HHSEARCH alignment of GI: 254780705 and SCOP domain: d3d31c1

Alignment
>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]}
Probab=99.92  E-value=1.1e-23  Score=166.71  Aligned_cols=194  Identities=21%  Similarity=0.217  Sum_probs=157.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC------
Q ss_conf             20266789999999999999999999999999864373024567898998876533699999999999986266------
Q gi|254780705|r  201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM------  274 (425)
Q Consensus       201 ~Gi~~ai~gTl~~~~ia~~ia~pigv~~aiyl~e~a~~~~~~~~i~~~i~~la~vPSIv~Gl~gl~~~~~~~~~------  274 (425)
                      ...+.++..|++.+.++.++++++|+..|++++++  +.+.++.++........+|++++|+..+..+.+....      
T Consensus        43 ~~~~~~l~~Sl~~a~~s~~i~~~lg~~~a~~~~~~--~~~~~~~~~~l~~~p~~ip~vv~~~~~~~~~~~~~~~~~~~~~  120 (248)
T d3d31c1          43 RSVISSIFLSLYAGFLATLLALLLGAPTGYILARF--DFPGKRLVESIIDVPVVVPHTVAGIALLTVFGSRGLIGEPLES  120 (248)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC--CCTTHHHHHHHHHGGGTSCHHHHHHHHHHHHSTTSTTTGGGTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCCCCCCC
T ss_conf             89999999999999999999999999999999864--6512568999999999999720002445203432111112222


Q ss_pred             ---CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---63004689753345436689999999985110678989987077212777788397533258999999999987677
Q gi|254780705|r  275 ---PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET  351 (425)
Q Consensus       275 ---~~~~~l~g~~~l~~m~lP~i~~~~~~al~~vp~~~~eaa~~LGas~~~~~~~v~lp~a~pgi~~g~il~~~ra~GEt  351 (425)
                         ...+.....++...+.+|++++..+++++++|++++|||..+|+|+||+++||++|.++|+++++.++++.++++|.
T Consensus       121 ~~~~~~~~~~iii~~~~~~~p~~~~~~~~~l~~i~~~~~eAA~~lGas~~~~~~~I~lP~~~p~i~~~~~l~f~~~~~~~  200 (248)
T d3d31c1         121 YIQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAFFFVTLPLSARYLLIGSVMTWARAISEF  200 (248)
T ss_dssp             TCCCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTCC
T ss_pred             CCCCCCCCCEEEHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             11245642001001101100368888899997103368999876310423477898899999999999999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999985432101366561344557999999860366500699999999999999999999
Q gi|254780705|r  352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT  412 (425)
Q Consensus       352 a~ll~~~~~~~~~~~p~~~~~p~~tlp~~Iy~~~~~~~~~~~~~~~aa~lvLl~~~~~~n~  412 (425)
                      .+..++|+.             ..+++..+|....+.+.+   .+.+.+++++++.+.+..
T Consensus       201 ~~~~~l~~~-------------~~~~~~~i~~~~~~~~~~---~a~a~a~il~~~~l~~~~  245 (248)
T d3d31c1         201 GAVVILAYY-------------PMVGPTLIYDRFISYGLS---ASRPIAVLLILVTLSIFL  245 (248)
T ss_dssp             HHHHHHHCT-------------TCCHHHHHHHHHHHSTTT---TTHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCC-------------CCHHHHHHHHHHHHCCHH---HHHHHHHHHHHHHHHHHH
T ss_conf             988733189-------------840999999999955899---999999999999999999


SCOP domain information

class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: Sulfate/molybdate ABC transporter, permease protein
species: Methanosarcina acetivorans [TaxId: 2214]