HHSEARCH alignment of GI: 254780705 and SCOP domain: d2onkc1

Alignment
>d2onkc1 f.58.1.1 (C:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=99.90  E-value=5.9e-22  Score=155.76  Aligned_cols=199  Identities=18%  Similarity=0.183  Sum_probs=154.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC----
Q ss_conf             1202667899999999999999999999999998643730245678989988765336999999999999862666----
Q gi|254780705|r  200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMP----  275 (425)
Q Consensus       200 ~~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~~----  275 (425)
                      ....|.++..|+..+.++.++++.+|+..|.++..+  +.+.++.++........+|.++.++....++.+.....    
T Consensus        44 ~~~~~~~~~nSl~~~~~~~~i~~i~g~~la~~l~~~--~~~~~~~~~~~~~~p~~ip~~v~~~~~~~~~~~~~~~~~~~~  121 (252)
T d2onkc1          44 DPAVWKVVLTTYYAALISTLIAVIFGTPLAYILARK--SFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSFSP  121 (252)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSC--CCSSHHHHHHHHHHHHHSCHHHHHHHHHHHHSTTSTTTTTCS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             978999999999999999999999999999999873--132168999998752168717777777641233210001245


Q ss_pred             ---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---30046897533454366899999999851106789899870772127777883975332589999999999876779
Q gi|254780705|r  276 ---RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA  352 (425)
Q Consensus       276 ---~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEta  352 (425)
                         ..+...-.++++.+.+|+.+...+++++++|++++|||..+|+|+||+++||++|.++|+++++.++++..+++|.+
T Consensus       122 ~~~~~~~~~iii~~~~~~~p~~~~~~~~~~~~i~~~~~eaA~~lGas~~~~~~~i~lP~~~p~i~~~~~l~~~~~~~~~~  201 (252)
T d2onkc1         122 LKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAGAIMSWARGISEFG  201 (252)
T ss_dssp             SCCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHCCH
T ss_pred             CCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             44200133211010011211036899999975038888788766998332546987087688999999999988999988


Q ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999854321013665613445579999998603665006999999999999999999999999
Q gi|254780705|r  353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW  416 (425)
Q Consensus       353 ~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~~a~~  416 (425)
                      ..++.|+.             ..+++..+|....+.+..   .+.+.+.+++++.+.+.....+
T Consensus       202 ~~~~~~~~-------------~~~~~~~i~~~~~~~~~~---~~~a~~~il~~~~~~~~~~~~~  249 (252)
T d2onkc1         202 AVVVIAYY-------------PMIAPTLIYERYLSEGLS---AAMPVAAILILLSLAVFVALRI  249 (252)
T ss_dssp             HHHTTCCS-------------SCCHHHHHHHHHHHHCGG---GTHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCC-------------CCHHHHHHHHHHHHCCHH---HHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87511489-------------851999999999805899---9999999999999999999999


SCOP domain information

class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: Molybdate/tungstate transport system permease protein WtpB (ModB)
species: Archaeoglobus fulgidus [TaxId: 2234]