HHsearch alignment of GI: 254780705 and MMDB domain: 3d31_C_

>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans}
Probab=99.94  E-value=2.7e-25  Score=179.57  Aligned_cols=208  Identities=20%  Similarity=0.194  Sum_probs=177.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC----
Q ss_conf             0120266789999999999999999999999999864373024567898998876533699999999999986266----
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM----  274 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~----  274 (425)
                      ...+.+.++.+|++.++++++++.++|+++|++++++  +.+.++.++..+.....+|.++.++..+..+......    
T Consensus        76 ~~~~~~~~l~~Tl~~~~~~~~~~~~ig~~~a~~l~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  153 (295)
T 3d31_C           76 GNRSVISSIFLSLYAGFLATLLALLLGAPTGYILARF--DFPGKRLVESIIDVPVVVPHTVAGIALLTVFGSRGLIGEPL  153 (295)
T ss_dssp             HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC--CCTTHHHHHHHHHGGGTSCHHHHHHHHHHHHSTTSTTTGGG
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             5989999999999999999999999999999999963--66479999999999999999999999999997266324303


Q ss_pred             -----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -----630046897533454366899999999851106789899870772127777883975332589999999999876
Q gi|254780705|r  275 -----PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG  349 (425)
Q Consensus       275 -----~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~G  349 (425)
                           ...+.....+++.++.+|+++...+++++++|++++|||..+|||+||++++|++|+++|++++|.++++..+++
T Consensus       154 ~~~~~~~~~~~~~i~~~~~~~~p~~~~~~~~~l~~i~~~l~eAA~~~Gas~~~~f~~I~lP~~~p~i~~~~~l~~~~~~~  233 (295)
T 3d31_C          154 ESYIQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAFFFVTLPLSARYLLIGSVMTWARAIS  233 (295)
T ss_dssp             TTTCCCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCHHHHHHHTHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             32167123999999999999999999999999975050589999876998262127746996999999999999999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             779999985432101366561344557999999860366500699999999999999999999999999974104
Q gi|254780705|r  350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR  424 (425)
Q Consensus       350 Eta~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~~  424 (425)
                      |+....++++.             ..++++.+|....+.+.+.   +++.+++++++++.++.+...+.+|.++|
T Consensus       234 ~~~~~~~l~~~-------------~~~~~~~i~~~~~~~~~~~---~~a~~~i~~~~~~~~~~~~~~~~~r~~~~  292 (295)
T 3d31_C          234 EFGAVVILAYY-------------PMVGPTLIYDRFISYGLSA---SRPIAVLLILVTLSIFLVIRTLSAGWSIY  292 (295)
T ss_dssp             CCHHHHHHHCT-------------TCCHHHHHHHHHHHSTTTT---THHHHHHHHHHHHHHHHHHC---------
T ss_pred             HHHHHHHHHCC-------------CCHHHHHHHHHHHHCCHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999589-------------7319999999999448999---99999999999999999999999760364