFGN------------~~F~~LP~~LYQQ~G~YR~QD---~AVTA~  506 (519)
T TIGR01253       442 SRLKLVELKALKAPLAYALALALVLSLGDFTVVALFGN------------DDFRSLPFLLYQQLGSYRSQD---AAVTAL  506 (519)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEECC------------CCCCHHHHHHHHHHCCCCCHH---HHHHHH
T ss_conf             47788879998779999999999985211562001037------------532113789998723533613---899999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999999
Q gi|254780705|r  402 LLLIFLAVIN  411 (425)
Q Consensus       402 vLl~~~~~~n  411 (425)
                      +|+.++..+.
T Consensus       507 ILLLLC~~LF  516 (519)
T TIGR01253       507 ILLLLCFLLF  516 (519)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999998


No 73 
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769    Bacterial binding protein-dependent transport systems ,  are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system. The integral inner-membrane proteins translocate the substrate across the membrane. It has been shown ,  that most of these proteins contain a conserved region located about 80 to 100 residues from their C-terminal extremity. This region seems  to be located in a cytoplasmic loop between two transmembrane domains. Apart from the conserved region, the sequence of these proteins is quite divergent, and they have a variable number of transmembrane helices.    These proteins represent a family of phosphonate uptake transporters., probably responsible for the transport of phosphonate across the inner membrane. ; GO: 0015604 phosphonate transmembrane transporter activity, 0015716 phosphonate transport, 0005887 integral to plasma membrane.
Probab=98.81  E-value=8.1e-07  Score=62.21  Aligned_cols=181  Identities=17%  Similarity=0.240  Sum_probs=134.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             99999999999999999999999864373024567898998876533699999999999986266630046897533454
Q gi|254780705|r  210 SLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM  289 (425)
Q Consensus       210 Tl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~g~~~l~~m  289 (425)
                      ..+.+.++..+++|+|.++|==|   .|+-|.++.++=..|.+-++|-+|+-.|    |+...++   .|++|..++.+-
T Consensus        12 A~~~T~~~V~l~~~l~ll~A~NL---~Pn~W~~~~VRRLM~~~RA~~E~V~A~l----F~~~~~L---GP~~~~~A~~IH   81 (192)
T TIGR01097        12 AVFSTILAVVLSIILGLLAAKNL---VPNPWVRQIVRRLMDILRAINEVVIAGL----FLVILSL---GPIAAVLALFIH   81 (192)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHC---CCCCCCCHHHHHHHHHHHHHHHHHHHHH----HHHHHHC---CCHHHHHHHHHH
T ss_conf             99999999999999999867525---8884210478999999977679999999----9999950---518999999999


Q ss_pred             HHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             36689999999985110678989987077212777788397533258999999999987677999998543210136656
Q gi|254780705|r  290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG  369 (425)
Q Consensus       290 ~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~  369 (425)
                      |.=..-....|+.+++++.=+|+-.|.||+|.+.+++=++|+.+|-.++=.++=+---.--...+=++|+.+    +   
T Consensus        82 T~G~L~KLl~E~VE~~~~~P~EG~RA~GAN~~E~~~yG~~PQVlP~l~SY~L~RlE~NVR~~T~~G~VG~GG----I---  154 (192)
T TIGR01097        82 TIGVLSKLLFEVVEAIDMKPVEGLRAVGANKLERVLYGVLPQVLPLLISYFLLRLEINVRAATVVGAVGAGG----I---  154 (192)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC----H---
T ss_conf             998999999999861589897665233303788999601026768899999999988655556530447872----7---


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1344557999999860366500699999999999999999999999999
Q gi|254780705|r  370 VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR  418 (425)
Q Consensus       370 ~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr  418 (425)
                          +.+|-..|-       ..+.++|.|..+.+++-+..+.....+||
T Consensus       155 ----G~~L~~~I~-------~~~~~~T~A~~~L~~~T~~~~D~lS~~LR  192 (192)
T TIGR01097       155 ----GVLLRLAIR-------QFQEAKTLALVLLLIVTVFLLDFLSARLR  192 (192)
T ss_pred             ----HHHHHHHHH-------CCHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             ----689999860-------33068899999999999999999877409


No 74 
>TIGR02790 nickel_nikC nickel ABC transporter, permease subunit NikC; InterPro: IPR014157   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This family consists of the NikC family of nickel ABC transporter permeases. Operons that contain this protein also contain a homologous permease subunit NikB. Nickel is used in cells as part of urease or certain hydrogenases or superoxide dismutases..
Probab=98.75  E-value=6.7e-06  Score=56.38  Aligned_cols=200  Identities=19%  Similarity=0.209  Sum_probs=139.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
                      .+|....+--.+.+...++.+++++|..+|     |. -++.-+++-=..|..=+.|++|.-|+    ++..+|-.-.+ 
T Consensus        58 ~~G~R~SLg~al~~l~~~~~iG~~iG~~aG-----y~-GG~vD~~~MR~~D~~lsfPt~~L~L~----ivG~lG~Gl~n-  126 (258)
T TIGR02790        58 LFGARVSLGLALLVLGLVLVIGVLIGLIAG-----YI-GGRVDEVIMRVCDVFLSFPTIVLALA----IVGLLGPGLEN-  126 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----CC-CCHHHEEHHHHHHHHHHHHHHHHHHH----HHHHHCCCHHH-
T ss_conf             999999999999999999999999999853-----01-54020002554758875578999999----98574347999-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6897533454366899999999-851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  280 LVGGLILALMTLPSIIIATGVA-LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       280 l~g~~~l~~m~lP~i~~~~~~a-l~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      ..  +++++.-=+.=.|-.|.- ++--.+++-++|.+.|+|.||.+++|++|...|-|+==.-|-+|.++=+-+.+-|.|
T Consensus       127 vi--iA~vl~~Wa~YAR~vRg~v~Slk~~~fvlaar~~g~s~~~ii~rHi~~~i~~~iiVLaTLeiG~~il~ia~LSFLG  204 (258)
T TIGR02790       127 VI--IALVLVQWAWYARMVRGMVVSLKQKEFVLAARASGASHWQIIRRHILPNILSPIIVLATLEIGHVILHIAALSFLG  204 (258)
T ss_pred             HH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99--9999975478999999999999868899999997589844504211321014799999689999999998766742


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4321013665613445579999998603665006999999999999999999999999999741
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK  422 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~  422 (425)
                      -.   .+.|. |=--.+==-.-=|.|. +     .+....=.+.++..|..+|++-.-||.+|.
T Consensus       205 LG---iQPPt-PEWG~Ml~eak~y~~t-~-----P~lmiyPG~ail~~V~~FNllGd~Lrd~l~  258 (258)
T TIGR02790       205 LG---IQPPT-PEWGIMLSEAKEYLRT-Q-----PELMIYPGLAILITVMAFNLLGDSLRDALG  258 (258)
T ss_pred             CC---CCCCC-CHHHHHHHHHHHHHHH-C-----HHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             37---89878-3456468876898862-7-----178888659999999999733356405459


No 75 
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism]
Probab=98.61  E-value=6.1e-07  Score=63.01  Aligned_cols=187  Identities=18%  Similarity=0.160  Sum_probs=113.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             99999999999999999999999864373024567898998876533699999999999986266630046897533454
Q gi|254780705|r  210 SLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM  289 (425)
Q Consensus       210 Tl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~g~~~l~~m  289 (425)
                      |+.-...-+.++..+++..++++   +.+.+..+.....++.|++.|.-+|==|..+.-..+ .+.-.-.+..-  .-+=
T Consensus       322 ~~lRV~vilals~~i~i~lGy~i---~~~p~~e~i~~P~~Q~LaafPa~~~FPl~~aa~~~~-i~~~ei~l~pL--~~~g  395 (523)
T COG4986         322 DYLRVVVILALSFLISIFLGYSI---ALRPRVEGIGQPLIQFLAAFPAPIYFPLLFAAIKTF-ILTPEIWLSPL--GFIG  395 (523)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHE---EECCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH-HCCCHHHHHHH--HHHH
T ss_conf             99999999999999999865740---315116554127999987189237888999999998-60745777467--7766


Q ss_pred             HHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             36689999999985110678989987077212777788397533258999999999987677999998543210136656
Q gi|254780705|r  290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG  369 (425)
Q Consensus       290 ~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~  369 (425)
                      +.=++.-+.-.+.+++|.+|+|++-..+..-|.-.+++++|...|-++||..-+.+-|.|-.+    +|-  +. .. +.
T Consensus       396 T~~Yi~~n~iaG~ka~P~e~~e~akny~l~~w~k~r~iilP~tFPYlitG~~tt~ggaWna~i----V~E--y~-s~-g~  467 (523)
T COG4986         396 TFYYIFYNVIAGAKALPVEYFEAAKNYNLGGWAKWRRIILPGTFPYLITGLSTTIGGAWNALI----VGE--YW-SW-GH  467 (523)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCHH----EEE--EC-CC-CC
T ss_conf             789999999987652778999999970835599888875364229998747753046344002----022--00-26-74


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             13445579999998603665006999999999999999999999
Q gi|254780705|r  370 VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA  413 (425)
Q Consensus       370 ~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~  413 (425)
                      -.....-|--.|.   ...+.+++.++....++.=+++...|.+
T Consensus       468 ~~~v~~GlgkyIa---~aT~aGd~pr~~~g~~im~i~Vvv~n~~  508 (523)
T COG4986         468 TLLVAHGLGKYIA---VATAAGDIPRALWGSFIMGIVVVVYNIL  508 (523)
T ss_pred             HHHHHHHHHHHHH---HHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             2665632798999---9985688306888656550455575799


No 76 
>TIGR03003 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, permease protein EhuD; InterPro: IPR014341   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    Members of this entry are presumed to act as permease subunits of ectoine ABC transporters. Operons containing this gene also contain other genes of the ABC transporter and are typically found next to either ectoine utilization or ectoine biosynthesis operons..
Probab=98.61  E-value=4.9e-06  Score=57.25  Aligned_cols=145  Identities=21%  Similarity=0.169  Sum_probs=108.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             66789999999999999999999999999864373024567898998876533699999999999986266630046897
Q gi|254780705|r  204 GVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG  283 (425)
Q Consensus       204 ~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~g~  283 (425)
                      .-++..|+..+.....+|+.+|+.-||-- .-++ .+++..+...++-+=+.|=.|-=.|-+ --+|-+|..-.+.++|.
T Consensus        20 ~~gl~~Ti~atalGfaiA~VlGLvfAilR-rsa~-~~Iswp~~~vvEFiR~TPLLvQlyFly-YVLP~~Gi~LpA~~~Gv   96 (218)
T TIGR03003        20 LEGLKVTIKATALGFAIALVLGLVFAILR-RSAR-KLISWPTAVVVEFIRDTPLLVQLYFLY-YVLPDYGISLPALLVGV   96 (218)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCCC-CEEEEEHEEEEEEECCCCHHHHHHHHH-HHHHCCCCCHHHHHHHH
T ss_conf             99999999999999999999999998875-2156-310100100465205680899999999-88302333137999989


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             53345436689999999985110678989987077212777788397533258999999999987677
Q gi|254780705|r  284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET  351 (425)
Q Consensus       284 ~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt  351 (425)
                      +.|++-==-|..-.=|.++++||+..=||+-|+-.|+.||-+||++|+|.|-|+-..--=+--=+.||
T Consensus        97 lglGlhYa~Y~aEVYR~G~eaVprGQWEAa~AlNlt~~~tyr~iIlPQAippi~Pa~gNYLvAM~KeT  164 (218)
T TIGR03003        97 LGLGLHYAAYAAEVYRAGLEAVPRGQWEAATALNLTARQTYRDIILPQAIPPIVPALGNYLVAMLKET  164 (218)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             99888899888888863102588761689998523354457651022210011004578999997327


No 77 
>COG4239 ABC-type uncharacterized transport system, permease component [General function prediction only]
Probab=98.58  E-value=5.6e-05  Score=50.48  Aligned_cols=204  Identities=23%  Similarity=0.293  Sum_probs=118.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998626663004
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA  279 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~  279 (425)
                      .|.+....--|++-.+.-++++..+||.++-...-|.  +++.-+.+-.|++.+++|..    +-+.++...+. |+...
T Consensus       133 lARliygfRiSvLfgL~lT~~SaliGv~~GA~qGyfg--g~vdL~~QRfIEvws~mP~l----yllii~as~~~-p~f~~  205 (341)
T COG4239         133 LARLIYGFRISVLFGLSLTLISALIGVLAGALQGYFG--GWVDLLGQRFIEVWSGMPTL----YLLIILASIFQ-PNFWW  205 (341)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHHCCCHH----HHHHHHHHHHC-CCHHH
T ss_conf             9999999999999999999999999998887753413--00488770599998447299----99999999968-54799


Q ss_pred             HHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6897-533454366899999999851106789899870772127777883975332589999999999876779999985
Q gi|254780705|r  280 LVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       280 l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                      +.+. +..+-|-+-.++|+  |-++.-.-+|..||.+||+++.+.+++|+||.|+-.++|=.=.-+++++.--..+=|.|
T Consensus       206 ll~i~llf~Wm~lv~vvRa--efLr~Rn~dYvkAArAlGv~d~~Ii~rHilPnamvatlTflPf~l~~sitTltsLdFLg  283 (341)
T COG4239         206 LLGIMLLFGWMSLVGVVRA--EFLRARNLDYVKAARALGVSDRRIILRHILPNAMVATLTFLPFILSGSITTLTSLDFLG  283 (341)
T ss_pred             HHHHHHHHHHHHHHHHHHH--HHHHHCCHHHHHHHHHCCCCCCEEEHHHHCCHHHHHHHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             9999999999999999999--99986026889999973988650302132629889999987898706332300166652


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             43210136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       359 ~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
                      -     +.|.+-    .+|--.+-+-..+-+..+.-.+  +-++|.+++..+-++-.-+|+.|.-
T Consensus       284 f-----glp~gs----pSLGELl~qgk~nlqapWlgit--~fv~l~~~lslLvfIgea~Rdafdp  337 (341)
T COG4239         284 F-----GLPPGS----PSLGELLNQGKNNLQAPWLGIT--AFVVLSLLLSLLIFIGEAVRDAFDP  337 (341)
T ss_pred             C-----CCCCCC----CCHHHHHHHHHHCCCCCHHHHH--HHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             6-----999999----6789999976524778425588--9999999999999942998863150


No 78 
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism]
Probab=98.51  E-value=3e-05  Score=52.21  Aligned_cols=134  Identities=22%  Similarity=0.290  Sum_probs=91.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHCCCCCHHH
Q ss_conf             667899999999999999999999999998643730-245678989988765336999999--99999986266630046
Q gi|254780705|r  204 GVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FFSSFVQANINNLASVPSIVYGIL--GSAVLINFFKMPRSTAL  280 (425)
Q Consensus       204 ~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~-~~~~~i~~~i~~la~vPSIv~Gl~--gl~~~~~~~~~~~~~~l  280 (425)
                      .-+..-|.--++    +++-+.+.++.++.--|.|+ ++-++.-..+|++.+||-+  |+|  .+.+|+..|+.    ++
T Consensus         8 ~la~LaT~gRm~----~ai~iSi~~~~~lAy~A~Ksk~~E~i~ip~ldVlqSVPVl--gFfpi~l~~Fv~lfpG----~l   77 (523)
T COG4986           8 PLALLATAGRML----LAILISILTGWFLAYAAIKSKRFENIYIPVLDVLQSVPVL--GFFPIVLIFFVYLFPG----PL   77 (523)
T ss_pred             HHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHH--EEHHHHHHHHHHHCCC----CH
T ss_conf             999999999999----9999999999999999985205676130499887408512--0105355444343475----00


Q ss_pred             HHHHHHHHHHHH----HHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             897533454366----8999999998511067898998707721277778839753325899999999998
Q gi|254780705|r  281 VGGLILALMTLP----SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA  347 (425)
Q Consensus       281 ~g~~~l~~m~lP----~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra  347 (425)
                      ..-++--+.+.-    -|.-....++|.||.++.|.|-.-+.|.|+..+|+-.|.++|||..-.+.+++-+
T Consensus        78 GvElAa~FlvFTs~aWNi~fs~YQsFkTvP~dl~Eva~~yrls~~~r~~rlyIPfa~Pgi~~Nl~~S~s~g  148 (523)
T COG4986          78 GVELAADFLVFTSVAWNIWFSEYQSFKTVPSDLLEVARNYRLSFLLRMARLYIPFAMPGIAANLMPSMSDG  148 (523)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCHHHHHHHHHHCCCCCCHHHHHHCCHHHCCC
T ss_conf             38999999999999999999999987238789999998726589998787054311256798468302283


No 79 
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only]
Probab=98.46  E-value=0.00013  Score=48.07  Aligned_cols=154  Identities=21%  Similarity=0.234  Sum_probs=101.1

Q ss_pred             HHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-
Q ss_conf             2026678-99999999999999999999999998643--7302456789899887653369999999999998626663-
Q gi|254780705|r  201 AGIGVAV-VGSLYMMLIVIGLSFPLGIASAIYLEEFS--HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPR-  276 (425)
Q Consensus       201 ~Gi~~ai-~gTl~~~~ia~~ia~pigv~~aiyl~e~a--~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~-  276 (425)
                      ..++|.. .++.-+..+++ =+--++..-.|..-||.  ++++..-.+ ...-.|----|.|||+-.+..+   ++... 
T Consensus       340 ~~~~P~~l~n~~T~vllAl-sasslALll~iL~le~~~~~qR~~~~~~-l~LP~LlP~lslvfG~qvL~L~---~~l~~~  414 (551)
T COG4135         340 INSLPEALINSLTMVLLAL-SASSLALLLLILWLEWGGIPQRRQAYLW-LWLPILLPALSLVFGQQVLALW---LGLDGS  414 (551)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HHCHHHHHHHHHHHHHCCCCHHCCHHHH-HHHHHHHHHHHHHHHHHHHHHH---HCCCCC
T ss_conf             8755999874565999997-2045999999999995798320110688-8888876677899889999999---626874


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00468975334543668999999998511067898998707721277778839753325899999999998767799999
Q gi|254780705|r  277 STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF  356 (425)
Q Consensus       277 ~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~  356 (425)
                      ....+  -+..+..+|.+.-.....-+++++....-|.++|-++||.+++|.+|.-.|..+++.-.||+-.+....|.++
T Consensus       415 w~~Vv--w~H~~fv~P~v~l~Ls~pWq~~dsrf~kIA~~lGks~~~Iff~vklPLlfra~L~A~AVGfaVsiaqYlPTL~  492 (551)
T COG4135         415 WTAVV--WGHLLFVMPWVLLILSPPWQRIDSRFIKIAQTLGKSRAKIFFYVKLPLLFRACLIAFAVGFSVSIAQYLPTLW  492 (551)
T ss_pred             HHHHH--HHHHHHHHHHHHHHHCCHHHHHCHHHHHHHHHHCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             39999--9999999999999847457552708999998708306678887504576799999999876742997614782


Q ss_pred             HHHHH
Q ss_conf             85432
Q gi|254780705|r  357 VGMVA  361 (425)
Q Consensus       357 ~~~~~  361 (425)
                      +|+.-
T Consensus       493 lG~GR  497 (551)
T COG4135         493 LGAGR  497 (551)
T ss_pred             CCCCC
T ss_conf             26776


No 80 
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry represents thiamine ABC transporter, permease protein in bacteria, believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane. The protein belongs to the larger ABC transport system. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate (TMP) or thiamine pyrophosphate (TPP).   Thiamine pyrophosphate (TPP)1 is a required cofactor synthesized de novo in Salmonella typhimurium. The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and -ketoglutarate dehydrogenase (1.2.4.2 from EC). Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism.; GO: 0005215 transporter activity, 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=98.44  E-value=0.00012  Score=48.36  Aligned_cols=205  Identities=23%  Similarity=0.207  Sum_probs=146.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHH
Q ss_conf             1202667899999999999999999999999--9986437302456789899887653369999999-------999998
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAI--YLEEFSHKGFFSSFVQANINNLASVPSIVYGILG-------SAVLIN  270 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~ai--yl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~g-------l~~~~~  270 (425)
                      ..=.++-+.=|+.-++++.++|+-.|+.-|-  |-..|..|.++=+......-..+  =-+|||+.+       ++.+.+
T Consensus        42 D~YL~H~~~FSF~QAlLS~~LS~~~~~lLARALy~~~F~G~~~LL~L~~lTl~LP~--LV~~FG~~~~YG~~GWLA~L~~  119 (519)
T TIGR01253        42 DDYLQHLVLFSFGQALLSALLSVIFALLLARALYRKRFLGKKALLKLMALTLVLPV--LVVVFGLLSVYGRSGWLATLAN  119 (519)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH--HHHHHHHHHHCCCCCHHHHHHH
T ss_conf             40789999999899999999999999999999740688426899999999999999--9999977764057537999998


Q ss_pred             HHCCCC---CHHHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             626663---0046897-533454366899999999851106789899870772127777883975332589999999999
Q gi|254780705|r  271 FFKMPR---STALVGG-LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR  346 (425)
Q Consensus       271 ~~~~~~---~~~l~g~-~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~r  346 (425)
                      .+|+.=   .-.+.|. +++.+..+|...+..-.+++++|.+-|+=|.-||...||-++-|-=|.-+.-+.--.-|=|=-
T Consensus       120 ~lGl~W~~~~YGL~GIL~AH~FFN~PlA~~LlLQ~L~~IP~~QRQLAAQL~l~~W~F~~lVEWP~lR~Q~~P~~~LIFML  199 (519)
T TIGR01253       120 LLGLEWTFSIYGLSGILLAHLFFNLPLAARLLLQALESIPYEQRQLAAQLNLRSWQFVKLVEWPVLRRQILPVAALIFML  199 (519)
T ss_pred             HCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCEEEEEEECHHHHHHCCHHHHHHHHH
T ss_conf             71875034334157999999996156999999998741781577999971677530566630512332112589999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             87677999998543210136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       347 a~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
                      .+.-.+.++-.||.      |.     .||+-..||+-....    ++.+-||.+.++=++..+  .-..+.+||++
T Consensus       200 CF~SF~~VL~LGGG------PQ-----~TT~E~AIYQA~~y~----yD~~~AAllAlLQ~V~CL--~L~~L~~RlS~  259 (519)
T TIGR01253       200 CFASFAVVLSLGGG------PQ-----ATTLELAIYQALLYD----YDLAKAALLALLQFVFCL--ILVLLSSRLSK  259 (519)
T ss_pred             HHHHHHHHHHCCCC------CC-----HHHHHHHHHHHHHHC----CCHHHHHHHHHHHHHHHH--HHHHHHHHHHH
T ss_conf             98889998735898------40-----689999999998731----684689999999999999--99999887876


No 81 
>COG4171 SapC ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms]
Probab=98.26  E-value=0.00014  Score=48.00  Aligned_cols=147  Identities=24%  Similarity=0.277  Sum_probs=109.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             02667899999999999999999999999998643730245678989988765336999999999999862666300468
Q gi|254780705|r  202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALV  281 (425)
Q Consensus       202 Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~  281 (425)
                      |-.+.+=+.+.+++.+.+++..+|+.+++      .++--.+++....|.+-++||....+    +++.++|-   +..-
T Consensus        94 Gt~~t~G~allvt~~a~l~g~~lGi~AG~------t~gl~s~~lnHilDt~lSiPsLLlAi----ivvaf~gp---sl~n  160 (296)
T COG4171          94 GTAPTVGGALLVTLAATICGGVLGIFAGA------THGLRSAVLNHILDTLLSIPSLLLAI----IVVAFAGP---SLSN  160 (296)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHCCC---HHHH
T ss_conf             67523413999999999999999999977------77789999999999997358999999----99996083---2888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             975334543668999999998-5110678989987077212777788397533258999999999987677999998543
Q gi|254780705|r  282 GGLILALMTLPSIIIATGVAL-RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV  360 (425)
Q Consensus       282 g~~~l~~m~lP~i~~~~~~al-~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~  360 (425)
                      +..+..+-.+|+++++...+. +.+.++|.-++--=|+|.....++.++|...+.+++-+--+++-|+=+-+++=|++-.
T Consensus       161 amfA~~LAllPrfirsiY~avh~EleKeYViaarLdGas~~~lL~~~IlPNI~~~~v~EitrAlsiAiLDI~ALgFl~LG  240 (296)
T COG4171         161 AMFAVWLALLPRFIRSIYSAVHDELEKEYVIAARLDGASTLNLLWFAILPNITAILVTEITRALSIAILDIAALGFLDLG  240 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999988778777652676618899999725127999999999999999988886133125


Q ss_pred             H
Q ss_conf             2
Q gi|254780705|r  361 A  361 (425)
Q Consensus       361 ~  361 (425)
                      +
T Consensus       241 A  241 (296)
T COG4171         241 A  241 (296)
T ss_pred             C
T ss_conf             7


No 82 
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only]
Probab=97.97  E-value=0.00073  Score=43.40  Aligned_cols=209  Identities=17%  Similarity=0.252  Sum_probs=120.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------
Q ss_conf             12026678999999999999999999999999986437302456789899887653369999999999998---------
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN---------  270 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~---------  270 (425)
                      .-|+..++.-|+..++++...+..+..   .++..|.+.-++.+ |+....-|-++|-+-|.. +++.+..         
T Consensus        51 ~q~~~~alL~~l~stl~~tv~Alli~~---~~i~~fw~~P~w~R-i~~~ls~LLAiPHvAfA~-~~a~LfA~~G~L~RLl  125 (551)
T COG4135          51 PQHLPQALLATLVSTLIATVGALLIAL---LVIVAFWPGPKWQR-ICHRLSWLLAIPHVAFAT-SAALLFADGGFLLRLL  125 (551)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHCCCCHHHH-HHHHHHHHHHCCHHHHHH-HHHHHHCCCHHHHHHH
T ss_conf             642289999999999999999999999---99999648971999-986400887454899999-9999945840789884


Q ss_pred             --HHCCCCC--------HH--HHHHHHHHHHHHHHHHHHHHHHHHHCHH-HHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             --6266630--------04--6897533454366899999999851106-789899870772127777883975332589
Q gi|254780705|r  271 --FFKMPRS--------TA--LVGGLILALMTLPSIIIATGVALRTVPS-SIRSAALGLGASKVQTVFHHVLPLAMPAIL  337 (425)
Q Consensus       271 --~~~~~~~--------~~--l~g~~~l~~m~lP~i~~~~~~al~~vp~-~~~eaa~~LGas~~~~~~~v~lp~a~pgi~  337 (425)
                        .|.....        .+  +.-+++|+.--.|++...+-+.+.+..- ...--+.+||-+|||-+.-+++|.-.+.|-
T Consensus       126 y~~f~~ft~p~d~~L~~Dpfaigl~~~La~KEvpFllli~la~L~ql~lt~~~~l~asLGYsr~q~~~w~l~P~~~r~ir  205 (551)
T COG4135         126 YDYFPYFTPPPDWLLPMDPFAIGLGATLAVKEVPFLLLILLAVLSQLALTQQVILLASLGYSRWQCLNWLLLPSVARAIR  205 (551)
T ss_pred             CCCCCCCCCCHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHEEHHHHHHHHH
T ss_conf             14777778980213568814667788988841319999999987687899999999973666343202100387899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH---HHHH
Q ss_conf             9999999998767799999854321013665613445579999998603665006999999999999999999---9999
Q gi|254780705|r  338 TGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI---NTAM  414 (425)
Q Consensus       338 ~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~---n~~a  414 (425)
                      -...--.+.++.-.         .+.  +--+|..| .|+|+..++|..++|-+...+++.++++++..+...   -+.-
T Consensus       206 ~~~fAv~ays~SVV---------Dva--~iLGP~~P-PTl~V~vwQW~~~~Dl~~~~~aa~ga~lllllvvaalaa~vaL  273 (551)
T COG4135         206 MAMFAVVAYSLSVV---------DVA--IILGPGNP-PTLAVIVWQWLTQGDLDQQTKAALGALLLLLLVVAALAAYVAL  273 (551)
T ss_pred             HHHHHHHHHHHHEE---------EEE--EEECCCCC-CCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999864101---------577--87469989-9504775430478760035577788899999999999999999


Q ss_pred             HHHHHHHHCCC
Q ss_conf             99999741049
Q gi|254780705|r  415 LWLRNRFKKRW  425 (425)
Q Consensus       415 ~~lr~r~~~~w  425 (425)
                      .++-++--|||
T Consensus       274 e~l~ka~~r~w  284 (551)
T COG4135         274 EYLLKAVWRRW  284 (551)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999998


No 83 
>COG4597 BatB ABC-type amino acid transport system, permease component [Amino acid transport and metabolism]
Probab=97.90  E-value=5.1e-06  Score=57.15  Aligned_cols=124  Identities=16%  Similarity=0.203  Sum_probs=84.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHH---HCCCCC---HH--H
Q ss_conf             9999999999999999986437302-----4567898998876533699999999999--986---266630---04--6
Q gi|254780705|r  216 IVIGLSFPLGIASAIYLEEFSHKGF-----FSSFVQANINNLASVPSIVYGILGSAVL--INF---FKMPRS---TA--L  280 (425)
Q Consensus       216 ia~~ia~pigv~~aiyl~e~a~~~~-----~~~~i~~~i~~la~vPSIv~Gl~gl~~~--~~~---~~~~~~---~~--l  280 (425)
                      ++.++|+.+|+.+++++..++++.-     ..+......-..-|.|-..|=++|..+.  ++.   |.+.+.   .|  .
T Consensus       188 ~~~~lA~~~~I~~s~~~~r~ak~rQ~~TGq~~~~~~~~~~LiiglPll~~~~~G~pl~~d~P~~~~FNl~GG~~v~PEf~  267 (397)
T COG4597         188 IAFILALVMAIVASVFLARWAKTRQIATGQQFRTWPTAAVLIIGLPLLAQWLFGAPLTFDVPALGGFNLTGGMVVIPEFA  267 (397)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCHHHHHHHCCCCCEECCCCCCCCCCCCCEEECHHHH
T ss_conf             79999999999999999999887787507857623568899845088999972897212052114435668705657899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89753345436689999999985110678989987077212777788397533258999
Q gi|254780705|r  281 VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG  339 (425)
Q Consensus       281 ~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g  339 (425)
                      +--++|++.+-.+|.-..|+++++|++..-|||.+||..+-+|.+.|+.|.|++-|+.-
T Consensus       268 aL~laLs~YTaaFIAEiVRaGI~~VskGQtEAa~sLGL~~~~t~RlVivPQAlRiIIPP  326 (397)
T COG4597         268 ALFLALSFYTAAFIAEIVRAGIQAVSKGQTEAARSLGLRSSLTLRLVIVPQALRIIIPP  326 (397)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHCCCCCCCEEEEEEECCCCEEECCC
T ss_conf             99999999999999999987650257661778986289975447999841101564176


No 84 
>TIGR01183 ntrB nitrate ABC transporter, permease protein; InterPro: IPR005889   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry comprises of the nitrate transport permease in bacteria, the gene product of ntrB. The nitrate transport permease is the integral membrane component of the nitrate transport system and belongs to the ATP-binding cassette (ABC) superfamily. At least in photosynthetic bacteria nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA, ntrB, ntrC, ntrD, narB. Functionally ntrC and ntrD resemble the ATP binding components of the binding protein-dependent transport systems. Mutational studies have shown that ntrB and ntrC are mandatory for nitrate accumulation. Nitrate reductase is encoded by narB. ; GO: 0015112 nitrate transmembrane transporter activity, 0015706 nitrate transport, 0016021 integral to membrane.
Probab=97.85  E-value=0.0015  Score=41.38  Aligned_cols=153  Identities=21%  Similarity=0.312  Sum_probs=116.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             11012026678999999999999999999999999986437302456789899887653369999999999998626663
Q gi|254780705|r  197 RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPR  276 (425)
Q Consensus       197 ~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~  276 (425)
                      ....-|..-.+.-|+--......++.-.|+..++.+..   ...+.+.++..++.|-.+|..-.    +-+-+..+.-..
T Consensus         9 ~G~~~Gl~~q~~~sl~rva~G~~~aa~~Gi~~G~~~G~---~~~~~~~ldP~~q~lr~~~PlaW----~Pi~l~~~~~~~   81 (203)
T TIGR01183         9 GGTDKGLFLQILASLTRVAVGYLLAAIVGIAVGILIGL---SKLLNKALDPIFQVLRTVPPLAW----LPIALAAFQDAQ   81 (203)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHCCHHH----HHHHHHHHHCCC
T ss_conf             67420379999999999999999999999999999746---89998742089999975153457----889999984168


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHH
Q ss_conf             004689753345436689999999985110678989987077212777788397533258999999999987677-9999
Q gi|254780705|r  277 STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET-APLL  355 (425)
Q Consensus       277 ~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt-a~ll  355 (425)
                      .+.   ..+.-+-.+=.++..|..+.+++|++|++.+.-|-.||.+-+.++++|.+.|-+.+|.-+++|-+.=.- |+-+
T Consensus        82 ~~a---ifvifita~WPi~int~~G~~~~P~dy~nv~rvl~ls~~~y~~~~~~P~~~Py~f~Gl~i~~Gl~Wlai~aae~  158 (203)
T TIGR01183        82 PAA---IFVIFITAIWPIIINTAVGVQQIPQDYNNVARVLKLSKSDYLLKVLLPAAVPYIFTGLRIAIGLSWLAIVAAEM  158 (203)
T ss_pred             CCE---EEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             631---31124877989998766667631177899999999878888887775444568986589999999999999999


Q ss_pred             HHHH
Q ss_conf             9854
Q gi|254780705|r  356 FVGM  359 (425)
Q Consensus       356 ~~~~  359 (425)
                      +.++
T Consensus       159 ~~~~  162 (203)
T TIGR01183       159 LIGG  162 (203)
T ss_pred             HHCC
T ss_conf             8605


No 85 
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This family consists of the NikB family of nickel ABC transporter permeases. Operons that contain this protein also contain a homologous permease subunit NikC. Nickel is used in cells as part of urease or certain hydrogenases or superoxide dismutases..
Probab=97.82  E-value=0.00069  Score=43.53  Aligned_cols=161  Identities=21%  Similarity=0.266  Sum_probs=112.9

Q ss_pred             CCHHHCCCCC-CCCCHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2023213443-2110120266789999----9999999999999999999998643730245678989988765336999
Q gi|254780705|r  186 NYGFFINGAS-SRPEVAGIGVAVVGSL----YMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY  260 (425)
Q Consensus       186 n~~f~t~~~s-~~~e~~Gi~~ai~gTl----~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~  260 (425)
                      .-.|.-+.-| ..|-..-+...+=-|+    ....+++++|+|+|+.||+|=..     ..-...++..-.-+++|.-=-
T Consensus        77 hLDFGiSYi~i~rpV~De~~~~LPaTl~LA~~aL~i~vlvSvPLG~LAA~~r~~-----~~D~~~R~~~FlG~siPnFWL  151 (315)
T TIGR02789        77 HLDFGISYISIDRPVLDEVARSLPATLELAGLALVIVVLVSVPLGILAARYRDR-----LPDHAVRFISFLGVSIPNFWL  151 (315)
T ss_pred             HHCCCCEEEECCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCCHHHHHHHHHHHHHHHHHH
T ss_conf             731464056668950888974353889999999999999984088999887368-----640789999999643056899


Q ss_pred             HHH---HHHHHHHHHCCCCCH----HHHHHHHHHHHHHHHHHHHHHHH-HHHCHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             999---999999862666300----46897533454366899999999-8511067898998707721277778839753
Q gi|254780705|r  261 GIL---GSAVLINFFKMPRST----ALVGGLILALMTLPSIIIATGVA-LRTVPSSIRSAALGLGASKVQTVFHHVLPLA  332 (425)
Q Consensus       261 Gl~---gl~~~~~~~~~~~~~----~l~g~~~l~~m~lP~i~~~~~~a-l~~vp~~~~eaa~~LGas~~~~~~~v~lp~a  332 (425)
                      |++   +++++++++...+.+    .+-=++++|+|.+-+=+|-.|++ +++.-+.|-.=|-.=|..+-++.++|+||.|
T Consensus       152 A~LLv~~fsvyL~lLP~~G~gtW~HlvLP~~tlal~~~a~y~RLLRaS~Ld~~qe~yv~yAR~RGi~~~~v~~~H~Lrna  231 (315)
T TIGR02789       152 AFLLVFLFSVYLDLLPVEGAGTWQHLVLPAVTLALMSVAIYARLLRASMLDNLQERYVTYARVRGIKERNVIRRHILRNA  231 (315)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEHECCCCHHHHHHHHHHCCCC
T ss_conf             99999999998613376778733113388899999999999999999999862887073011026465776886324111


Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             3258999999999987677
Q gi|254780705|r  333 MPAILTGSTVSLARALGET  351 (425)
Q Consensus       333 ~pgi~~g~il~~~ra~GEt  351 (425)
                      ..-.+||+=..+|+=+|=|
T Consensus       232 ~~p~iTA~GM~~g~Ll~GT  250 (315)
T TIGR02789       232 ILPMITALGMHIGELLGGT  250 (315)
T ss_pred             HHHHHHHHHHHHHHHHHCC
T ss_conf             0256776001388784071


No 86 
>TIGR01726 HEQRo_perm_3TM amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family; InterPro: IPR010065   This entry represents one of several classes of multiple membrane spanning regions found in the inner membrane component of binding-protein-dependent transport systems. The region covered by this entry generally is predicted to contain three transmembrane helices. Substrate specificities attributed to members of this family include histidine, arginine, glutamine, glutamate, and (in Agrobacterium) the opines octopine and nopaline.; GO: 0005215 transporter activity, 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=96.73  E-value=0.045  Score=31.98  Aligned_cols=90  Identities=13%  Similarity=0.096  Sum_probs=69.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             26678999999999999999999999999986437302456789899887653369999999999998626663004689
Q gi|254780705|r  203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVG  282 (425)
Q Consensus       203 i~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~~~~~l~g  282 (425)
                      ++....-|+.++++++++++++|+..|+.-.  .+.+.++......+|..=++|=+|.=+|-+ +-+|.+|..-+...+|
T Consensus         5 l~~G~~~Tl~~~~~~~~~g~~~Gl~~al~r~--s~~~~l~~~~~~Y~~~~Rg~PlLvqlf~~y-fgLP~~Gi~l~~~~Aa   81 (99)
T TIGR01726         5 LLKGLLLTLLISVLSILLGLVLGLLLALLRL--SGNRPLRWIATVYVELFRGTPLLVQLFFIY-FGLPLIGIRLSPLTAA   81 (99)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCCHHHHH
T ss_conf             9999999999999999999999999999987--135999999999999996207999999999-8435427706778999


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             7533454366899
Q gi|254780705|r  283 GLILALMTLPSII  295 (425)
Q Consensus       283 ~~~l~~m~lP~i~  295 (425)
                      .+++++..=-|+.
T Consensus        82 ~~al~l~~~AY~a   94 (99)
T TIGR01726        82 VIALTLFEGAYLA   94 (99)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999998799998


No 87 
>COG4174 ABC-type uncharacterized transport system, permease component [General function prediction only]
Probab=94.86  E-value=0.11  Score=29.55  Aligned_cols=160  Identities=23%  Similarity=0.324  Sum_probs=89.5

Q ss_pred             HHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             64112202321344321101202667899999999999999999999999998643730245678989988765336999
Q gi|254780705|r  181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY  260 (425)
Q Consensus       181 i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~  260 (425)
                      .+..|.-+||.+.+-.+--.--.--.|---++.+++.-++++|+|+.-|+--.     +++.-.-...|-+=.+||+-.|
T Consensus       110 ~rfDfGeS~fr~~~VidLI~eklPVSiSlGlw~tli~YliSIPLGI~KAv~~g-----s~fDvwsS~viiigyAiP~Flf  184 (364)
T COG4174         110 ARFDFGESFFRDASVIDLIKEKLPVSISLGLWSTLIIYLISIPLGIRKAVRNG-----SRFDVWSSAVIIIGYAIPAFLF  184 (364)
T ss_pred             HHCCCCHHHHCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCHHHHHHHHCC-----CCCEEEEEEEEEEECCCHHHHH
T ss_conf             71033387645771999999747827876899999999974333288887479-----8420221136887324279999


Q ss_pred             HHHHHHHHH-----HHHCCCC---C-----HHHHHHHH--HHHHHHHHH----------HHHHH-HHHHHCHHHHHHHHH
Q ss_conf             999999999-----8626663---0-----04689753--345436689----------99999-998511067898998
Q gi|254780705|r  261 GILGSAVLI-----NFFKMPR---S-----TALVGGLI--LALMTLPSI----------IIATG-VALRTVPSSIRSAAL  314 (425)
Q Consensus       261 Gl~gl~~~~-----~~~~~~~---~-----~~l~g~~~--l~~m~lP~i----------~~~~~-~al~~vp~~~~eaa~  314 (425)
                      |++-..+|-     .+|.+.+   .     ++ -+-++  +=-|+||..          .-.|+ .-+..+.+.|.-.|.
T Consensus       185 ailLiVlFaGGsy~dwFPLRGLvSdnf~~L~~-~~ki~DYlWH~tLPv~a~v~g~FAt~TlLtKNSFldEi~KqYVvTAR  263 (364)
T COG4174         185 AILLIVLFAGGSYFDWFPLRGLVSDNFDQLSW-YGKITDYLWHITLPVLALVLGGFATLTLLTKNSFLDEIRKQYVVTAR  263 (364)
T ss_pred             HHHHHHHHCCCCCEEECCCCCCCCCCHHHCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEHH
T ss_conf             99999741587610120014634588343472-78889999998888999998667778887530589997645266323


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             70772127777883975332589999999999
Q gi|254780705|r  315 GLGASKVQTVFHHVLPLAMPAILTGSTVSLAR  346 (425)
Q Consensus       315 ~LGas~~~~~~~v~lp~a~pgi~~g~il~~~r  346 (425)
                      +-|.|.-+++++|+...|+--+++|.=-+|--
T Consensus       264 AKGlserrvly~HVFRNAMLlviaGfP~afis  295 (364)
T COG4174         264 AKGLSERRVLYKHVFRNAMLLVIAGFPAAFIS  295 (364)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             15885545269988634278876178099999


No 88 
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms]
Probab=94.62  E-value=0.32  Score=26.52  Aligned_cols=55  Identities=20%  Similarity=0.251  Sum_probs=39.2

Q ss_pred             HHHHH--HHHHHHHHH-HCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             36689--999999985-11067898998707721277778839753325899999999
Q gi|254780705|r  290 TLPSI--IIATGVALR-TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL  344 (425)
Q Consensus       290 ~lP~i--~~~~~~al~-~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~  344 (425)
                      +.|++  ++..|.+-. -..++|..+|..=|.|||+.+++||+..+.|-++.-.-+-|
T Consensus       192 iaPTtevir~mr~s~~~Vl~qNyikaA~trGlS~~~Ilr~hVlrNalPplIPq~g~qf  249 (321)
T COG4168         192 VAPTTEVIRLMRQSTEEVLNQNYIKAAATRGLSRFTILRRHVLRNALPPLIPQLGLQF  249 (321)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             7347999999999899997424899999656035589999998504785444136799


No 89 
>COG0390 ABC-type uncharacterized transport system, permease component [General function prediction only]
Probab=94.46  E-value=0.35  Score=26.29  Aligned_cols=41  Identities=12%  Similarity=-0.030  Sum_probs=25.4

Q ss_pred             HHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             689999999985110678989987077212777788397533
Q gi|254780705|r  292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAM  333 (425)
Q Consensus       292 P~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~  333 (425)
                      +...-...+++.+ .++.-|+.++||||++|.+..+.--..+
T Consensus       140 ~L~~~~l~~~i~~-~~~eie~~LsLGaTp~~A~~~~~r~Air  180 (256)
T COG0390         140 SLAYERLVSEIIS-EKDEIEAKLSLGATPKEASRPYIRSAIR  180 (256)
T ss_pred             HHHHHHHHHHHHC-CHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             5578888999740-3899999985289889997999999888


No 90 
>pfam03649 UPF0014 Uncharacterized protein family (UPF0014).
Probab=92.66  E-value=0.71  Score=24.34  Aligned_cols=79  Identities=20%  Similarity=0.237  Sum_probs=45.9

Q ss_pred             HHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHCCCCCCCCCCH
Q ss_conf             99999998511067898998707721277778839753325899999999998767-79999985432101366561344
Q gi|254780705|r  295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE-TAPLLFVGMVAFVTDYPVGVTDI  373 (425)
Q Consensus       295 ~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GE-ta~ll~~~~~~~~~~~p~~~~~p  373 (425)
                      .....+.+++ .++.-|+.++||||+||.....+-...+.+++- .+-. -+++|= +-|=+|||+.-       +=.||
T Consensus       145 l~rl~~~l~~-~~~~iE~~LaLGAt~~~A~~~~~r~Air~aliP-~in~-m~~vGlVsLPGmMTGqIL-------aG~~P  214 (250)
T pfam03649       145 LDKLIDMVKS-ERDIIWGYLALGATPIQALAPFIRNAIRAALIP-TVNR-TKSVGLVSLPGMMVGMLL-------AGADP  214 (250)
T ss_pred             HHHHHHHHHH-HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH-HHHH-HHHCCHHCCCHHHHHHHH-------CCCCH
T ss_conf             9999999998-799999999879998999999999999998562-6999-878012126468999896-------49988


Q ss_pred             HHHHHHHHHH
Q ss_conf             5579999998
Q gi|254780705|r  374 ATAFPVQIYL  383 (425)
Q Consensus       374 ~~tlp~~Iy~  383 (425)
                      .++.-+||-.
T Consensus       215 l~Av~YQivI  224 (250)
T pfam03649       215 IYAAEYQIII  224 (250)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999999


No 91 
>TIGR01478 STEVOR variant surface antigen, stevor family; InterPro: IPR006374   Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see .   This entry represents the stevor (short for "subtelomeric variable open reading frame") family of predicted variant surface antigens. This is the third largest variant surface antigen family in P. falciparum, with 33 genes identified in the genome of this parasite . The function of these proteins is not known, but they are expressed during several stages of the parasite life-cycle and may play a variety of roles in parasite survival and infection ..
Probab=91.23  E-value=0.23  Score=27.49  Aligned_cols=28  Identities=39%  Similarity=0.682  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9999999999999999999999741049
Q gi|254780705|r  398 GAILLLLIFLAVINTAMLWLRNRFKKRW  425 (425)
Q Consensus       398 aa~lvLl~~~~~~n~~a~~lr~r~~~~w  425 (425)
                      -|++||+++++++-++-+||+||=.+-|
T Consensus       278 IAAlVLi~L~V~LIiLYIWLYrRRK~SW  305 (315)
T TIGR01478       278 IAALVLIILTVVLIILYIWLYRRRKKSW  305 (315)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCHHH
T ss_conf             9999999999999999888856403035


No 92 
>PTZ00042 stevor; Provisional
Probab=89.55  E-value=1.4  Score=22.41  Aligned_cols=28  Identities=39%  Similarity=0.669  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9999999999999999999999741049
Q gi|254780705|r  398 GAILLLLIFLAVINTAMLWLRNRFKKRW  425 (425)
Q Consensus       398 aa~lvLl~~~~~~n~~a~~lr~r~~~~w  425 (425)
                      -|++||+++.+++-++-+||+||=.+.|
T Consensus       267 IaalVLlilaVvLIILYIWLyrRRKnSW  294 (304)
T PTZ00042        267 IAALVLLILAVVLIILYIWLYRRRKNSW  294 (304)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             9999999999999999999998412421


No 93 
>PRK11275 pstC phosphate transporter permease subunit; Provisional
Probab=85.77  E-value=0.4  Score=25.94  Aligned_cols=46  Identities=11%  Similarity=0.144  Sum_probs=38.6

Q ss_pred             HHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             8888886-568999999999999999999999997614446216899
Q gi|254780705|r   10 NLKYRYI-SEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTH   55 (425)
Q Consensus        10 ~LkkR~~-aEkrFr~yGi~AI~ial~fL~~Ll~sI~s~G~~AF~qT~   55 (425)
                      +-|.|+| .||.|+..-..+-.+.++.|+.+++.++.+|.|+|++.-
T Consensus         7 ~~~~~~R~~D~if~~l~~~~a~~~~~~l~~I~~~l~~~~~p~~~~~g   53 (319)
T PRK11275          7 AFNAPGKKGDIIFSALVKLAALITLLLLGGIIVSLIISSWPSIQKFG   53 (319)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             65679957869999999999999999999999999998899999718


No 94 
>PRK11086 sensory histidine kinase DcuS; Provisional
Probab=81.54  E-value=0.96  Score=23.51  Aligned_cols=37  Identities=14%  Similarity=0.157  Sum_probs=29.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             2026678999999999999999999999999986437
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH  237 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~  237 (425)
                      ..|...+..+....+..+++++.+|+..|++++.+-.
T Consensus       169 ~~i~~~~~~~~~~i~~~~~~~lllg~~~a~~lar~ik  205 (541)
T PRK11086        169 SEVTQQINESRWSIYWSILFGALVGLIGAVILVRVLK  205 (541)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8899999999999999999999999999999999999


No 95 
>COG4709 Predicted membrane protein [Function unknown]
Probab=75.84  E-value=5.3  Score=18.78  Aligned_cols=35  Identities=17%  Similarity=0.396  Sum_probs=20.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             10120266789999999999999999999999999
Q gi|254780705|r  198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL  232 (425)
Q Consensus       198 ~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl  232 (425)
                      |.+--+..++.+..-+...+.++.+|+.++.-.++
T Consensus        73 ~~~~n~~~aii~~~~L~~~~v~i~Lpl~~~vi~~v  107 (195)
T COG4709          73 PTQKNVRRAIIALIGLGLLAVIIGLPLLIGVILFV  107 (195)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             76001499999999999999999999999999999


No 96 
>KOG3312 consensus
Probab=70.16  E-value=7.2  Score=17.93  Aligned_cols=41  Identities=22%  Similarity=0.268  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88998888888656899999999999999999999999761
Q gi|254780705|r    5 SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVS   45 (425)
Q Consensus         5 ~~~~~~LkkR~~aEkrFr~yGi~AI~ial~fL~~Ll~sI~s   45 (425)
                      |.++.+||.-+|-=.-||+-.+.||.++...|.-+|-|||.
T Consensus        70 eR~Ee~LK~~nRDlSl~kmKsmfaigl~ftal~~~fNSiFe  110 (186)
T KOG3312          70 ERVEEKLKNNNRDLSLFKMKSMFAIGLAFTALLGMFNSIFE  110 (186)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             88999986366543788788889999999999999886605


No 97 
>pfam04306 DUF456 Protein of unknown function (DUF456). Putative membrane protein.
Probab=69.81  E-value=7.4  Score=17.88  Aligned_cols=11  Identities=36%  Similarity=0.178  Sum_probs=5.0

Q ss_pred             HHHCCCHHHHH
Q ss_conf             87077212777
Q gi|254780705|r  314 LGLGASKVQTV  324 (425)
Q Consensus       314 ~~LGas~~~~~  324 (425)
                      ---|+|||-+.
T Consensus        56 kk~G~s~~~~~   66 (140)
T pfam04306        56 KRFGASKWGLW   66 (140)
T ss_pred             HHCCCCHHHHH
T ss_conf             97189389899


No 98 
>TIGR00797 matE MATE efflux family protein; InterPro: IPR002528   Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters. These proteins mediate resistance to a wide range of cationic dyes, fluroquinolones, aminoglycosides and other structurally diverse antibodies and drugs. MATE proteins are found in bacteria, archaea and eukaryotes. These proteins are predicted to have 12 alpha-helical transmembrane regions, some of the animal proteins may have an additional C-terminal helix. ; GO: 0015238 drug transporter activity, 0015297 antiporter activity, 0006855 multidrug transport, 0016020 membrane.
Probab=69.03  E-value=7.7  Score=17.78  Aligned_cols=160  Identities=19%  Similarity=0.179  Sum_probs=71.6

Q ss_pred             CCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHH-H-HC-C-CHHHHHHHHHHHHHHHHHH
Q ss_conf             220232134432110120266789999999999999999999----9999998-6-43-7-3024567898998876533
Q gi|254780705|r  185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGI----ASAIYLE-E-FS-H-KGFFSSFVQANINNLASVP  256 (425)
Q Consensus       185 fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~pigv----~~aiyl~-e-~a-~-~~~~~~~i~~~i~~la~vP  256 (425)
                      +|| .|--|.-..||.|..+.| +.|.+.-.++.++-+-.-.    .--+++. + +. + ++-++++++..+..+-..=
T Consensus       159 L~~-~li~G~fG~P~lG~~GaA-~At~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lg~P~~~~~~  236 (412)
T TIGR00797       159 LDY-ILIFGKFGFPELGIVGAA-LATVISYWLMFLLLLYYIKKSAQAKKIGLKWEGLLKPDWEVLKRLLKLGLPIALRVI  236 (412)
T ss_pred             HHH-HHHCCCCCCHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             838-987178887124777668-999999999999999999971212432122444330258999999987089999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHH-HHHH---HHHHHHH-HHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             699999999999986266630046897-5334---5436689-9999999851106789899870772127777883975
Q gi|254780705|r  257 SIVYGILGSAVLINFFKMPRSTALVGG-LILA---LMTLPSI-IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPL  331 (425)
Q Consensus       257 SIv~Gl~gl~~~~~~~~~~~~~~l~g~-~~l~---~m~lP~i-~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~  331 (425)
                      +.......+..+..-+|-  ...+++- +++.   +..+|-+ ....-.+         -.+..+|+.+-+-...+..-.
T Consensus       237 ~~~~~~~~~~~~~~~~G~--~~~lA~~~~~~~~~~~~~m~~~G~~~A~~~---------~vG~~lGa~~~~~a~~~~~~~  305 (412)
T TIGR00797       237 LESLSFALVALLVARLGG--SIALAAHQVALNVESLLFMPAFGLGIAVSI---------LVGQALGAGDPKRAKEVARVA  305 (412)
T ss_pred             HHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHCCCCHHHHHHHHHHH
T ss_conf             999999999999873167--324677899999999999999899999999---------999985146878999999999


Q ss_pred             HHHHHHHHHHHHHHHHH-HHH---HHHHHH
Q ss_conf             33258999999999987-677---999998
Q gi|254780705|r  332 AMPAILTGSTVSLARAL-GET---APLLFV  357 (425)
Q Consensus       332 a~pgi~~g~il~~~ra~-GEt---a~ll~~  357 (425)
                      .+=|+.-+.++++--.+ .|.   -+-+++
T Consensus       306 ~~~~~~~~~~~~~~~~~~~~~g~Pi~~lFt  335 (412)
T TIGR00797       306 LKLSLLLGLVLAIILILFREVGLPIARLFT  335 (412)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHC
T ss_conf             999999999999999983023642455507


No 99 
>PRK11660 putative sulfate transporter YchM; Provisional
Probab=68.27  E-value=5.7  Score=18.57  Aligned_cols=15  Identities=20%  Similarity=0.109  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             332589999999999
Q gi|254780705|r  332 AMPAILTGSTVSLAR  346 (425)
Q Consensus       332 a~pgi~~g~il~~~r  346 (425)
                      ...||.-|+++++.-
T Consensus       426 l~~gI~vGv~ls~~l  440 (567)
T PRK11660        426 MVIAISVGIVLASLL  440 (567)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 100
>COG1033 Predicted exporters of the RND superfamily [General function prediction only]
Probab=55.35  E-value=13  Score=16.21  Aligned_cols=13  Identities=38%  Similarity=0.447  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9876779999985
Q gi|254780705|r  346 RALGETAPLLFVG  358 (425)
Q Consensus       346 ra~GEta~ll~~~  358 (425)
                      +++-|.+..+-+|
T Consensus       319 ~~i~~~Gi~~siG  331 (727)
T COG1033         319 PAIKEFGILLSIG  331 (727)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             8999999999999


No 101
>TIGR00883 2A0106 MFS transporter, metabolite:H+ symporter (MHS) family protein; InterPro: IPR004736   Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters. Two such families have been found to occur ubiquitously in all classifications of living organisms. These are the ATP-binding cassette (ABC) superfamily and the major facilitator superfamily (MFS), also called the uniporter-symporter-antiporter family. While ABC family permeases are in general multicomponent primary active transporters, capable of transporting both small molecules and macromolecules in response to ATP hydrolysis the MFS transporters are single-polypeptide secondary carriers capable only of transporting small solutes in response to chemiosmotic ion gradients. Although well over 100 families of transporters have now been recognized and classified, the ABC superfamily and MFS account for nearly half of the solute transporters encoded within the genomes of microorganisms. They are also prevalent in higher organisms. The importance of these two families of transport systems to living organisms can therefore not be overestimated .   The MFS was originally believed to function primarily in the uptake of sugars but subsequent studies revealed that drug efflux systems, Krebs cycle metabolites, organophosphate:phosphate exchangers, oligosaccharide:H1 symport permeases, and bacterial aromatic acid permeases were all members of the MFS. These observations led to the probability that the MFS is far more widespread in nature and far more diverse in function than had been thought previously. 17 subgroups of the MFS have been identified .   Evidence suggests that the MFS permeases arose by a tandem intragenic duplication event in the early prokaryotes. This event generated a 2-transmembrane-spanner (TMS) protein topology from a primordial 6-TMS unit. Surprisingly, all currently recognized MFS permeases retain the two six-TMS units within a single polypeptide chain, although in 3 of the 17 MFS families, an additional two TMSs are found . Moreover, the well-conserved MFS specific motif between TMS2 and TMS3 and the related but less well conserved motif between TMS8 and TMS9  prove to be a characteristic of virtually all of the more than 300 MFS proteins identified.   This entry represents the metabolite-H(+) symport (MHS) subfamily of the MFS. Members include citrate-proton symporters , alpha-ketoglutarate permease , shikimate transporters , and the proline/betaine transporter ProP .; GO: 0005215 transporter activity, 0006810 transport, 0016021 integral to membrane.
Probab=55.22  E-value=14  Score=16.20  Aligned_cols=168  Identities=23%  Similarity=0.251  Sum_probs=93.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCH--------------------------HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999998745664112202321344321101--------------------------202667899999999999999
Q gi|254780705|r  168 QWKWFQKLDSDGALFLDFNYGFFINGASSRPEV--------------------------AGIGVAVVGSLYMMLIVIGLS  221 (425)
Q Consensus       168 ql~~~d~L~~~g~i~~~fn~~f~t~~~s~~~e~--------------------------~Gi~~ai~gTl~~~~ia~~ia  221 (425)
                      -++|+|...------.-||..||-+.|+..+..                          -|=...++=|+++|.++++.-
T Consensus         3 ~~EwfDF~lYg~~A~lvf~~~Ffp~~dp~~~~~~~~atFa~gFl~RP~Gg~~FG~~GDr~GRk~~L~~tl~~Mg~~T~~I   82 (413)
T TIGR00883         3 AVEWFDFYLYGFAAVLVFNTFFFPSGDPLVALLATFATFAVGFLARPLGGIVFGHFGDRIGRKKTLVITLLMMGIGTVLI   82 (413)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             15788789999999997300278988827899999999999999988999999886323546999999999985766531


Q ss_pred             HH------HHH----------------------HHHHHHHHHCCCHH---HHHHHHHHHHHHHHHHHHHHHHH-HHHH--
Q ss_conf             99------999----------------------99999986437302---45678989988765336999999-9999--
Q gi|254780705|r  222 FP------LGI----------------------ASAIYLEEFSHKGF---FSSFVQANINNLASVPSIVYGIL-GSAV--  267 (425)
Q Consensus       222 ~p------igv----------------------~~aiyl~e~a~~~~---~~~~i~~~i~~la~vPSIv~Gl~-gl~~--  267 (425)
                      --      ||+                      ++++|+.|+||++|   ..++.+.         +-..|++ +.++  
T Consensus        83 GLlPsY~~IG~~APiLL~~~Rl~QGfs~GGE~gGaa~~~~E~A~~gkRG~~gSf~~~---------g~~~G~llA~l~~~  153 (413)
T TIGR00883        83 GLLPSYATIGIWAPILLLLARLIQGFSLGGEWGGAALYLVESAPPGKRGFYGSFQQV---------GAPVGLLLAALVVL  153 (413)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH---------HHHHHHHHHHHHHH
T ss_conf             224760117789999999999984356789999999999975002203788889998---------67899999999999


Q ss_pred             HHH-HHCCCC-------CHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH---C---CCHHHHHHHHHHHHHH
Q ss_conf             998-626663-------0046897533454366899999999851106789899870---7---7212777788397533
Q gi|254780705|r  268 LIN-FFKMPR-------STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL---G---ASKVQTVFHHVLPLAM  333 (425)
Q Consensus       268 ~~~-~~~~~~-------~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~L---G---as~~~~~~~v~lp~a~  333 (425)
                      .++ .++...       .-|..-+++|.+.     .-..|..+++-|.--++....-   |   ++=++++.||.-+   
T Consensus       154 ~~s~~~~~~~P~~~WGWRiPFl~s~~l~~~-----gL~lR~~L~Et~~f~~~~~~~~~~~~~~~~p~~~~~~~~~~~---  225 (413)
T TIGR00883       154 LLSYLLGDEAPLLEWGWRIPFLVSAVLVLI-----GLYLRRNLEETPVFEKAQEKHKTRTGKKRIPLAELLTKHRKA---  225 (413)
T ss_pred             HHHHHHCCCCCHHHCCCHHHHHHHHHHHHH-----HHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHCHHH---
T ss_conf             999972665203310314589999999999-----999816564577999988521253037674099998722299---


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2589999999999876779999985
Q gi|254780705|r  334 PAILTGSTVSLARALGETAPLLFVG  358 (425)
Q Consensus       334 pgi~~g~il~~~ra~GEta~ll~~~  358 (425)
                            .+++.+-.++++..-.++.
T Consensus       226 ------~~~~~~~~~~~~~~fY~~t  244 (413)
T TIGR00883       226 ------FLLVLGLVIATTTTFYLIT  244 (413)
T ss_pred             ------HHHHHHHHHHHHHHHHHHH
T ss_conf             ------9999999999899999999


No 102
>KOG3787 consensus
Probab=54.28  E-value=14  Score=16.10  Aligned_cols=150  Identities=21%  Similarity=0.261  Sum_probs=67.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             32110120266789999999----99999999999999999986437302456789899887653369999999999998
Q gi|254780705|r  195 SSRPEVAGIGVAVVGSLYMM----LIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN  270 (425)
Q Consensus       195 s~~~e~~Gi~~ai~gTl~~~----~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~  270 (425)
                      ++-.|.+.+.--+..+|--+    ...+..-.|+|+..=|.=.-..-+. +....   -.+.-=+=+++.|++--++.+-
T Consensus       208 g~lG~~g~~lv~FF~~L~e~iMklV~~iMWy~PvGI~fLIagkIlem~D-l~~~~---~~Lg~Yv~TVi~GL~iH~~i~l  283 (507)
T KOG3787         208 GKLGEKGQVLVDFFNSLNEAIMKLVSWIMWYSPVGILFLIAGKILEMED-LGVTA---RQLGMYVVTVILGLFIHGFIVL  283 (507)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCC-HHHHH---HHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8523001799999999999999999999998035489999776612356-99999---9988999999999999998886


Q ss_pred             ---HHCCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---6266630046--89753345436689999999985110678989987077212777788397533258999999999
Q gi|254780705|r  271 ---FFKMPRSTAL--VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLA  345 (425)
Q Consensus       271 ---~~~~~~~~~l--~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~  345 (425)
                         +|-..+.+|+  .+|+.-++++    .-.|..+=...|-..|----.+|.-|--|  +.+||..      ++|--=|
T Consensus       284 PliYF~~TrkNP~~f~~Gm~Qal~T----A~gTsSSsATLPitfkCleEn~gVD~RiT--RFVLPvG------ATINMDG  351 (507)
T KOG3787         284 PLIYFVVTRKNPFRFIAGLLQALAT----AFGTASSSATLPITFKCLEENLGVDKRVT--RFVLPVG------ATINMDG  351 (507)
T ss_pred             HHEEEEEECCCHHHHHHHHHHHHHH----HHHCCCCCCCCHHHHHHHHHHCCCCCCEE--EEECCCC------CEECCCH
T ss_conf             5304778746818999989999999----97504554542277999987189872302--3650357------5435774


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             987677999998543
Q gi|254780705|r  346 RALGETAPLLFVGMV  360 (425)
Q Consensus       346 ra~GEta~ll~~~~~  360 (425)
                      -|+=|..+.+|++-.
T Consensus       352 tALYEAVAaIFIAQl  366 (507)
T KOG3787         352 TALYEAVAAIFIAQL  366 (507)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             899999999999997


No 103
>PRK10555 aminoglycoside/multidrug efflux system; Provisional
Probab=53.41  E-value=14  Score=16.01  Aligned_cols=27  Identities=19%  Similarity=0.359  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999999999999974104
Q gi|254780705|r  398 GAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       398 aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      |.++--++-++++-.+-.++.||+.+|
T Consensus      1007 GL~~st~ltL~~vP~ly~l~~r~~~~~ 1033 (1037)
T PRK10555       1007 GMISATILAIFFVPLFFVLVRRRFPLK 1033 (1037)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             999999999999999999988056899


No 104
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345   Members of this entry belong to the family of polysaccharide chain length determinant proteins. They are found in species that encode the PEP-CTERM/exosortase system and are predicted to act in protein sorting in a number of Gram-negative bacteria, they are also found near the epsH homologue that is the putative exosortase gene..
Probab=52.69  E-value=14  Score=16.06  Aligned_cols=39  Identities=15%  Similarity=0.231  Sum_probs=25.0

Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHH
Q ss_conf             98707721277778839753325----------8999999999987677
Q gi|254780705|r  313 ALGLGASKVQTVFHHVLPLAMPA----------ILTGSTVSLARALGET  351 (425)
Q Consensus       313 a~~LGas~~~~~~~v~lp~a~pg----------i~~g~il~~~ra~GEt  351 (425)
                      |--+..+.-.+-|+|+=|...|-          +..|+++|+|-++|=+
T Consensus       396 S~~~e~~~~~v~FRviDPP~~P~~PsgP~R~ll~~~~~~~Glg~G~gl~  444 (510)
T TIGR03007       396 SKQMEVQDKAVSFRVIDPPIVPSKPSGPNRPLLLLAVLLGGLGAGIGLA  444 (510)
T ss_pred             HHHEEEECCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             3303320670246775675678999987889999999999999999999


No 105
>COG0598 CorA Mg2+ and Co2+ transporters [Inorganic ion transport and metabolism]
Probab=50.66  E-value=16  Score=15.74  Aligned_cols=31  Identities=19%  Similarity=0.402  Sum_probs=18.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6650069999999999999999999999999997
Q gi|254780705|r  387 DAERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       387 ~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                      .|+..+   .+|-.++|.+++++.-+...|+|||
T Consensus       289 mPel~~---~~Gy~~~l~~m~~~~~~~~~~frrk  319 (322)
T COG0598         289 MPELDW---PYGYPIALILMLLLALLLYLYFRRK  319 (322)
T ss_pred             CCCCCC---CHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             988788---2589999999999999999999983


No 106
>COG1291 MotA Flagellar motor component [Cell motility and secretion]
Probab=50.43  E-value=16  Score=15.72  Aligned_cols=194  Identities=19%  Similarity=0.193  Sum_probs=87.5

Q ss_pred             HHHHHHHHHHHHHHHHHCC-CCCEEEEEEEEEEEECHHHHCCCCCCCCCHHHHHCCCHHHHHHH---HHHHHCCCCCCCH
Q ss_conf             9999999999999976144-46216899999873088890657656679888630458999999---9996314566660
Q gi|254780705|r   29 VLVVFVFLILLLSSIVSKG-IGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRK---ALARKLSISDSNH  104 (425)
Q Consensus        29 I~ial~fL~~Ll~sI~s~G-~~AF~qT~I~l~V~~d~~~id~~~~~~~d~~~l~~~~~~~li~~---aL~~~~p~~~~~r  104 (425)
                      |.+-+.|.+++..-+...| ..+|.|-.         +.+=.-+..   -.....++--+.+++   .+...|.  ...+
T Consensus         7 iGlvl~~~~i~~G~i~~Gg~~~~l~~~~---------s~lII~gg~---i~A~~~~~p~~~vk~~~k~~~~~F~--~~k~   72 (266)
T COG1291           7 IGLVLAFGSVLGGYILGGGSLGALIQPS---------SLLIIVGGG---IGAFMVGNPGKVVKATPKALKEAFR--KPKK   72 (266)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCC---------HHHEEECHH---HHHHHHCCCHHHHHHHHHHHHHHHH--CCCH
T ss_conf             9999999999998972688623540512---------332030215---7898862868999999999999984--5762


Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHCHHHCCCEEEEEEEECCCCHHHHCCCCC----C--CCHHCCCCHHHHHHHHHHHHH
Q ss_conf             3489899873001689999997406321597478999704530233034556----5--300005999999999999874
Q gi|254780705|r  105 ALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY----S--PANVHRMSDYQWKWFQKLDSD  178 (425)
Q Consensus       105 ~~kr~l~~liS~~a~~~Lrd~v~~np~liG~t~~~~llAsddvD~~~KG~i~----r--~e~~rrisd~ql~~~d~L~~~  178 (425)
                      .+..++...+.+-+..-=|+=+..--+          .+++..|-+.|..+.    .  |+.-|-+-|.++...++=.++
T Consensus        73 ~~~~~li~~l~~la~~~Rk~GllaLE~----------~~~~~~d~Fi~~glrliVdG~~~~~I~~~me~Ei~~~ee~~~~  142 (266)
T COG1291          73 EDYVDLIALLYELAEKARKEGLLALEA----------LADEIEDPFIKDGLRLIVDGNDPEEIEALMEEEIETMEERHEK  142 (266)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH----------HHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             029999999999999998701877998----------8862414589966798715898899999999999999998753


Q ss_pred             HHHHHCCCCHHHCCCCCCC---------------------CC--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5664112202321344321---------------------10--120266789999999999999999999999999864
Q gi|254780705|r  179 GALFLDFNYGFFINGASSR---------------------PE--VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF  235 (425)
Q Consensus       179 g~i~~~fn~~f~t~~~s~~---------------------~e--~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~  235 (425)
                      +.       ..|+......                     |+  ..+|..|++||+|=++.|-.+-.|++-----.-.+ 
T Consensus       143 ~a-------~~~~~~g~~aPa~GivgaV~GlI~~l~~l~~p~~LG~~iA~Alv~T~~Gi~~ay~~~~P~a~kLk~~~~~-  214 (266)
T COG1291         143 PA-------HAFTTAGDYAPAFGIVGAVMGLIHALGNLDDPAELGALIAAALVGTLYGIFLAYGLFGPLANKLKQKSDE-  214 (266)
T ss_pred             HH-------HHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-
T ss_conf             89-------9999988458266699999999999882799788888999999999999999989786889999888899-


Q ss_pred             CCCHHHH-HHHHHHHHHHHHHH
Q ss_conf             3730245-67898998876533
Q gi|254780705|r  236 SHKGFFS-SFVQANINNLASVP  256 (425)
Q Consensus       236 a~~~~~~-~~i~~~i~~la~vP  256 (425)
                        +.++. -++|..+...+|-+
T Consensus       215 --e~~~~~~i~e~ll~i~~G~n  234 (266)
T COG1291         215 --EVKLKEIIIEGLLAIQNGEN  234 (266)
T ss_pred             --HHHHHHHHHHHHHHHHCCCC
T ss_conf             --99999999999999954899


No 107
>KOG1934 consensus
Probab=49.20  E-value=17  Score=15.60  Aligned_cols=214  Identities=16%  Similarity=0.183  Sum_probs=99.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEECHHHHCCCCCCCCCHHHHHCCCHHHHHHH-----HHHHHCCCC
Q ss_conf             999999999999999997614446216899999873088890657656679888630458999999-----999631456
Q gi|254780705|r   26 VVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRK-----ALARKLSIS  100 (425)
Q Consensus        26 i~AI~ial~fL~~Ll~sI~s~G~~AF~qT~I~l~V~~d~~~id~~~~~~~d~~~l~~~~~~~li~~-----aL~~~~p~~  100 (425)
                      ..-+++-+++++-+..++.  |       ..+++..+|++.+-+++....+...+   ..+....+     -..++ |.+
T Consensus       469 ~vr~~vil~~~~Y~~~a~y--G-------~~~i~~gl~~~kl~~~dS~l~~~~~~---~~~~~~~~~~~v~v~V~n-p~d  535 (868)
T KOG1934         469 KVRLLVILLYLVYLAFAIY--G-------CLNIKEGLDPSKLLPEDSPLVKSLRL---QEKYFWEYGQQVAVFVNN-PPD  535 (868)
T ss_pred             HHHHHHHHHHHHHHHHHHH--H-------HEECCCCCCHHHCCCCCCCCHHHHHH---HHHHHHCCCCEEEEEECC-CCC
T ss_conf             2999999999999999986--3-------33035787877734002744578999---888753357469999818-856


Q ss_pred             CCCHHHHHHHHHHHCCHH-----------HHHHHHHHH----HCHHHCCCEEE------EEEEECCCCHHHHCCCCC---
Q ss_conf             666034898998730016-----------899999974----06321597478------999704530233034556---
Q gi|254780705|r  101 DSNHALLRQASQMLSTTA-----------RYHLRKTLM----TDPSLIGKTVE------VSLLASANIDSALKGYLY---  156 (425)
Q Consensus       101 ~~~r~~kr~l~~liS~~a-----------~~~Lrd~v~----~np~liG~t~~------~~llAsddvD~~~KG~i~---  156 (425)
                      -.+.+..+++.++++.=+           .+-||+|..    .|-.....+.+      -|++.+.+-+.+-+-..-   
T Consensus       536 l~~~~~~~~~~~~~~~fE~~~~~~G~~sT~~wlr~y~~~~~~~~~~~~~~~~~~~~~~~~~fl~~~~~~~~~~di~~~~~  615 (868)
T KOG1934         536 LSNPENRDNLNELVSEFESTPYSMGRESTKFWLREYLNFLFEKNAELEDNDDEFYDHLYESFLKSPEFSFWRNDIVFDNK  615 (868)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEECCC
T ss_conf             79878999999999997438766676520268999999876401224578741100438887435434667654685357


Q ss_pred             -C-----------CCHHCCCCHHHHHH-HHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -5-----------30000599999999-9999874566411220232134432110120266789999999999999999
Q gi|254780705|r  157 -S-----------PANVHRMSDYQWKW-FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP  223 (425)
Q Consensus       157 -r-----------~e~~rrisd~ql~~-~d~L~~~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia~~ia~p  223 (425)
                       .           -.....-+..+..- ...+.+--.-...||..-|....--.....-+.+..+.|...+++++.+.. 
T Consensus       616 ~~~~~~i~~f~f~~~~~~~~~~~~~~~~~~~~R~ia~~~~~fnvtvf~~~~~f~Dq~~~v~~~ti~~~~~a~i~M~~v~-  694 (868)
T KOG1934         616 SDEETIIFAFRFTIGLTNLTKWNERTRLLETWRKIADEYSDFNVTVFDPSFVFLDQYLSVVPVTIQSIVIALICMFLVC-  694 (868)
T ss_pred             CCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHH-
T ss_conf             8887438999999987405878899999999999986456787699247518888998713189999999999999999-


Q ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999864373024567898998876533699999999999
Q gi|254780705|r  224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL  268 (425)
Q Consensus       224 igv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~  268 (425)
                           .++    -|+ ..+.+.     ...++=||=+|.+|+.-+
T Consensus       695 -----~lf----Ip~-~~~~~~-----it~si~SI~~GV~G~lsl  724 (868)
T KOG1934         695 -----FLF----IPN-PLCVFW-----ITLSIVSINIGVFGFLSL  724 (868)
T ss_pred             -----HHH----HCC-HHHHHH-----HHHHHHHEEEHHHHHHHH
T ss_conf             -----999----574-689999-----999876223158565588


No 108
>pfam11189 DUF2973 Protein of unknown function (DUF2973). Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently they have no known function.
Probab=48.22  E-value=14  Score=16.11  Aligned_cols=46  Identities=13%  Similarity=0.101  Sum_probs=27.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEE------EEEEEEECHHHHCCCCCCCC
Q ss_conf             99999999999997614446216899------99987308889065765667
Q gi|254780705|r   30 LVVFVFLILLLSSIVSKGIGALWQTH------ISLPIEFSETIVDPQKKRFM   75 (425)
Q Consensus        30 ~ial~fL~~Ll~sI~s~G~~AF~qT~------I~l~V~~d~~~id~~~~~~~   75 (425)
                      +.++.+|+++-+...++|+.+..+-.      =+-.....||.+|.+|+-..
T Consensus         7 ~~af~~L~~~Afr~m~~g~~~~~~~~~~~~~~rt~~~t~HPEllD~~G~~~~   58 (65)
T pfam11189         7 ILAFTILLWLAFRNMIRGWVAASIESQRLSPDRTGQVTTHPELLDEDGNLTK   58 (65)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHCCCCCCCC
T ss_conf             9999999999999998437650755357887778861588788765898416


No 109
>PRK12482 flagellar motor protein MotA; Provisional
Probab=48.06  E-value=18  Score=15.48  Aligned_cols=30  Identities=27%  Similarity=0.285  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             120266789999999999999999999999
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASA  229 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~a  229 (425)
                      ..+|..|++||+|=.+.|-.+-.|++--..
T Consensus       199 G~~IA~ALVgTfyGi~lAy~~~~PiA~kLk  228 (287)
T PRK12482        199 GLKVAAALVGTFLGVFICYCLMDPLSNAME  228 (287)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999998988999999


No 110
>COG0659 SUL1 Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism]
Probab=47.65  E-value=18  Score=15.44  Aligned_cols=19  Identities=26%  Similarity=0.436  Sum_probs=8.4

Q ss_pred             CCCHHHHHHHHHHHHHHHH
Q ss_conf             1101202667899999999
Q gi|254780705|r  197 RPEVAGIGVAVVGSLYMML  215 (425)
Q Consensus       197 ~~e~~Gi~~ai~gTl~~~~  215 (425)
                      .|..+|++.+++|.+...+
T Consensus        48 v~p~~GLyas~i~~~v~al   66 (554)
T COG0659          48 VPPEAGLYASIVAGIIYAL   66 (554)
T ss_pred             CCHHHHHHHHHHHHHHHHH
T ss_conf             9869889999999999998


No 111
>pfam10140 essB Predicted membrane protein essB. Members of this family of prokaryotic proteins include the virulence factor essB, which is required for the synthesis and secretion of EsxA and EsxB, both ESAT-6 like proteins.
Probab=47.34  E-value=18  Score=15.41  Aligned_cols=24  Identities=8%  Similarity=-0.116  Sum_probs=15.5

Q ss_pred             CCEEEEEEEECCCCHHHHCCCCCC
Q ss_conf             974789997045302330345565
Q gi|254780705|r  134 GKTVEVSLLASANIDSALKGYLYS  157 (425)
Q Consensus       134 G~t~~~~llAsddvD~~~KG~i~r  157 (425)
                      =.+.++-+..+..+-..|.|.-+.
T Consensus        83 l~PeNl~f~~~~~p~~~hrGik~~  106 (359)
T pfam10140        83 LHPENLVFDKGLTPKFIHRGVKES  106 (359)
T ss_pred             ECCCEEEEECCCCEEEEECCCCCC
T ss_conf             737437981798579886276667


No 112
>COG3135 BenE Uncharacterized protein involved in benzoate metabolism [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=44.70  E-value=20  Score=15.16  Aligned_cols=21  Identities=29%  Similarity=0.317  Sum_probs=7.2

Q ss_pred             CCHHHH-HHHHHH-HHHHHHHHC
Q ss_conf             999999-999999-874566411
Q gi|254780705|r  164 MSDYQW-KWFQKL-DSDGALFLD  184 (425)
Q Consensus       164 isd~ql-~~~d~L-~~~g~i~~~  184 (425)
                      .|+.|. .|+-.+ ..+|....+
T Consensus        50 as~aq~aSwl~al~l~mGv~ti~   72 (402)
T COG3135          50 ASPAQIASWLTALGLAMGVSTLT   72 (402)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98789999999999999998888


No 113
>pfam02392 Ycf4 Ycf4. This family consists of hypothetical Ycf4 proteins from various chloroplast genomes. It has been suggested that Ycf4 is involved in the assembly and/or stability of the photosystem I complex in chloroplasts.
Probab=41.60  E-value=19  Score=15.33  Aligned_cols=30  Identities=17%  Similarity=0.433  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             9999999999999999999999761444621
Q gi|254780705|r   21 FRFYCVVAVLVVFVFLILLLSSIVSKGIGAL   51 (425)
Q Consensus        21 Fr~yGi~AI~ial~fL~~Ll~sI~s~G~~AF   51 (425)
                      ..+||++++++++-..+++++++.+ ||.-|
T Consensus        63 M~FYGi~gl~ls~Ylw~tI~wdVG~-GyNeF   92 (180)
T pfam02392        63 MCFYGIAGLLLSLYLWLTIFWNVGS-GYNEF   92 (180)
T ss_pred             HHHHHHHHHHHHHHHHHHHEEECCC-CCCCC
T ss_conf             6568899999999998751153257-64420


No 114
>CHL00036 ycf4 photosystem I assembly protein Ycf4
Probab=41.49  E-value=20  Score=15.06  Aligned_cols=30  Identities=17%  Similarity=0.351  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             9999999999999999999999761444621
Q gi|254780705|r   21 FRFYCVVAVLVVFVFLILLLSSIVSKGIGAL   51 (425)
Q Consensus        21 Fr~yGi~AI~ial~fL~~Ll~sI~s~G~~AF   51 (425)
                      ..+||++++++++-..+++++++.+ ||.-|
T Consensus        66 M~FYGi~gl~ls~Ylw~tI~w~VG~-GyN~F   95 (184)
T CHL00036         66 MCFYGIAGLFISSYLWCTILWNVGS-GYNEF   95 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHEEECCC-CCCCC
T ss_conf             6578899999999998863032257-64311


No 115
>PRK08990 flagellar motor protein PomA; Reviewed
Probab=41.03  E-value=22  Score=14.80  Aligned_cols=35  Identities=17%  Similarity=0.311  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             12026678999999999999999999999999986
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE  234 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e  234 (425)
                      ..|+..|+++|+|=+++|-++..|++--.-...++
T Consensus       176 G~~mA~ALvtTlYGillAnl~~~PiA~KL~~~~~~  210 (253)
T PRK08990        176 GPAMAVALLTTLYGAVLANMVAIPIADKLSLRMGE  210 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98889999999999999999999999999989999


No 116
>PRK08124 flagellar motor protein MotA; Validated
Probab=40.73  E-value=23  Score=14.77  Aligned_cols=34  Identities=18%  Similarity=0.056  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1202667899999999999999999999999998
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE  233 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~  233 (425)
                      ..|+..|+++|+|=+++|-++..|++--.....+
T Consensus       180 G~~mA~ALvtT~yGvllAn~~~~PiA~kl~~~~~  213 (263)
T PRK08124        180 GHAISAAFVATLLGIFTGYVLWHPFANKLKRKSK  213 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9889999999999999999999889999998999


No 117
>PRK02542 photosystem I assembly protein Ycf4; Provisional
Probab=40.69  E-value=20  Score=15.14  Aligned_cols=32  Identities=19%  Similarity=0.310  Sum_probs=24.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             999999999999999999999997614446216
Q gi|254780705|r   20 LFRFYCVVAVLVVFVFLILLLSSIVSKGIGALW   52 (425)
Q Consensus        20 rFr~yGi~AI~ial~fL~~Ll~sI~s~G~~AF~   52 (425)
                      -..+||++++.+++-..+++++++.+ ||.-|-
T Consensus        69 vM~FYGi~gl~ls~Ylw~~I~wdVG~-GyNeFd  100 (188)
T PRK02542         69 AMGFYGVAATLLASYLWLVIAIDVGG-GYNEFD  100 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHEEECCC-CCCCCC
T ss_conf             99898899999999998751264246-664110


No 118
>TIGR00879 SP MFS transporter, sugar porter (SP) family; InterPro: IPR003663   The sugar transporters belong to a superfamily of membrane proteins responsible for the binding and transport of various carbohydrates, organic alcohols, and acids in a wide range of prokaryotic and eukaryotic organisms . These integral membrane proteins are predicted to comprise twelve membrane spanning domains. It is likely that the transporters have evolved from an ancient protein present in living organisms before the divergence into prokaryotes and eukaryotes . In mammals, these proteins are expressed in a number of organs .   This family includes just the sugar transporters. ; GO: 0005351 sugar:hydrogen ion symporter activity, 0008643 carbohydrate transport, 0016020 membrane.
Probab=37.94  E-value=25  Score=14.49  Aligned_cols=179  Identities=18%  Similarity=0.186  Sum_probs=88.8

Q ss_pred             HHHHHHHHHHHHHH---HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------H-H-----HCCCCC---
Q ss_conf             99999999999999---9998643730245678989988765336999999999999------8-6-----266630---
Q gi|254780705|r  216 IVIGLSFPLGIASA---IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI------N-F-----FKMPRS---  277 (425)
Q Consensus       216 ia~~ia~pigv~~a---iyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~------~-~-----~~~~~~---  277 (425)
                      -=++.++++|+..+   .|++|.||++ ++...-...++     .|++|++.-..+-      . .     .+++-.   
T Consensus       196 gR~l~G~g~G~~s~~~P~Y~sE~AP~~-lRG~~~~~~ql-----~~t~G~l~a~~~~~~~A~~~~~~~~~~~~w~~~~g~  269 (572)
T TIGR00879       196 GRVLLGIGVGIASALVPMYISEIAPKA-LRGALVSLYQL-----AITIGILVAYGFGYGLANSGTVSLNNTLGWRIPLGL  269 (572)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHH-HCCHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             999999853189998999897338565-57401257899-----999999999999999987665521232222156677


Q ss_pred             -HHHHHHHHHHHHHHHHH---------------------------HHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             -04689753345436689---------------------------99999998511067898998707721277778839
Q gi|254780705|r  278 -TALVGGLILALMTLPSI---------------------------IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVL  329 (425)
Q Consensus       278 -~~l~g~~~l~~m~lP~i---------------------------~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~l  329 (425)
                       ...++-+.+.+..+|=.                           .....+-++.+..+.+........+ |..+++..-
T Consensus       270 ~~~~~~~~~~~~~~~PeSPrwLv~k~~~~~~A~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~l~~~~~  348 (572)
T TIGR00879       270 QLIPAALLFLGLFFLPESPRWLVEKGKVEEFARKSLARLRGTSSEDKEILDELELIDIARSIEKEQVNQS-WGELFSLKR  348 (572)
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHCCC
T ss_conf             7899999999998731214667516765888899999754897424789999998876545656532543-146662178


Q ss_pred             H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             7-533258999999999987677999998543210136656134455799999986036650069999999999999999
Q gi|254780705|r  330 P-LAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA  408 (425)
Q Consensus       330 p-~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~  408 (425)
                      . .-.+-++.|++|...+=        ++|.++. -           ==+..||..++..+   .+......++.-.+-+
T Consensus       349 ~~~~~~~~~~g~~l~~~qQ--------~~GiN~~-~-----------YY~~~if~~~G~~~---~~~~~~~si~~g~~n~  405 (572)
T TIGR00879       349 RKVERRRLFLGVVLQAFQQ--------FTGINAI-M-----------YYSPTIFENAGVST---TDTAFLVSIIVGAVNF  405 (572)
T ss_pred             CHHHHHHHHHHHHHHHHHH--------HHHHHHH-H-----------HHHHHHHHHHCCCH---HHHHHHHHHHHHHHHH
T ss_conf             5246889999999999876--------4314514-5-----------10679999717740---2357766789999999


Q ss_pred             HHHHHHHHHHHHHHCC
Q ss_conf             9999999999974104
Q gi|254780705|r  409 VINTAMLWLRNRFKKR  424 (425)
Q Consensus       409 ~~n~~a~~lr~r~~~~  424 (425)
                      ...+.|.++.+|+-||
T Consensus       406 ~~T~~a~~~vd~~GRr  421 (572)
T TIGR00879       406 IFTFVAIFLVDRFGRR  421 (572)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999998443057


No 119
>PRK10503 multidrug efflux system subunit MdtB; Provisional
Probab=36.49  E-value=26  Score=14.35  Aligned_cols=22  Identities=18%  Similarity=0.566  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999999999999999974104
Q gi|254780705|r  403 LLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       403 Ll~~~~~~n~~a~~lr~r~~~~  424 (425)
                      +-++-..++=++.++|+||+||
T Consensus      1015 vP~lY~l~~~~~~~~~~~~~~~ 1036 (1040)
T PRK10503       1015 TPVIYLLFDRLALWTKSRFARH 1036 (1040)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999999999987754445


No 120
>COG3859 Predicted membrane protein [Function unknown]
Probab=35.94  E-value=27  Score=14.29  Aligned_cols=52  Identities=19%  Similarity=0.211  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCHH-HHHHH--HHHHC----CCHHHHHHHHHHHHHHHHH
Q ss_conf             33454366899999999851106-78989--98707----7212777788397533258
Q gi|254780705|r  285 ILALMTLPSIIIATGVALRTVPS-SIRSA--ALGLG----ASKVQTVFHHVLPLAMPAI  336 (425)
Q Consensus       285 ~l~~m~lP~i~~~~~~al~~vp~-~~~ea--a~~LG----as~~~~~~~v~lp~a~pgi  336 (425)
                      -.+++++|..+.+-|-++++=-- .+.-+  .+.+|    .++.|.+..-.+|...=|+
T Consensus        36 SvslgmIPi~liafRrG~kaG~~tGLl~Gll~~i~G~~Y~lhpsQ~~ldYilaf~~iG~   94 (185)
T COG3859          36 SVSLGMIPILLIAFRRGLKAGLLTGLLWGLLHLILGKAYILHPSQVLLDYILAFMAIGF   94 (185)
T ss_pred             CEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             20237877999999863488789899999999971735533589999971179999899


No 121
>TIGR01113 mtrE tetrahydromethanopterin S-methyltransferase, subunit E; InterPro: IPR005780    This model describes N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit E in methanogenic archaea. This methyltranferase is a membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump.  5-methyl-5,6,7,8-tetrahydromethanopterin + 2-mercaptoethanesulphonate = 5,6,7,8-tetrahydromethanopterin + 2-(methylthio)ethanesulphonate.  Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase (encoded by subunit A) is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of methyl-coenzyme M by another enzyme, methyl-coenzyme M reductase.; GO: 0030269 tetrahydromethanopterin S-methyltransferase activity, 0006814 sodium ion transport, 0005737 cytoplasm, 0012506 vesicle membrane.
Probab=35.76  E-value=27  Score=14.28  Aligned_cols=64  Identities=23%  Similarity=0.295  Sum_probs=43.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHH-H----HHHHHHHHHH--HHHHHHH
Q ss_conf             0599999999999987456641122023213443211012026678999999999-9----9999999999--9999986
Q gi|254780705|r  162 HRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLI-V----IGLSFPLGIA--SAIYLEE  234 (425)
Q Consensus       162 rrisd~ql~~~d~L~~~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~i-a----~~ia~pigv~--~aiyl~e  234 (425)
                      +.-|.-||+=     .+|.+++-||+     .-|-||-.++.+.++-||+-.+++ .    .++|+-+|..  +-|+++ 
T Consensus        29 NPNSQVQLAP-----QMgn~HR~FNK-----AISGEPvsY~l~c~iaG~va~v~m~~~~Lp~~~Ala~Ga~iaA~vH~~-   97 (298)
T TIGR01113        29 NPNSQVQLAP-----QMGNLHRYFNK-----AISGEPVSYGLYCAIAGAVAYVLMSEFGLPPILALAVGAVIAALVHLA-   97 (298)
T ss_pred             CCCHHHCCCC-----CCCCHHHHHHH-----HHCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH-
T ss_conf             8860212530-----03764257630-----103682236788878999999999732736999999999999999999-


Q ss_pred             HC
Q ss_conf             43
Q gi|254780705|r  235 FS  236 (425)
Q Consensus       235 ~a  236 (425)
                      ||
T Consensus        98 yA   99 (298)
T TIGR01113        98 YA   99 (298)
T ss_pred             HH
T ss_conf             99


No 122
>PRK09110 flagellar motor protein MotA; Validated
Probab=35.62  E-value=27  Score=14.26  Aligned_cols=35  Identities=34%  Similarity=0.434  Sum_probs=27.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             12026678999999999999999999999999986
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE  234 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e  234 (425)
                      ..+|..|+++|+|=++.|-++-.|++--...+-+|
T Consensus       199 G~~mAvALvtT~YGv~lAn~i~~PiA~kL~~~~~~  233 (283)
T PRK09110        199 GALIGAALVGTFLGILLAYGFVGPLAAKLEQVVEE  233 (283)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88999999999999999999999999999988999


No 123
>PRK06926 flagellar motor protein MotP; Reviewed
Probab=34.16  E-value=29  Score=14.12  Aligned_cols=33  Identities=18%  Similarity=0.195  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             120266789999999999999999999999999
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL  232 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl  232 (425)
                      ..|+..|+++|+|=+++|-++-.|++--.-..-
T Consensus       184 G~~mAvALvtTlYGv~lAn~~f~PiA~KL~~~~  216 (272)
T PRK06926        184 GPNMAVALLTTLYGTLLANLVFIPIAAKLEEKT  216 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             888899999999999999999988999999888


No 124
>pfam04206 MtrE Tetrahydromethanopterin S-methyltransferase, subunit E. The N5-methyltetrahydromethanopterin: coenzyme M (EC:2.1.1.86) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump.
Probab=33.71  E-value=29  Score=14.07  Aligned_cols=57  Identities=23%  Similarity=0.261  Sum_probs=41.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHH
Q ss_conf             99999999999874566411220232134432110120266789999999999-----99999999999999
Q gi|254780705|r  165 SDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIV-----IGLSFPLGIASAIY  231 (425)
Q Consensus       165 sd~ql~~~d~L~~~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia-----~~ia~pigv~~aiy  231 (425)
                      |..|+.=     ++|.+.+-||+     ..|-+|...|.|-++-|++-.+++.     .++++.+|-..|-+
T Consensus        32 SQVQLAP-----Qmg~~HR~fNK-----AiSGEP~aygl~c~i~g~vA~~l~~~~~~~~ilai~~Ga~vaa~   93 (269)
T pfam04206        32 SQVQLAP-----QMGNLHRIFNK-----AISGEPVSYGLYCGIAGAVAYVLMSYFGLPPLIALAVGAGIAAL   93 (269)
T ss_pred             CHHHCCH-----HCCCHHHHHHH-----HCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             1411060-----00759998624-----10589825678899879999999997384189999998899999


No 125
>PRK00972 tetrahydromethanopterin S-methyltransferase subunit E; Provisional
Probab=33.12  E-value=30  Score=14.01  Aligned_cols=57  Identities=26%  Similarity=0.264  Sum_probs=40.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHH
Q ss_conf             99999999999874566411220232134432110120266789999999999----99999999999999
Q gi|254780705|r  165 SDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIV----IGLSFPLGIASAIY  231 (425)
Q Consensus       165 sd~ql~~~d~L~~~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~ia----~~ia~pigv~~aiy  231 (425)
                      |..|+.=     ++|.+++-||+     ..|-+|...|.|-++-|+..-+++.    .++++.+|-..|-+
T Consensus        39 SQVQLAP-----QmG~~HR~fNK-----AiSGEP~aygl~~~i~g~va~~l~~~~~~~ilAi~~Gs~vaa~   99 (293)
T PRK00972         39 SQVQLAP-----QMGNIHRIFNK-----AISGEPVSYGLWCAIAGAVAWALITFGLNPLLAIIVGSLVAAF   99 (293)
T ss_pred             CHHHCCH-----HCCCHHHHHHH-----HCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             1412060-----10649998734-----1058981678899988999999998584099999998899999


No 126
>pfam03594 BenE Benzoate membrane transport protein.
Probab=32.75  E-value=30  Score=13.97  Aligned_cols=14  Identities=29%  Similarity=0.361  Sum_probs=6.6

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             27777883975332
Q gi|254780705|r  321 VQTVFHHVLPLAMP  334 (425)
Q Consensus       321 ~~~~~~v~lp~a~p  334 (425)
                      |+.+..+.+|+..-
T Consensus       205 ~~a~i~lalPL~iv  218 (378)
T pfam03594       205 WQATLSLALPLYLV  218 (378)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999874889999


No 127
>pfam01350 Flavi_NS4A Flavivirus non-structural protein NS4A. Flaviviruses encode a single polyprotein. This is cleaved into three structural and seven non-structural proteins. The NS4A protein is small and poorly conserved among the Flaviviruses. NS4A contains multiple hydrophobic potential membrane spanning regions. NS4A has only been found in cells infected by Kunjin virus.
Probab=31.68  E-value=21  Score=15.01  Aligned_cols=12  Identities=33%  Similarity=0.515  Sum_probs=4.2

Q ss_pred             HHHHHHHHCHHH
Q ss_conf             999998511067
Q gi|254780705|r  297 ATGVALRTVPSS  308 (425)
Q Consensus       297 ~~~~al~~vp~~  308 (425)
                      +-|.|++..|..
T Consensus        37 A~r~A~~elPEA   48 (145)
T pfam01350        37 AYRMALEELPEA   48 (145)
T ss_pred             HHHHHHHHCCHH
T ss_conf             999999868299


No 128
>PRK11410 hypothetical protein; Provisional
Probab=30.61  E-value=33  Score=13.74  Aligned_cols=154  Identities=14%  Similarity=0.122  Sum_probs=80.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCC-------CCCEEEEEEEEEEEECHHHHCCCCCCCCCHHHHHCCCHHHHHHH
Q ss_conf             89999999999999999999999976144-------46216899999873088890657656679888630458999999
Q gi|254780705|r   19 WLFRFYCVVAVLVVFVFLILLLSSIVSKG-------IGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRK   91 (425)
Q Consensus        19 krFr~yGi~AI~ial~fL~~Ll~sI~s~G-------~~AF~qT~I~l~V~~d~~~id~~~~~~~d~~~l~~~~~~~li~~   91 (425)
                      ++.|.||+.++....+..+ .++-....|       .|.--+...++|+..+...||-+.-+-.-...+.-.-.+++..|
T Consensus         8 ~~~~~~g~i~~ga~~~~~a-~~w~~~~~g~g~~~~~~p~~~~~~l~lDL~~PDalids~sLsqLP~DlL~VPlL~dvLTE   86 (570)
T PRK11410          8 KGWRVYGLVAVGAIALLSA-GVWALQYAGSGPEKTLSPLVVHNNLQLDLNEPDALIDSDSLSQLPKDLLTVPLLRDVLTE   86 (570)
T ss_pred             CCCEEECHHHHHHHHHHHC-CHHHEEEECCCCCCCCCCCEEECCCCCCCCCCCHHHCHHHHHHCCHHHHHCHHHHHHHHH
T ss_conf             6522402389889999852-213204305686767886112134344667862212215355572877635377654468


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHCHHHCCCE--EEEEEEECCCCHHHH----CCCCCC---CCHHC
Q ss_conf             999631456666034898998730016899999974063215974--789997045302330----345565---30000
Q gi|254780705|r   92 ALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKT--VEVSLLASANIDSAL----KGYLYS---PANVH  162 (425)
Q Consensus        92 aL~~~~p~~~~~r~~kr~l~~liS~~a~~~Lrd~v~~np~liG~t--~~~~llAsddvD~~~----KG~i~r---~e~~r  162 (425)
                      -+.-.++.. .+|=--.---+.+-..-...++|.+.+  ++.+++  +-+|--++++..-++    +|...+   |...-
T Consensus        87 DFVfYYe~~-~dRL~l~GsLRRiayEH~L~l~D~l~~--~lfdqPA~VaLWRg~dGrL~~fv~~m~R~GLAklLE~la~v  163 (570)
T PRK11410         87 DFVFYYENH-ADRLGLEGSLRRIVYEHDLTLKDKLFE--SLLDQPAQVALWRGADGRLSHFVVLMQRSGLAKLLEPLAFV  163 (570)
T ss_pred             HHHHHHHCC-CHHHCCCHHHHHHHHHHCCCHHHHHHH--HHHCCCCCEEEEECCCCCHHHEEEEEECCHHHHHHHHHHHH
T ss_conf             899998623-034313005777777731862899999--98457400365657999812448888412089998766431


Q ss_pred             CCCHHHHHHHHHHH
Q ss_conf             59999999999998
Q gi|254780705|r  163 RMSDYQWKWFQKLD  176 (425)
Q Consensus       163 risd~ql~~~d~L~  176 (425)
                      -.+|.|++-+..+.
T Consensus       164 A~~D~QLskv~~~s  177 (570)
T PRK11410        164 ATSDSQLSKVEISS  177 (570)
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             36767776654331


No 129
>pfam04172 LrgB LrgB-like family. The two products of the lrgAB operon are potential membrane proteins, and LrgA and LrgB are both thought to control of murein hydrolase activity and penicillin tolerance.
Probab=30.40  E-value=33  Score=13.72  Aligned_cols=40  Identities=20%  Similarity=0.140  Sum_probs=19.2

Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9870772127777883975332589999999999876779
Q gi|254780705|r  313 ALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA  352 (425)
Q Consensus       313 a~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta  352 (425)
                      +-.+|..+.-+..-+++--..-.++.-.++.+-|.=.+-|
T Consensus       126 s~~iGG~~sLta~~viitGi~Ga~~g~~ll~~~~i~~~~a  165 (215)
T pfam04172       126 SESIGGIPALTAVFVILTGILGAILGPPLLKLLGIKHPVA  165 (215)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH
T ss_conf             9996895889999999999899999999999808896888


No 130
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=29.46  E-value=34  Score=13.62  Aligned_cols=99  Identities=20%  Similarity=0.305  Sum_probs=48.3

Q ss_pred             HHHHHHHHHHHHHHHCCCC--------CHHHHHHHHHHHHHHHH--HHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             9999999999998626663--------00468975334543668--9999999985110678989987077212777788
Q gi|254780705|r  258 IVYGILGSAVLINFFKMPR--------STALVGGLILALMTLPS--IIIATGVALRTVPSSIRSAALGLGASKVQTVFHH  327 (425)
Q Consensus       258 Iv~Gl~gl~~~~~~~~~~~--------~~~l~g~~~l~~m~lP~--i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v  327 (425)
                      ..||+.++.+-+..+.+.-        .-.=++|+.+..  +|.  .+---+|.++.-|+.-|-.-++-|.+---.+.-+
T Consensus       110 ~~~~~~al~v~~vvHE~~Hgi~ar~~~i~vkS~G~ll~~--ip~GAFvEpdeee~~~a~~~~r~ri~aAG~~~N~v~~~i  187 (263)
T cd06159         110 LPYGIIALVVGVVVHELSHGILARVEGIKVKSGGLLLLI--IPPGAFVEPDEEELNKADRRIRLRIFAAGVTANFVVALI  187 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCHHHHHH--HCCCCCCCCCHHHHHCCCHHHHHHHHHCCCHHHHHHHHH
T ss_conf             789999999999999888899999818633011567866--164223588979985288154533200360998999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----CCCCCCCCCCHHHHHH
Q ss_conf             39753325899999999998767799999854321----0136656134455799
Q gi|254780705|r  328 VLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF----VTDYPVGVTDIATAFP  378 (425)
Q Consensus       328 ~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~----~~~~p~~~~~p~~tlp  378 (425)
                      .+++..                    ++-++...|    .+-+|.-|+|-+..+-
T Consensus       188 ~~~l~f--------------------l~W~~~iNf~lglfN~lPa~plDGg~v~~  222 (263)
T cd06159         188 AFALFF--------------------LYWIFWINFLLGLFNCLPAIPLDGGHVFR  222 (263)
T ss_pred             HHHHHH--------------------HHHHHHHHHHHHHHHCCCCCCCCCHHHHH
T ss_conf             999999--------------------99999999999998357666576067999


No 131
>pfam00523 Fusion_gly Fusion glycoprotein F0.
Probab=29.40  E-value=34  Score=13.61  Aligned_cols=18  Identities=17%  Similarity=0.303  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999864
Q gi|254780705|r  218 IGLSFPLGIASAIYLEEF  235 (425)
Q Consensus       218 ~~ia~pigv~~aiyl~e~  235 (425)
                      +-+|.--.|.+|+-|.+-
T Consensus        96 LGvATaAqITAgvAL~~a  113 (460)
T pfam00523        96 LGVATAAQITAGVALVKA  113 (460)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             756668889889999998


No 132
>pfam12273 RCR Chitin synthesis regulation, resistance to Congo red. RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5.
Probab=28.67  E-value=35  Score=13.53  Aligned_cols=21  Identities=10%  Similarity=0.597  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999999997614
Q gi|254780705|r   26 VVAVLVVFVFLILLLSSIVSK   46 (425)
Q Consensus        26 i~AI~ial~fL~~Ll~sI~s~   46 (425)
                      +.+|++..+|++++++..+++
T Consensus         4 ~fav~i~~~~i~~f~~~~~n~   24 (124)
T pfam12273         4 LFAIFIIALLILFFLTARINR   24 (124)
T ss_pred             EHHHHHHHHHHHHHHHHHHHH
T ss_conf             089999999999999998739


No 133
>pfam06819 Arc_PepC Archaeal Peptidase A24 C-terminal Domain. This region is of unknown function but is found in some archaeal pfam01478. It is predicted to be of mixed alpha/beta secondary structure by JPred.
Probab=28.66  E-value=35  Score=13.53  Aligned_cols=24  Identities=25%  Similarity=0.313  Sum_probs=21.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             599999999999987456641122
Q gi|254780705|r  163 RMSDYQWKWFQKLDSDGALFLDFN  186 (425)
Q Consensus       163 risd~ql~~~d~L~~~g~i~~~fn  186 (425)
                      -+++.|+.-+..|.+.|+++..||
T Consensus        87 GLs~E~IE~LkkLv~EGKi~def~  110 (111)
T pfam06819        87 GLTEEQIEKLKKLVSEGKIEDEFL  110 (111)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             677989999999997378765235


No 134
>pfam12072 DUF3552 Domain of unknown function (DUF3552). This presumed domain is functionally uncharacterized. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with pfam00013, pfam01966. This domain has a single completely conserved residue A that may be functionally important.
Probab=27.84  E-value=37  Score=13.44  Aligned_cols=17  Identities=18%  Similarity=0.342  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999
Q gi|254780705|r   24 YCVVAVLVVFVFLILLL   40 (425)
Q Consensus        24 yGi~AI~ial~fL~~Ll   40 (425)
                      +++++.++|+++=.++.
T Consensus         5 ~~i~~~~iG~~~G~~~~   21 (201)
T pfam12072         5 LAIIALVVGFAIGYFVR   21 (201)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 135
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism]
Probab=27.34  E-value=37  Score=13.39  Aligned_cols=103  Identities=20%  Similarity=0.278  Sum_probs=55.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHC---C--------CCCHHHHHHHHHHHHHHHHHHH----HHHHHHHHCHHHHHHHHHHH
Q ss_conf             7653369999999999998626---6--------6300468975334543668999----99999851106789899870
Q gi|254780705|r  252 LASVPSIVYGILGSAVLINFFK---M--------PRSTALVGGLILALMTLPSIII----ATGVALRTVPSSIRSAALGL  316 (425)
Q Consensus       252 la~vPSIv~Gl~gl~~~~~~~~---~--------~~~~~l~g~~~l~~m~lP~i~~----~~~~al~~vp~~~~eaa~~L  316 (425)
                      +..+|+++.-+||...++.++.   .        .+.+.+.|+++|+.|.+-+...    ..++-+..++..|+-     
T Consensus         4 ~~~~~~v~~~~wgivL~~~~~~ll~~~~~~~s~~~~~~qf~g~iaL~~msl~~~LA~R~~~iE~~~~GlD~~Y~~-----   78 (438)
T COG4097           4 LWKMLVVIGALWGIVLFVLFIPLLYTPLNLLSWRLEFSQFLGFIALALMSLIFLLATRLPLIEAWFNGLDKIYRF-----   78 (438)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH-----
T ss_conf             244379999999999998756765074469999998899999999999999999984417776554014677577-----


Q ss_pred             CCCHHHHHHHHHHHHHHHHH---------------------HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             77212777788397533258---------------------9999999999876779999985432
Q gi|254780705|r  317 GASKVQTVFHHVLPLAMPAI---------------------LTGSTVSLARALGETAPLLFVGMVA  361 (425)
Q Consensus       317 Gas~~~~~~~v~lp~a~pgi---------------------~~g~il~~~ra~GEta~ll~~~~~~  361 (425)
                        .||..+.-++|-.+-+=+                     -...+-.-+..+||++..+++++.-
T Consensus        79 --HK~~sIlailL~l~H~~~~~~g~w~~~~~l~~k~a~v~~~l~~~~~s~~elG~~~~yi~~~lll  142 (438)
T COG4097          79 --HKYTSILAILLLLAHNFILFIGNWLTLQLLNFKPAPVKPSLAGMWRSAKELGEWSAYIFIGLLL  142 (438)
T ss_pred             --HHHHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             --8899999999999999999758601105024655665312556667799999999999999999


No 136
>TIGR02357 thia_yuaJ probable proton-coupled thiamine transporter YuaJ; InterPro: IPR012651   Members of this protein family have been assigned as thiamine transporters by a phylogenomic analysis of families of genes regulated by the THI element, a broadly conserved RNA secondary structure element through which thiamine pyrophosphate (TPP) levels can regulate transcription of many genes related to thiamine transport, salvage, and de novo biosynthesis. Species with this protein always lack the ThiBPQ ABC transporter. In some species (e.g. Steptococcus mutans and Streptococcus pyogenes), yuaJ is the only THI-regulated gene. Evidence from Bacillus cereus indicates thiamine uptake is coupled to proton translocation..
Probab=27.24  E-value=38  Score=13.37  Aligned_cols=12  Identities=8%  Similarity=0.221  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHCC
Q ss_conf             799999986036
Q gi|254780705|r  376 AFPVQIYLWAAD  387 (425)
Q Consensus       376 tlp~~Iy~~~~~  387 (425)
                      .+|+.+|...-+
T Consensus       147 G~s~~lYSl~~N  158 (187)
T TIGR02357       147 GMSAYLYSLIYN  158 (187)
T ss_pred             CCCHHHHHHHHH
T ss_conf             832999999999


No 137
>TIGR00895 2A0115 MFS transporter, aromatic acid:H+ symporter (AAHS) family; InterPro: IPR004746 Benzoate transport proteins belong to this group. Benzyl alcohol, benzaldehyde, benzoate, and anthranilate are metabolized via catechol, cis,cis-muconate, and the beta-ketoadipate pathway in some bacteria.; GO: 0005215 transporter activity, 0006810 transport, 0016021 integral to membrane.
Probab=27.21  E-value=38  Score=13.37  Aligned_cols=87  Identities=23%  Similarity=0.345  Sum_probs=44.9

Q ss_pred             HHHHHHH-----HHHHHCCCHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHH-
Q ss_conf             9999999-----99864373024567898998876533--699999999999986266630046897533454366899-
Q gi|254780705|r  224 LGIASAI-----YLEEFSHKGFFSSFVQANINNLASVP--SIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII-  295 (425)
Q Consensus       224 igv~~ai-----yl~e~a~~~~~~~~i~~~i~~la~vP--SIv~Gl~gl~~~~~~~~~~~~~~l~g~~~l~~m~lP~i~-  295 (425)
                      +|+++..     ..+||+|++ ++..+=...  ..|.|  -.+=|++ =+.++|.+|| ++--..||++-.+|..+.+. 
T Consensus       122 lGlGg~~pn~~aL~sEY~p~r-~R~~~vg~~--~~Gy~~G~~~gg~l-~~~LiP~~GW-r~~F~vGG~~Pl~ll~~l~~~  196 (413)
T TIGR00895       122 LGLGGLMPNLIALVSEYAPKR-FRGTAVGLM--FCGYAIGAAVGGFL-AGWLIPAFGW-RSLFYVGGIIPLLLLLLLMRF  196 (413)
T ss_pred             HHHHHHHHHHHHHHHHCCCCC-HHHHHHHHH--HHHHHHHHHHHHHH-HHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
T ss_conf             549999999999998435763-346688888--87678999999999-8887544407-999999999999999999977


Q ss_pred             ----------H-----HHHHHHHHCHHHHHHHHHH
Q ss_conf             ----------9-----9999985110678989987
Q gi|254780705|r  296 ----------I-----ATGVALRTVPSSIRSAALG  315 (425)
Q Consensus       296 ----------~-----~~~~al~~vp~~~~eaa~~  315 (425)
                                +     ..++.+.++.|+++..+..
T Consensus       197 LPES~~fl~~kg~~~~~~~~~~n~I~p~~~~~~~~  231 (413)
T TIGR00895       197 LPESIDFLVEKGKRPEKVRRIVNAIAPQLQAEAQS  231 (413)
T ss_pred             CCCCHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             68768989770887579999987754542257654


No 138
>PRK01030 tetrahydromethanopterin S-methyltransferase subunit C; Provisional
Probab=27.00  E-value=38  Score=13.35  Aligned_cols=70  Identities=21%  Similarity=0.174  Sum_probs=40.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986266
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM  274 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~  274 (425)
                      .|+...++|.....+.....++.=|++ ++.-.-. ..|..+++-..-  +=.|||||-+=-+|.++.-..+|.
T Consensus        18 ~Givg~LigiYla~~~~~~~~~~gglg-ai~A~Vw-Ga~tvRrvasYG--LGTGVPSIGm~alGmG~iaal~G~   87 (266)
T PRK01030         18 IGIVGGLVGIYLAYFNPSVFSFFGGLG-AIAATVW-GANTVRRVASYG--LGTGVPSIGMMALGMGIIAALAGL   87 (266)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHH-HHHHHHH-CHHHHHHHHHHC--CCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999999999999996620889999999-9999996-518899998605--888987399999857899999998


No 139
>PRK06743 flagellar motor protein MotP; Reviewed
Probab=26.92  E-value=38  Score=13.34  Aligned_cols=33  Identities=21%  Similarity=0.293  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             120266789999999999999999999999999
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL  232 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl  232 (425)
                      ..|+..|++.|+|=+++|-++..|++--.-...
T Consensus       176 G~~mAvAlvtTlYG~~lAnl~flPiA~KL~~~~  208 (254)
T PRK06743        176 GTGMAVAMLTTLYGSVLANMIAIPLAEKVYRGI  208 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             899999999999999999999999999999889


No 140
>pfam06553 BNIP3 BNIP3. This family consists of several mammalian specific BCL2/adenovirus E1B 19-kDa protein-interacting protein 3 or BNIP3 sequences. BNIP3 belongs to the Bcl-2 homology 3 (BH3)-only family, a Bcl-2-related family possessing an atypical Bcl-2 homology 3 (BH3) domain, which regulates PCD from mitochondrial sites by selective Bcl-2/Bcl-XL interactions. BNIP3 family members contain a C-terminal transmembrane domain that is required for their mitochondrial localisation, homodimerization, as well as regulation of their pro-apoptotic activities. BNIP3-mediated apoptosis has been reported to be independent of caspase activation and cytochrome c release and is characterized by early plasma membrane and mitochondrial damage, prior to the appearance of chromatin condensation or DNA fragmentation.
Probab=24.99  E-value=29  Score=14.05  Aligned_cols=34  Identities=29%  Similarity=0.356  Sum_probs=26.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             101202667899999999999999999999999998
Q gi|254780705|r  198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE  233 (425)
Q Consensus       198 ~e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~  233 (425)
                      ...+||+.+=+  |++.+.+++++..+|++.|||+.
T Consensus       153 mKk~glFS~e~--L~vflpSl~lShlL~~GlGiyIg  186 (197)
T pfam06553       153 MKKGGLFSAEF--LKVFLPTLLLSHLLGLGLGIYIG  186 (197)
T ss_pred             CCCCCCCCHHH--HHHHHHHHHHHHHHHHCCEEEEE
T ss_conf             44676045999--99999999999998723224773


No 141
>KOG3120 consensus
Probab=23.79  E-value=43  Score=12.97  Aligned_cols=118  Identities=15%  Similarity=0.163  Sum_probs=54.1

Q ss_pred             CCEEEEEEEEEEEECHHHHCCCCCCCCC---------H---HHHHCCCHHHHHHHHHHHHCCCCCCCHHH-HHHHHHHHC
Q ss_conf             6216899999873088890657656679---------8---88630458999999999631456666034-898998730
Q gi|254780705|r   49 GALWQTHISLPIEFSETIVDPQKKRFMD---------P---AILLRADYNLLVRKALARKLSISDSNHAL-LRQASQMLS  115 (425)
Q Consensus        49 ~AF~qT~I~l~V~~d~~~id~~~~~~~d---------~---~~l~~~~~~~li~~aL~~~~p~~~~~r~~-kr~l~~liS  115 (425)
                      +|=.+-.|.+-++||..++|.+.+.-.-         .   ....++-|..+..+-+...-. ++.+.++ |+-++++=-
T Consensus         7 s~~~~~ril~~FDFD~TIid~dSD~wVv~~lp~~~l~~qL~~t~p~~~Wne~M~rv~k~Lhe-qgv~~~~ik~~~r~iP~   85 (256)
T KOG3120           7 SASSSPRILLVFDFDRTIIDQDSDNWVVDELPTTDLFNQLRDTYPKGFWNELMDRVFKELHE-QGVRIAEIKQVLRSIPI   85 (256)
T ss_pred             CCCCCCCEEEEEECCCEEECCCCCHHHHHHCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHH-CCCCHHHHHHHHHCCCC
T ss_conf             42368857999855750333776258998646204579998762131399999999999987-38899999999851889


Q ss_pred             CHHHHHHHHHHHHCHHHCCCEEEEEEEECCCCHHHHCCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCCC
Q ss_conf             01689999997406321597478999704530233034556530000599999999999987456641122023213443
Q gi|254780705|r  116 TTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGAS  195 (425)
Q Consensus       116 ~~a~~~Lrd~v~~np~liG~t~~~~llAsddvD~~~KG~i~r~e~~rrisd~ql~~~d~L~~~g~i~~~fn~~f~t~~~s  195 (425)
                      .---.++.+.+.+++.       +.+-.-+|.+++.                    +|..-+..-+..-|. ..|||+..
T Consensus        86 ~Pgmv~lik~~ak~g~-------~eliIVSDaNsfF--------------------Ie~~Lea~~~~d~F~-~IfTNPa~  137 (256)
T KOG3120          86 VPGMVRLIKSAAKLGC-------FELIIVSDANSFF--------------------IEEILEAAGIHDLFS-EIFTNPAC  137 (256)
T ss_pred             CCCHHHHHHHHHHCCC-------CEEEEEECCCHHH--------------------HHHHHHHCCHHHHHH-HHHCCCCC
T ss_conf             8348999999986788-------3289994674437--------------------999999725799999-98369766


No 142
>TIGR00383 corA magnesium and cobalt transport protein CorA; InterPro: IPR004488 The CorA transport system is the primary Mg2+ influx system of Salmonella typhimurium and Escherichia coli. It has an unusual membrane topology, with a large, soluble, highly charged periplasmic N-terminal domain with three transmembrane segments in a shorter, hydrophobic C-terminal domain. It has been suggested that the CorA Mg2+ transport system forms the major Mg2+ uptake system in the bacteria and archaea but that some family members may have a function other than Mg2+ transport .; GO: 0015087 cobalt ion transmembrane transporter activity, 0015095 magnesium ion transmembrane transporter activity, 0006824 cobalt ion transport, 0015693 magnesium ion transport, 0016020 membrane.
Probab=21.14  E-value=49  Score=12.64  Aligned_cols=92  Identities=16%  Similarity=0.375  Sum_probs=49.5

Q ss_pred             HHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHH
Q ss_conf             99999985110678989987077212777788397533258999999999987677999998543210136656134455
Q gi|254780705|r  296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIAT  375 (425)
Q Consensus       296 ~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta~ll~~~~~~~~~~~p~~~~~p~~  375 (425)
                      .-.-|+.+..=.+++++.+++=-.|.--+.|+. -     ++|-+          ..|+.+|||+ |.-|.     +|-.
T Consensus       245 ~~~~e~~r~~~~~L~d~~~s~~s~~mN~ImK~l-T-----vvs~i----------FiPlTfIAg~-YGMNF-----~pdk  302 (339)
T TIGR00383       245 LEIIETYRELLSSLMDLYLSLVSNKMNEIMKIL-T-----VVSTI----------FIPLTFIAGI-YGMNF-----KPDK  302 (339)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-H-----HHHHH----------HHHHHHHCCC-CCCCC-----CCCC
T ss_conf             778999999999999999988879886899999-9-----99999----------8602452031-56468-----8878


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             799999986036650069999999999999999999999999997
Q gi|254780705|r  376 AFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR  420 (425)
Q Consensus       376 tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r  420 (425)
                        |     | ..||-.|   -||--+||.+++++.-.--.|.|||
T Consensus       303 --p-----w-fMPEL~w---~yGY~~~l~vM~~~~~~~~~~F~RK  336 (339)
T TIGR00383       303 --P-----W-FMPELNW---KYGYPAVLIVMAVIALGMLIFFRRK  336 (339)
T ss_pred             --C-----C-CCCCCCC---CCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             --8-----6-5755457---7755999999999998877335204


No 143
>pfam01726 LexA_DNA_bind LexA DNA binding domain. This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins. The aligned region contains a variant form of the helix-turn-helix DNA binding motif. This domain is found associated with pfam00717 the auto-proteolytic domain of LexA EC:3.4.21.88.
Probab=20.67  E-value=50  Score=12.57  Aligned_cols=35  Identities=23%  Similarity=0.254  Sum_probs=24.2

Q ss_pred             HHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             51106789899870772127777883975332589
Q gi|254780705|r  303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAIL  337 (425)
Q Consensus       303 ~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~  337 (425)
                      ...||++||-+-++|.+-..++.+++--+...|.+
T Consensus        22 ~G~~Pt~rEI~~~~g~~S~s~v~~~l~~Le~kG~I   56 (65)
T pfam01726        22 TGYPPSRREIAQALGLRSPNAAEEHLKALERKGYI   56 (65)
T ss_pred             HCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCE
T ss_conf             28898799999993899809999999999998396


No 144
>COG4059 MtrE Tetrahydromethanopterin S-methyltransferase, subunit E [Coenzyme metabolism]
Probab=20.25  E-value=51  Score=12.52  Aligned_cols=51  Identities=24%  Similarity=0.228  Sum_probs=36.6

Q ss_pred             HHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHH
Q ss_conf             7456641122023213443211012026678999999999-----9999999999999999
Q gi|254780705|r  177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLI-----VIGLSFPLGIASAIYL  232 (425)
Q Consensus       177 ~~g~i~~~fn~~f~t~~~s~~~e~~Gi~~ai~gTl~~~~i-----a~~ia~pigv~~aiyl  232 (425)
                      .++.+.+-||+     .-|-+|...|.+.++-||.-..++     ..++++.+|.+.+-+.
T Consensus        45 QM~~~HR~fNK-----AvSGEPvsy~l~~avagtVa~vlm~~~~L~~l~Al~lGa~iaA~v  100 (304)
T COG4059          45 QMMNPHRIFNK-----AVSGEPVSYGLYCAVAGTVAYVLMSEFGLPPLFALALGAGIAACV  100 (304)
T ss_pred             HHCCHHHHHHH-----CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             21688988612-----026898510111346578899999872873999999987899999


No 145
>PRK08456 flagellar motor protein MotA; Validated
Probab=20.08  E-value=52  Score=12.50  Aligned_cols=35  Identities=20%  Similarity=0.143  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             12026678999999999999999999999999986
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE  234 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e  234 (425)
                      ..|+..|+++|+|=+++|-++-.|++--.....+|
T Consensus       179 G~~mA~ALvtTfyGvllAn~v~~PiA~KL~~~~~~  213 (257)
T PRK08456        179 AAGIAGAFTATVTGIMGSYALFGPWGHKMKAKSKD  213 (257)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98999999999999999999999999999978999


Done!