HHsearch results for GI: 254780705 and protein with PDBid: 2r6g_G

>2r6g_G Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: f.58.1.1 PDB: 3fh6_G
Probab=99.86  E-value=1.2e-20  Score=149.02  Aligned_cols=207  Identities=14%  Similarity=0.054  Sum_probs=146.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--H-CCC
Q ss_conf             0120266789999999999999999999999999864373024567898998876533699999999999986--2-666
Q gi|254780705|r  199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF--F-KMP  275 (425)
Q Consensus       199 e~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~--~-~~~  275 (425)
                      .....+.++.+|+..+.++.++++++|+.+|..+..+  +.+..+.....+.....+|+++.++.....+...  . ...
T Consensus        77 ~~~~~~~~l~nSl~~a~~~~~~~~~i~~~~a~~l~r~--~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~g~~~~~~  154 (296)
T 2r6g_G           77 PPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARM--RFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFI  154 (296)
T ss_dssp             CSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCTTSHHHHHHHHHTTSSCSSSHHHHHHHHHHHHHHHSTTS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             4408999999999999999999999999999999834--78517999999986224767798999999998614213443


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HH
Q ss_conf             30046897533454366899999999851106789899870772127777883975332589999999999876779-99
Q gi|254780705|r  276 RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA-PL  354 (425)
Q Consensus       276 ~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta-~l  354 (425)
                      ..+...+.+......+|+.++....+++++|++++|||..+||++||+++||++|..+|+++++.++++..+++|.. |.
T Consensus       155 ~~~~~~~vi~~~~~~~pf~~~~~~~~l~~ip~~l~EAA~~dGAs~~~~f~~I~lPll~p~i~~~~~l~fi~~~~~f~~~~  234 (296)
T 2r6g_G          155 GLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVAS  234 (296)
T ss_dssp             STTSHHHHHHHHTTTTHHHHHHHHHHHTTSCTHHHHHHHHTTCCHHHHHHHTTHHHHHHHHHHHHHHHHHHHHTCCHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             02336999999999999899999999973407778889875993033243899847568999999999999999768888


Q ss_pred             HHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             998543210136656134455799999986036650069999999999999999999999999997410
Q gi|254780705|r  355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK  423 (425)
Q Consensus       355 l~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~lr~r~~~  423 (425)
                      ++.++.            ...|+++.+|.+.+... .....++|++++.++.++   ++..+++||+-|
T Consensus       235 ~~~~~~------------~~~t~~~~i~~~~~~~~-~~~~~~~A~~vi~~l~~l---iv~~~~qr~~~~  287 (296)
T 2r6g_G          235 LLLRDV------------NSYTLAVGMQQYLNPQN-YLWGDFAAAAVMSALPIT---IVFLLAQRWLVN  287 (296)
T ss_dssp             HHCCSG------------GGCCHHHHGGGGBCSSC-BCHHHHHHHHHHTHHHHH---HHHHHHTTTCCS
T ss_pred             HCCCCC------------CCEEHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHHH---HHHHHHHHHHHH
T ss_conf             135899------------80639999999983306-219999999999999999---999999999998