BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780705|ref|YP_003065118.1| phosphate ABC transporter,
permease protein PstA [Candidatus Liberibacter asiaticus str. psy62]
         (425 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780705|ref|YP_003065118.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040382|gb|ACT57178.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 425

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/425 (100%), Positives = 425/425 (100%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI
Sbjct: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY
Sbjct: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
           HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA
Sbjct: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF
Sbjct: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV
Sbjct: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV
Sbjct: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR
Sbjct: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420

Query: 421 FKKRW 425
           FKKRW
Sbjct: 421 FKKRW 425


>gi|315121870|ref|YP_004062359.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495272|gb|ADR51871.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 427

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/427 (79%), Positives = 385/427 (90%), Gaps = 2/427 (0%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           MKSFS+NKK LK RYISE+LFRF CV+AVL+V  FLI+ L SIVSKGIG LWQTHISLPI
Sbjct: 1   MKSFSVNKKKLKSRYISEFLFRFSCVIAVLIVLAFLIIFLYSIVSKGIGTLWQTHISLPI 60

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           EFSETI+DP K RF DP+IL +A+YNLLV+ ALARKL ISDS H++L Q S+M+S+T RY
Sbjct: 61  EFSETIIDPNKNRFKDPSILQKANYNLLVQMALARKLGISDSEHSMLAQVSEMISSTVRY 120

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL-YS-PANVHRMSDYQWKWFQKLDSD 178
            LR TL+ DPSLIGKTVE+ LLASANIDSALKGY+ +S PA V ++SD Q KWF++L +D
Sbjct: 121 RLRNTLLADPSLIGKTVEMPLLASANIDSALKGYIDFSLPATVRKISDDQLKWFRQLVAD 180

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G++   FNYGFF+NGASSRPE AGIGVA+VGSLYM+LIVI LSFP+GIASAIYLEEF+ K
Sbjct: 181 GSISFHFNYGFFVNGASSRPESAGIGVAIVGSLYMILIVIALSFPVGIASAIYLEEFAPK 240

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
            FFSSF+QANINNLASVPS+VYGILGSA+L+NFF+MPRST+LVGGLILA+MTLPSIIIA 
Sbjct: 241 NFFSSFIQANINNLASVPSVVYGILGSAMLVNFFQMPRSTSLVGGLILAIMTLPSIIIAA 300

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
           GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLA+PAILTGSTVSLARALGETAPLLFVG
Sbjct: 301 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAVPAILTGSTVSLARALGETAPLLFVG 360

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAFVTDYP G+TDIATAFPVQ+YLW +DAER FVE+TFG+ILLLL+FLAVINT MLWLR
Sbjct: 361 MVAFVTDYPEGITDIATAFPVQVYLWTSDAERLFVEKTFGSILLLLVFLAVINTVMLWLR 420

Query: 419 NRFKKRW 425
           NRF+K W
Sbjct: 421 NRFRKHW 427


>gi|222084781|ref|YP_002543310.1| phosphate ABC transporter, permease protein PstA [Agrobacterium
           radiobacter K84]
 gi|221722229|gb|ACM25385.1| phosphate ABC transporter, permease protein PstA [Agrobacterium
           radiobacter K84]
          Length = 444

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 239/418 (57%), Positives = 307/418 (73%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  FR Y + AV    VFLI L+SS+V  G  A  QT I+LPIEF E ++DP
Sbjct: 27  GIKRRYAAERRFRAYGIAAVTFGLVFLIALVSSVVRHGYTAFVQTSITLPIEFVEKVIDP 86

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP +L+ A+Y +LVR AL + L I  ++ AL+R+A+ M+S +AR  LR  +M D
Sbjct: 87  TGKRASDPKVLIAANYPVLVRDALVKALGIDPADRALVREATAMVSDSARSMLRDKVMAD 146

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYSPANV--HRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IGKTV+++LLA ANIDSA KG +   AN    ++SD Q  W ++L + GAL   FN 
Sbjct: 147 PSIIGKTVKITLLADANIDSANKGQIDLTANEADRKVSDRQLGWMRQLAASGALHKAFNS 206

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F++G SSRPE AG+GVA++GSLY+ML V+ L+ P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 207 GLFLSGNSSRPEAAGLGVALIGSLYLMLTVLVLALPVGVAASIYLEEFAPKNRLTDLIEV 266

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V IN   +PRS +LVGGL+L+LMTLP IIIAT  ALR VP 
Sbjct: 267 NINNLAAVPSIVYGLLGLSVFINVMGLPRSASLVGGLVLSLMTLPMIIIATRSALRAVPP 326

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGAS++Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV  YP
Sbjct: 327 SIRSAALGLGASRMQVVFHHVLPLAMPGILTGTILGLAHALGETAPLLLIGMVAFVASYP 386

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQIY+WA++AER FVERT GAI++LL FL  +N   + LR RF++RW
Sbjct: 387 TSPLDPATALPVQIYMWASEAERAFVERTSGAIIVLLFFLVAMNIGAILLRRRFERRW 444


>gi|306843559|ref|ZP_07476160.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO1]
 gi|306276250|gb|EFM57950.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO1]
          Length = 436

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 238/418 (56%), Positives = 299/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKRETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGVMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|153008105|ref|YP_001369320.1| phosphate ABC transporter inner membrane subunit PstA [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559993|gb|ABS13491.1| phosphate ABC transporter, inner membrane subunit PstA
           [Ochrobactrum anthropi ATCC 49188]
          Length = 438

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/418 (56%), Positives = 299/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR+Y + A+ +   FL  LL S+ SKG  A WQT + LP++  E ++DP
Sbjct: 21  GLKRRYAAERRFRYYGIAAIAIGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEEKVIDP 80

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M +
Sbjct: 81  GNKRATDPNVLITANYPLLVRNALAEKLGVAATDRPAMRDLGRFYSDGVRIQLRKMVMDN 140

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  V +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 141 PSLIGTTQTVPVLAGADIDSAFKGQIDLSVPETSRKVSDRQVGWMKMLSEEGVMKEAFNT 200

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 201 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFAKKNRFTDMIEV 260

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 261 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 320

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 321 SIRAAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 380

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 381 STPMDPATALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 438


>gi|190890214|ref|YP_001976756.1| phosphate ABC transporter permease [Rhizobium etli CIAT 652]
 gi|190695493|gb|ACE89578.1| phosphate ABC transporter, permease protein [Rhizobium etli CIAT
           652]
          Length = 440

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 235/417 (56%), Positives = 307/417 (73%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  F+ Y + A++   VFL +LL +++ KG  A  QT I+LPIEFSE  +DP 
Sbjct: 24  IKRRYAAERRFQAYGIAAIIFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDPS 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R AS MLS +A   LR  ++ DP
Sbjct: 84  NKRATDPSVLIAANYPVLLRDAIVKQLNINASSKPDVRDASAMLSKSAPIQLRDMVVADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           SLIGKTV VSLLA ANIDSA KG   L       +++D Q  W  +L + GAL   FN G
Sbjct: 144 SLIGKTVNVSLLADANIDSANKGQIDLSVDEKNRKVNDKQVTWMNQLKASGALQKQFNTG 203

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F+NG SSRPE AG+GVA++GSLY+MLIV+ LS P+G+A++IYLEEF+ K   +  ++ N
Sbjct: 204 LFVNGNSSRPEAAGLGVALIGSLYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEVN 263

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP S
Sbjct: 264 INNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPS 323

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P 
Sbjct: 324 IRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPA 383

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              + +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 384 TPLEPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|327192730|gb|EGE59666.1| phosphate ABC transporter, permease protein [Rhizobium etli
           CNPAF512]
          Length = 440

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 235/417 (56%), Positives = 306/417 (73%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEFSE  +DP 
Sbjct: 24  IKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDPS 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R AS MLS +A   LR  ++ DP
Sbjct: 84  NKRATDPSVLIAANYPVLLRDAIVKQLNINASSKPDVRDASAMLSKSAPIQLRDMVVADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           SLIGKTV VSLLA ANIDSA KG   L       +++D Q  W  +L + GAL   FN G
Sbjct: 144 SLIGKTVNVSLLADANIDSANKGQIDLTVDEKNRKVNDKQVTWMNQLKASGALQKQFNTG 203

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F+NG SSRPE AG+GVA++GSLY+MLIV+ LS P+G+A++IYLEEF+ K   +  ++ N
Sbjct: 204 LFVNGNSSRPEAAGLGVALIGSLYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEVN 263

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP S
Sbjct: 264 INNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPS 323

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P 
Sbjct: 324 IRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPA 383

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              + +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 384 TPLEPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|23502988|ref|NP_699115.1| phosphate ABC transporter permease [Brucella suis 1330]
 gi|23349027|gb|AAN31030.1| phosphate ABC transporter, permease protein [Brucella suis 1330]
          Length = 436

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  DNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|161620050|ref|YP_001593937.1| phosphate ABC transporter, permease protein PstA [Brucella canis
           ATCC 23365]
 gi|254705141|ref|ZP_05166969.1| phosphate ABC transporter, permease protein PstA [Brucella suis bv.
           3 str. 686]
 gi|260567390|ref|ZP_05837860.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 4 str. 40]
 gi|261755845|ref|ZP_05999554.1| phosphate ABC transporter [Brucella suis bv. 3 str. 686]
 gi|161336861|gb|ABX63166.1| phosphate ABC transporter, permease protein PstA [Brucella canis
           ATCC 23365]
 gi|260156908|gb|EEW91988.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 4 str. 40]
 gi|261745598|gb|EEY33524.1| phosphate ABC transporter [Brucella suis bv. 3 str. 686]
          Length = 436

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  DNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|254713458|ref|ZP_05175269.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           M644/93/1]
 gi|254716186|ref|ZP_05177997.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           M13/05/1]
 gi|261217959|ref|ZP_05932240.1| phosphate ABC transporter [Brucella ceti M13/05/1]
 gi|261321191|ref|ZP_05960388.1| phosphate ABC transporter [Brucella ceti M644/93/1]
 gi|260923048|gb|EEX89616.1| phosphate ABC transporter [Brucella ceti M13/05/1]
 gi|261293881|gb|EEX97377.1| phosphate ABC transporter [Brucella ceti M644/93/1]
          Length = 436

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDCQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|254700771|ref|ZP_05162599.1| phosphate ABC transporter, permease protein PstA [Brucella suis bv.
           5 str. 513]
 gi|261751280|ref|ZP_05994989.1| phosphate ABC transporter [Brucella suis bv. 5 str. 513]
 gi|261741033|gb|EEY28959.1| phosphate ABC transporter [Brucella suis bv. 5 str. 513]
          Length = 436

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADAP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|62290979|ref|YP_222772.1| phosphate ABC transporter permease [Brucella abortus bv. 1 str.
           9-941]
 gi|82700889|ref|YP_415463.1| binding-protein dependent transport system inner membrane protein
           [Brucella melitensis biovar Abortus 2308]
 gi|163844155|ref|YP_001628560.1| phosphate ABC transporter, permease protein PstA [Brucella suis
           ATCC 23445]
 gi|189025192|ref|YP_001935960.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella abortus S19]
 gi|225853567|ref|YP_002733800.1| phosphate ABC transporter permease PstA [Brucella melitensis ATCC
           23457]
 gi|237816483|ref|ZP_04595476.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           str. 2308 A]
 gi|254690274|ref|ZP_05153528.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 6 str. 870]
 gi|254694761|ref|ZP_05156589.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 3 str. Tulya]
 gi|254696389|ref|ZP_05158217.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254731303|ref|ZP_05189881.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 4 str. 292]
 gi|256045746|ref|ZP_05448624.1| phosphate ABC transporter, permease protein PstA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256060103|ref|ZP_05450285.1| phosphate ABC transporter, permease protein PstA [Brucella neotomae
           5K33]
 gi|256112465|ref|ZP_05453386.1| phosphate ABC transporter, permease protein PstA [Brucella
           melitensis bv. 3 str. Ether]
 gi|256258527|ref|ZP_05464063.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 9 str. C68]
 gi|256262949|ref|ZP_05465481.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 2 str. 63/9]
 gi|260546243|ref|ZP_05821983.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus NCTC 8038]
 gi|260563042|ref|ZP_05833528.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 1 str. 16M]
 gi|260755813|ref|ZP_05868161.1| phosphate ABC transporter [Brucella abortus bv. 6 str. 870]
 gi|260759036|ref|ZP_05871384.1| phosphate ABC transporter [Brucella abortus bv. 4 str. 292]
 gi|260760761|ref|ZP_05873104.1| phosphate ABC transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884838|ref|ZP_05896452.1| phosphate ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|261215088|ref|ZP_05929369.1| phosphate ABC transporter [Brucella abortus bv. 3 str. Tulya]
 gi|261324079|ref|ZP_05963276.1| phosphate ABC transporter [Brucella neotomae 5K33]
 gi|265992162|ref|ZP_06104719.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993900|ref|ZP_06106457.1| phosphate ABC transporter [Brucella melitensis bv. 3 str. Ether]
 gi|294851368|ref|ZP_06792041.1| phosphate ABC transporter [Brucella sp. NVSL 07-0026]
 gi|297247366|ref|ZP_06931084.1| phosphate ABC transporter, permease PstA [Brucella abortus bv. 5
           str. B3196]
 gi|306842749|ref|ZP_07475391.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO2]
 gi|62197111|gb|AAX75411.1| phosphate ABC transporter, permease protein [Brucella abortus bv. 1
           str. 9-941]
 gi|82616990|emb|CAJ12099.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis biovar Abortus 2308]
 gi|163674878|gb|ABY38989.1| phosphate ABC transporter, permease protein PstA [Brucella suis
           ATCC 23445]
 gi|189020764|gb|ACD73486.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella abortus S19]
 gi|225641932|gb|ACO01846.1| phosphate ABC transporter, permease protein PstA [Brucella
           melitensis ATCC 23457]
 gi|237788550|gb|EEP62765.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           str. 2308 A]
 gi|260096350|gb|EEW80226.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus NCTC 8038]
 gi|260153058|gb|EEW88150.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 1 str. 16M]
 gi|260669354|gb|EEX56294.1| phosphate ABC transporter [Brucella abortus bv. 4 str. 292]
 gi|260671193|gb|EEX58014.1| phosphate ABC transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675921|gb|EEX62742.1| phosphate ABC transporter [Brucella abortus bv. 6 str. 870]
 gi|260874366|gb|EEX81435.1| phosphate ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|260916695|gb|EEX83556.1| phosphate ABC transporter [Brucella abortus bv. 3 str. Tulya]
 gi|261300059|gb|EEY03556.1| phosphate ABC transporter [Brucella neotomae 5K33]
 gi|262764881|gb|EEZ10802.1| phosphate ABC transporter [Brucella melitensis bv. 3 str. Ether]
 gi|263003228|gb|EEZ15521.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092823|gb|EEZ16998.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 2 str. 63/9]
 gi|294819957|gb|EFG36956.1| phosphate ABC transporter [Brucella sp. NVSL 07-0026]
 gi|297174535|gb|EFH33882.1| phosphate ABC transporter, permease PstA [Brucella abortus bv. 5
           str. B3196]
 gi|306287093|gb|EFM58598.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO2]
 gi|326410139|gb|ADZ67204.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis M28]
 gi|326539859|gb|ADZ88074.1| phosphate ABC transporter, permease protein PstA [Brucella
           melitensis M5-90]
          Length = 436

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|17988270|ref|NP_540904.1| phosphate ABC transporter permease [Brucella melitensis bv. 1 str.
           16M]
 gi|17984039|gb|AAL53168.1| phosphate transport system permease protein psta [Brucella
           melitensis bv. 1 str. 16M]
          Length = 436

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTARPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|86356165|ref|YP_468057.1| phosphate ABC transporter, permease protein [Rhizobium etli CFN 42]
 gi|86280267|gb|ABC89330.1| phosphate ABC transporter, permease protein [Rhizobium etli CFN 42]
          Length = 440

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/417 (55%), Positives = 307/417 (73%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEF+E  +DP 
Sbjct: 24  IKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFTEKTIDPN 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R A+ MLS +A   LR  ++ DP
Sbjct: 84  NKRASDPSVLVAANYPVLLRDAIVKQLNINASSKPDVRDATAMLSKSAPIQLRDMVVADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           SLIGKTV VS+LA ANIDSA KG   L       +++D Q  W  +L + GAL  +FN G
Sbjct: 144 SLIGKTVNVSVLADANIDSANKGQIDLSVDEKNRKVNDKQVNWMNQLKASGALTKEFNTG 203

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F+NG SSRPE AG+GVA++GSLY+MLIV+ LS P+G+A++IYLEEF+ K   +  ++ N
Sbjct: 204 LFVNGNSSRPEAAGLGVALIGSLYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEVN 263

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP S
Sbjct: 264 INNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPS 323

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P 
Sbjct: 324 IRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPA 383

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              + +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 384 TPLEPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|254718180|ref|ZP_05179991.1| phosphate ABC transporter, permease protein PstA [Brucella sp.
           83/13]
 gi|265983137|ref|ZP_06095872.1| phosphate ABC transporter [Brucella sp. 83/13]
 gi|306837694|ref|ZP_07470563.1| phosphate ABC transporter, permease protein PstA [Brucella sp. NF
           2653]
 gi|264661729|gb|EEZ31990.1| phosphate ABC transporter [Brucella sp. 83/13]
 gi|306407252|gb|EFM63462.1| phosphate ABC transporter, permease protein PstA [Brucella sp. NF
           2653]
          Length = 436

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 297/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGVMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE + +GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSSLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|256370536|ref|YP_003108047.1| phosphate ABC transporter, permease protein [Brucella microti CCM
           4915]
 gi|256000699|gb|ACU49098.1| phosphate ABC transporter, permease protein [Brucella microti CCM
           4915]
          Length = 436

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 297/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+ID A KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDPAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|225626509|ref|ZP_03784548.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           str. Cudo]
 gi|254707342|ref|ZP_05169170.1| phosphate ABC transporter, permease protein PstA [Brucella
           pinnipedialis M163/99/10]
 gi|254709116|ref|ZP_05170927.1| phosphate ABC transporter, permease protein PstA [Brucella
           pinnipedialis B2/94]
 gi|256030642|ref|ZP_05444256.1| phosphate ABC transporter, permease protein PstA [Brucella
           pinnipedialis M292/94/1]
 gi|256158644|ref|ZP_05456527.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           M490/95/1]
 gi|256254048|ref|ZP_05459584.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           B1/94]
 gi|260169546|ref|ZP_05756357.1| phosphate ABC transporter, permease protein PstA [Brucella sp.
           F5/99]
 gi|261221188|ref|ZP_05935469.1| phosphate ABC transporter [Brucella ceti B1/94]
 gi|261314825|ref|ZP_05954022.1| phosphate ABC transporter [Brucella pinnipedialis M163/99/10]
 gi|261316616|ref|ZP_05955813.1| phosphate ABC transporter [Brucella pinnipedialis B2/94]
 gi|261759073|ref|ZP_06002782.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. F5/99]
 gi|265987688|ref|ZP_06100245.1| phosphate ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|265997149|ref|ZP_06109706.1| phosphate ABC transporter [Brucella ceti M490/95/1]
 gi|225618166|gb|EEH15209.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           str. Cudo]
 gi|260919772|gb|EEX86425.1| phosphate ABC transporter [Brucella ceti B1/94]
 gi|261295839|gb|EEX99335.1| phosphate ABC transporter [Brucella pinnipedialis B2/94]
 gi|261303851|gb|EEY07348.1| phosphate ABC transporter [Brucella pinnipedialis M163/99/10]
 gi|261739057|gb|EEY27053.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. F5/99]
 gi|262551617|gb|EEZ07607.1| phosphate ABC transporter [Brucella ceti M490/95/1]
 gi|264659885|gb|EEZ30146.1| phosphate ABC transporter [Brucella pinnipedialis M292/94/1]
          Length = 436

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 297/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG   L  P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++ W
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERCW 436


>gi|148559657|ref|YP_001259938.1| phosphate ABC transporter permease PstA [Brucella ovis ATCC 25840]
 gi|148370914|gb|ABQ60893.1| phosphate ABC transporter, permease protein PstA [Brucella ovis
           ATCC 25840]
          Length = 436

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 236/419 (56%), Positives = 298/419 (71%), Gaps = 4/419 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL   L S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCAFLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYL---YSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
           PSLIG T  + +LA A+IDSA KG +    S  N  ++SD Q  W + L  +G +   FN
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVSETN-RKVSDRQVGWMKTLSDEGIMKQAFN 197

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
            G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++
Sbjct: 198 TGLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIE 257

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
            NINNLA+VPSIV+G+LG AVLINFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP
Sbjct: 258 VNINNLAAVPSIVFGLLGLAVLINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVP 317

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            SIRSA LGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D 
Sbjct: 318 PSIRSAVLGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADV 377

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           P    D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 378 PATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|218673762|ref|ZP_03523431.1| phosphate ABC transporter, permease protein [Rhizobium etli GR56]
          Length = 439

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 230/417 (55%), Positives = 304/417 (72%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEF+E  +DP 
Sbjct: 23  IKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFTEKTIDPD 82

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP++L+ A+Y +L+R A+ ++L+I+ ++   +R A+ MLS +A   LR  ++ DP
Sbjct: 83  NKRATDPSVLVAANYPVLLRDAIVKQLNINAASRPDVRDATAMLSKSAPIQLRDMVVADP 142

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           SLIGKTV VSLLA AN+DSA KG   L       +++D Q  W  +L + GAL   FN G
Sbjct: 143 SLIGKTVNVSLLADANVDSANKGQIDLSVDEKNRKVNDKQVTWMNQLKASGALHKQFNTG 202

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F+ G SSRPE AG+GVA+VGS Y+MLIV+ LS P+G+A++IYLEEF+ K   +  ++ N
Sbjct: 203 LFVKGNSSRPEAAGLGVALVGSFYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEVN 262

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP S
Sbjct: 263 INNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPS 322

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P 
Sbjct: 323 IRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPT 382

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              + +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 383 TPLEPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 439


>gi|116250316|ref|YP_766154.1| transmembrane component of ABC transporter [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115254964|emb|CAK06038.1| putative transmembrane component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 440

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/417 (54%), Positives = 305/417 (73%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEF E  +DP 
Sbjct: 24  IKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFVEKTIDPN 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP++L+ A+Y +L+R A+ ++L+++ S+   +R A+ MLS +A   LR  +M DP
Sbjct: 84  NKRATDPSVLIAANYPVLLRDAIVKQLNVNASSRPDVRDATAMLSKSAPIQLRDMVMADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           S+IGKT+ V++LA AN+DSA KG   L       +++D Q  W  +L + GAL   FN G
Sbjct: 144 SIIGKTINVTVLADANVDSANKGQIDLSVDEKNRKVNDKQVGWMNELKASGALHKQFNTG 203

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F+NG SSRPE AG+GVA++GSLY+MLIV+ L+ P+G+A++IYLEEF+ K   +  ++ N
Sbjct: 204 LFVNGNSSRPEAAGLGVALIGSLYLMLIVLVLALPIGVAASIYLEEFAPKNKLTDLIEVN 263

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP S
Sbjct: 264 INNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPS 323

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P 
Sbjct: 324 IRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPT 383

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              D +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 384 TPLDPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|209547779|ref|YP_002279696.1| phosphate ABC transporter inner membrane subunit PstA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533535|gb|ACI53470.1| phosphate ABC transporter, inner membrane subunit PstA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 440

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 230/417 (55%), Positives = 305/417 (73%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  F+ Y + A+    +FL +LL +++ KG  A  QT I+LPIEF+E  +DP 
Sbjct: 24  IKRRYAAERRFQAYGIAAIAFGLIFLFILLWTVIGKGYTAFQQTAITLPIEFTEKAIDPS 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R AS MLS  A   LR  ++ DP
Sbjct: 84  NKRATDPSVLIAANYPVLLRDAIVKQLNINASSKPDVRDASAMLSKGAPIQLRDMVVADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           SLIGKTV V++LA AN+DSA KG   L       +++D Q  W  +L + GAL   FN G
Sbjct: 144 SLIGKTVNVTVLADANVDSANKGQIDLTVDEKNRKVNDKQVGWMNELKASGALHKQFNTG 203

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F+NG SSRPE AG+GVA++GSLY+MLIV+ L+ P+G+A++IYLEEF+ K   +  ++ N
Sbjct: 204 LFVNGNSSRPEAAGLGVALIGSLYLMLIVLVLALPIGVAASIYLEEFAPKNRLTDLIEVN 263

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP S
Sbjct: 264 INNLAAVPSIVYGLLGLSVFINFVGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPS 323

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P 
Sbjct: 324 IRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPT 383

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              D +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 384 TPLDPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|241202934|ref|YP_002974030.1| phosphate ABC transporter membrane protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240856824|gb|ACS54491.1| phosphate ABC transporter, inner membrane subunit PstA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 440

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/417 (54%), Positives = 305/417 (73%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEFSE  +DP 
Sbjct: 24  IKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDPN 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP++L+ A+Y +L+R A+ ++L+++ ++   +R AS MLS  A   LR  ++ DP
Sbjct: 84  NKRATDPSVLIAANYPVLLRDAIVKQLNVNAASRPDVRDASAMLSKGAPVQLRDMVVADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           S+IGKTV V++LA AN+DSA KG   L       +++D Q  W  +L + GAL   FN G
Sbjct: 144 SIIGKTVNVTVLADANVDSANKGQIDLSVDEKNRKVNDKQVGWMNELKASGALHKQFNTG 203

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F+NG SSRPE AG+GVA++GSLY+MLIV+ L+ P+G+A++IYLEEF+ K   +  ++ N
Sbjct: 204 LFVNGNSSRPEAAGLGVALIGSLYLMLIVLVLALPIGVAASIYLEEFAPKNKLTDLIEVN 263

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP S
Sbjct: 264 INNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPS 323

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P 
Sbjct: 324 IRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPT 383

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              D +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 384 TPLDPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|319781151|ref|YP_004140627.1| phosphate ABC transporter inner membrane subunit PstA
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167039|gb|ADV10577.1| phosphate ABC transporter, inner membrane subunit PstA
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 438

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/418 (55%), Positives = 296/418 (70%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y VVA+ V   FL ++L +IVSKG  A WQT +SLPI F E ++DP
Sbjct: 21  GLKARYAAERRFRIYGVVAISVGLAFLAIMLITIVSKGYTAFWQTTVSLPITFDEKVIDP 80

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L++A+Y  L   AL  KL IS  +  ++++    LS  AR  LR  +  D
Sbjct: 81  SGKRATDPSVLIKANYPKLAENALVAKLGISPDDKPMIQKLKGFLSEGARVQLRDIVAAD 140

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IG T +V++LA+AN+DSA KG   L       ++SD Q  W  KL ++GA+   FN 
Sbjct: 141 PSVIGTTRDVNILAAANLDSAFKGQIDLSVEEARRKVSDQQITWMNKLKAEGAMAEHFNS 200

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA++GS YMM+IV+ L+ P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 201 GLFTYGASSRPETSGMGVAIIGSFYMMVIVLLLALPIGVAASIYLEEFAKKNRFTDLIEV 260

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INF  MPRS A VGGL+L LMTLP+IIIAT  AL  VP 
Sbjct: 261 NINNLAAVPSIVFGLLGLAVFINFLGMPRSAAFVGGLVLTLMTLPTIIIATRAALAAVPP 320

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK+Q VF H+LPLA P ILTG+ + LARALGETAPLL +GMVAFV D P
Sbjct: 321 SIRSAALGLGASKMQMVFQHILPLAAPGILTGTIIGLARALGETAPLLLIGMVAFVADPP 380

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQIY+WA +AER FVER  GAI++LL+FL  +N   + LR RF++RW
Sbjct: 381 TTPFDPATALPVQIYMWANEAERAFVERMSGAIIILLVFLMAMNITAIVLRRRFERRW 438


>gi|227820731|ref|YP_002824701.1| phosphate ABC transporter, permease protein [Sinorhizobium fredii
           NGR234]
 gi|227339730|gb|ACP23948.1| phosphate ABC transporter, permease protein [Sinorhizobium fredii
           NGR234]
          Length = 440

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 300/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  FR Y + A+ +   FL +LL S+ SKG  A  QT I+LPIEFSE ++DP
Sbjct: 23  GIKRRYAAERRFRAYGISAIAIGLFFLAVLLWSVASKGYTAFQQTTITLPIEFSEKVIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
           + +R  DP  L+ A+Y +LVR AL ++L I      L++QA+ M+S + R  LR  +  D
Sbjct: 83  KNERATDPKQLMTANYPVLVRDALVKQLGIDPKKRPLVKQATDMVSDSVRTQLRDIVTGD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IGKT+ V+LLA ANIDSA KG   L    +  ++ D Q  W  +L   G L   FN 
Sbjct: 143 PSVIGKTIPVTLLADANIDSAFKGQIDLSVEESKRKVKDQQVTWMNELAEAGVLKKSFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE AG+GVA+VGS YMMLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GIFSFGASSRPEAAGVGVALVGSAYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG AV +NF  MPRS ALVGG +L LMTLP+IIIAT  AL+ VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLAVFVNFAGMPRSAALVGGFVLTLMTLPTIIIATRAALKAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK+QT+FHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV DYP
Sbjct: 323 SIRSAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVVDYP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               + +TA PVQIY+WA +AER FVERT GAI++LLIFL ++N   + LR RF++RW
Sbjct: 383 GSPLEPSTALPVQIYMWANEAERAFVERTSGAIIILLIFLIIMNLGAILLRRRFERRW 440


>gi|150395349|ref|YP_001325816.1| phosphate ABC transporter inner membrane subunit PstA
           [Sinorhizobium medicae WSM419]
 gi|150026864|gb|ABR58981.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium medicae WSM419]
          Length = 440

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 303/418 (72%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  FR +   A+ +   FL +LL S+VSKG  A  QT I+LPIEFSE ++DP
Sbjct: 23  GIKRRYAAERRFRAFGFGAIAIGLFFLAVLLWSVVSKGYTAFQQTTITLPIEFSEKVIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
           + +R  DP  L  A+Y LLVR+AL ++L +  +   L++QA+ M+S +AR  LR  ++ D
Sbjct: 83  KNERATDPKQLFTANYPLLVREALVKQLGLDQAKRPLVKQATDMVSASARSQLRDIVVAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYSPANVHR--MSDYQWKWFQKLDSDGALFLDFNY 187
           P++IGKT+ V+LLA ANIDSA KG +    +  R  + D Q  W   L  +G L   FN 
Sbjct: 143 PTVIGKTIPVTLLADANIDSAFKGQIDLTVDEARRKVKDEQVAWMNTLAEEGVLKKSFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE AG+GVA++GSLYMMLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GIFTFGASSRPEAAGVGVALLGSLYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG AV INF+ MPRS ALVG  +L LMTLP+IIIAT  AL+ VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLAVFINFWGMPRSAALVGAFVLTLMTLPTIIIATRAALKAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK+QTVFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV D+P
Sbjct: 323 SIRSAALGLGASKMQTVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVVDFP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               + +TA PVQIY+WA +AER FVERT GAI++LLIFL  +N   + LR RF++RW
Sbjct: 383 GSPLEPSTALPVQIYMWANEAERAFVERTSGAIIILLIFLIFMNLGAILLRRRFERRW 440


>gi|15964265|ref|NP_384618.1| phosphate ABC transporter permease [Sinorhizobium meliloti 1021]
 gi|307307002|ref|ZP_07586741.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium meliloti BL225C]
 gi|307320656|ref|ZP_07600069.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium meliloti AK83]
 gi|15073442|emb|CAC45084.1| Putative phosphate transport system permease ABC transporter
           [Sinorhizobium meliloti 1021]
 gi|306893691|gb|EFN24464.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium meliloti AK83]
 gi|306901942|gb|EFN32541.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium meliloti BL225C]
          Length = 440

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 302/418 (72%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  FR + + A+ +   FL +LL S+VSKG  A  QT I+LPIEFSE ++DP
Sbjct: 23  GIKRRYAAERRFRAFGMSAIAIGLFFLAVLLWSVVSKGYTAFQQTTITLPIEFSEKVIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
           + +R  DP  L  A+Y LLVR+AL ++L +  S   L++QA+ M+S +AR  LR  ++ D
Sbjct: 83  KNERATDPKQLYTANYPLLVREALVKQLGLDPSKRPLVKQAADMVSASARTQLRDIVVAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IG+T+ V+LLA ANIDSA KG   L       ++ D Q  W  +L   G L   FN 
Sbjct: 143 PSVIGRTIPVTLLAEANIDSAFKGQIDLSVDETKRKVKDEQVAWMNQLAEAGVLKKSFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE AG+GVA++GSLYMMLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GIFTFGASSRPEAAGVGVALLGSLYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG AV +NF  MPRS ALVG  +L LMTLP+IIIAT  AL+ VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLAVFVNFAGMPRSAALVGAFVLTLMTLPTIIIATRAALKAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK+QT+FHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV D+P
Sbjct: 323 SIRSAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVVDFP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               + +TA PVQIY+WA +AER FVERT GAI++LLIFL  +N   + LR RF++RW
Sbjct: 383 GSPLEPSTALPVQIYMWANEAERAFVERTSGAIIILLIFLIFMNLGAILLRRRFERRW 440


>gi|121602070|ref|YP_989478.1| phosphate ABC transporter, permease protein PstA [Bartonella
           bacilliformis KC583]
 gi|120614247|gb|ABM44848.1| phosphate ABC transporter, permease protein PstA [Bartonella
           bacilliformis KC583]
          Length = 430

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/430 (52%), Positives = 309/430 (71%), Gaps = 5/430 (1%)

Query: 1   MKSFSINKK---NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHIS 57
           MK  S++ +    LK RY +E  FR Y ++A+ +   FL +LL S++S+G  A +Q+ ++
Sbjct: 1   MKEHSLSHRRNIGLKRRYWAERRFRAYGLIAIFIGLSFLAILLWSVISRGYTAFFQSEMA 60

Query: 58  LPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTT 117
           L +   E I+DP  +R ++P IL+ A+Y LL+  ALA KL +  ++  L+R  S+M S  
Sbjct: 61  LSVYLDEKIIDPNGQRMINPKILMTANYPLLISNALATKLGVDHNDQVLMRNVSRMFSHG 120

Query: 118 ARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKL 175
            R  LR  ++ +P+LIG T ++ +LA+A+IDSA KG   L+      ++ D + +W + L
Sbjct: 121 IRVQLRDMVIKNPNLIGTTQKIKVLAAADIDSACKGQINLHVTGKNRKIFDQRIEWMKHL 180

Query: 176 DSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
             DG L+  FNYGFFI+GASSRPE +G+GVA++GSL+MM+IV+  S P+G+A+AIYLEE+
Sbjct: 181 TDDGTLYQAFNYGFFISGASSRPETSGLGVAIMGSLFMMIIVLMGSLPIGMATAIYLEEY 240

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
            HK   +  ++ NINNLA+VPSI++G+LG +V IN   MPRS + VGGL+L LMTLP+II
Sbjct: 241 GHKNKLTDLIEININNLAAVPSIIFGLLGLSVFINVCGMPRSASFVGGLVLTLMTLPTII 300

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT  ALR VP SIR+AALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL
Sbjct: 301 IATRSALRAVPFSIRAAALGLGASKTQMVFHHVVPLAAPGILTGTIIGLAQALGETAPLL 360

Query: 356 FVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            VGMVAFV + P    D ATA PVQI++WA +AER FVE+T GAI++L+IFLAV+N A +
Sbjct: 361 LVGMVAFVANIPTTPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLMIFLAVMNIAAV 420

Query: 416 WLRNRFKKRW 425
            LR RF++RW
Sbjct: 421 LLRRRFERRW 430


>gi|222147390|ref|YP_002548347.1| phosphate ABC transporter permease protein [Agrobacterium vitis S4]
 gi|221734380|gb|ACM35343.1| phosphate ABC transporter permease protein [Agrobacterium vitis S4]
          Length = 445

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 236/417 (56%), Positives = 308/417 (73%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  FR Y +VA+    +FL+LLL+S+VSKG  A  QT I++P+EFSE ++DP 
Sbjct: 29  IKRRYAAERRFRAYGIVAISFGLLFLLLLLTSVVSKGYTAFLQTTITVPVEFSEKLIDPS 88

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            +R  +P +L+ A+Y +LVR ALA KL I  SN   ++Q ++M+S   R  LR  ++ DP
Sbjct: 89  NQRATNPDVLVAANYPVLVRNALAAKLKIDTSNRPAMKQLTEMVSDNVRVQLRNMVVADP 148

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
            L+GKTV VS+LASA ID+A KG   L    +  ++SD Q  W   L   GAL   FN G
Sbjct: 149 LLVGKTVPVSVLASATIDTAFKGQFDLTVDESSRKISDQQIGWMNTLAESGALAKSFNTG 208

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F+NGASSRPE AG+GVA++G+ YMML V+ L+ P+G+A++IYLEEF+ K  ++  ++ N
Sbjct: 209 IFVNGASSRPEAAGVGVALIGTAYMMLTVLILALPIGVATSIYLEEFAPKNRWTDLIEVN 268

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIV+G+LG AV INF  +PRS +LVGGL+L LMTLP+IIIAT  AL+ VP S
Sbjct: 269 INNLAAVPSIVFGLLGLAVFINFAGLPRSASLVGGLVLTLMTLPTIIIATRAALKAVPPS 328

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+QTVFHHVLPLAMP +LTG+ + LA ALGETAPLL +GMVAFV DYP 
Sbjct: 329 IRAAALGLGASKMQTVFHHVLPLAMPGVLTGTIIGLAHALGETAPLLLIGMVAFVADYPG 388

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              D +TA PVQIY+WA +AER FVERT GAI++LLIFL ++N   + LR RF++RW
Sbjct: 389 TPLDPSTALPVQIYMWANEAERAFVERTSGAIIILLIFLLIMNVGAILLRRRFERRW 445


>gi|319898364|ref|YP_004158457.1| phosphate ABC transporter, permease protein [Bartonella
           clarridgeiae 73]
 gi|319402328|emb|CBI75867.1| phosphate ABC transporter, permease protein [Bartonella
           clarridgeiae 73]
          Length = 430

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/426 (52%), Positives = 306/426 (71%), Gaps = 4/426 (0%)

Query: 4   FSINKKN--LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           F  +++N  LK RY +E  FR Y + A+ +   FL+ LL SI+S+G  A +Q  + L + 
Sbjct: 5   FFAHRRNIGLKGRYRAERRFRAYGLSAIFISLFFLVALLWSIISQGYTAFFQNEMILSVY 64

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
             E ++DP  +R  +P IL+ A+Y LLVR ALA KL +  ++   +R  ++M S + R  
Sbjct: 65  LDEKVIDPGGQRESNPKILITANYPLLVRNALAEKLGVDQNDQPSMRDINRMFSQSVRVQ 124

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDG 179
           LR  +  +P+LIG T ++ +LA+ANIDSA KG   L+ P    ++SD Q KW + L +DG
Sbjct: 125 LRDIITKNPNLIGTTQKIKVLAAANIDSACKGQIDLHVPEKNRKISDQQIKWMKYLINDG 184

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            L+  FN  FF  GASSRPE +G+GVA++GS YMM+IV+ +S P+GIA+A+YLEE++ K 
Sbjct: 185 TLYKTFNRHFFTFGASSRPETSGLGVAMIGSFYMMIIVLVISLPIGIATALYLEEYARKN 244

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            F+ F++ NINNLA+VPSIV+G+LG AV INF  MPRS + VGGL+LALMTLP+IIIAT 
Sbjct: 245 KFTDFIEININNLAAVPSIVFGLLGLAVFINFMGMPRSASFVGGLVLALMTLPTIIIATR 304

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            ALR VP SIR+ ALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL +GM
Sbjct: 305 SALRAVPFSIRAGALGLGASKTQMVFHHVIPLAAPGILTGTIIGLAQALGETAPLLLIGM 364

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAFV D P+   D ATA PVQI++WA++AER FVE+T GAI++L++FL  +N + + LR 
Sbjct: 365 VAFVVDIPMTPMDPATALPVQIFMWASEAERAFVEKTSGAIIILMVFLVFMNISAVILRR 424

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 425 RFERRW 430


>gi|90418938|ref|ZP_01226849.1| permease protein, ABC-type phosphate transporter [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337018|gb|EAS50723.1| permease protein, ABC-type phosphate transporter [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 439

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/418 (53%), Positives = 297/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y +VA+ +   FL+ LL S+VSKG  A WQT I +P+ FSE ++  
Sbjct: 22  GIKRRYRAERRFKIYGIVAIAIGLFFLVALLWSVVSKGYTAFWQTEIQVPVTFSEEVIGS 81

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
           ++    +P  L+ A+Y  L R  L + L +   + A +++  +++S+  R  LR  ++ D
Sbjct: 82  RQDALDNPTKLMMANYPTLARDGLVQMLGVDAEDRAAVKEVGKLISSGVRVQLRDMVLND 141

Query: 130 PSLIGKTVEVSLLASANIDSALKG-YLYSPANVHR-MSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IG T ++ L A + +DSALKG Y  + A   R +SD Q  W  +L   GA+   FN+
Sbjct: 142 PSIIGTTQDIWLYAGSELDSALKGQYDLTVAEGRRPISDRQLGWIDRLQESGAIEKRFNW 201

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSR E AG+GVA+VGSLYMM IV+ L+ P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 202 GLFTFGASSRAETAGVGVAIVGSLYMMGIVLVLALPIGVAASIYLEEFAPKNRFTDLIEV 261

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV IN+F +PRS ALVGGL+L LMTLP+IIIAT  AL+ VP 
Sbjct: 262 NINNLAAVPSIVFGLLGLAVFINWFGLPRSAALVGGLVLTLMTLPTIIIATRAALKAVPP 321

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK+Q VF HVLPLAMP ILTG+ + LA+ALGETAPLL +GMVAFV DYP
Sbjct: 322 SIRSAALGLGASKMQMVFQHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMVAFVADYP 381

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQI++WA +AER FVERT GAI++LL FLAV+N   + LR RF++RW
Sbjct: 382 SSPMDASTALPVQIFMWANEAERAFVERTSGAIMILLAFLAVMNITAILLRRRFERRW 439


>gi|49475057|ref|YP_033098.1| phosphate ABC transporter permease [Bartonella henselae str.
           Houston-1]
 gi|49237862|emb|CAF27057.1| Phosphate transport system permease protein [Bartonella henselae
           str. Houston-1]
          Length = 430

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 316/427 (74%), Gaps = 4/427 (0%)

Query: 2   KSFSINKKN--LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           + FS +++N  LK RY +E  FR Y ++A+ +   FL  LL S++S+G  A +QT ++L 
Sbjct: 3   EDFSFSRRNIGLKRRYWAERRFRAYGLIAIFIGLFFLFALLWSVISQGYTAFFQTEMTLS 62

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR 119
           I   E ++DP  +R  +P IL+ A+Y LLVR ALARKL+I  ++ A LR  ++M S + R
Sbjct: 63  IYLDEKVIDPSGQRLANPQILITANYPLLVRNALARKLNIDQNDRASLRDINRMFSNSVR 122

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR+ +  +P LIG T ++ +LA+A+IDSA KG   L+      ++S+ Q +W ++L  
Sbjct: 123 VQLREIVTKNPQLIGTTQKIKVLAAADIDSAYKGQIDLHVAEKNRKISNRQVEWMKRLAY 182

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DG L+  FN+GFF  GASSRPE AG+GVA++GS YM++IV+ +S P+GIA+A+YLEE++ 
Sbjct: 183 DGTLYKTFNFGFFTFGASSRPETAGLGVAIIGSFYMIIIVLVISLPIGIATALYLEEYAR 242

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K  F+ F++ NINNLA+VPSIV+G+LG AV +NFF +PRS + VGGL+LALMTLP+IIIA
Sbjct: 243 KNKFTDFIEVNINNLAAVPSIVFGLLGLAVFVNFFGLPRSASFVGGLVLALMTLPTIIIA 302

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  ALR VP SIR+AALGLGASK Q VFHHVLPLA P ILTG+ + +A+ALGETAPLL +
Sbjct: 303 TRSALRAVPFSIRAAALGLGASKTQVVFHHVLPLAAPGILTGTIIGVAQALGETAPLLLI 362

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAFV + P    D ATA PVQI++WA +AER FVE+T GAI++L+IFL+++N + ++L
Sbjct: 363 GMVAFVVNIPATPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLMIFLSIMNISAVFL 422

Query: 418 RNRFKKR 424
           R RF++R
Sbjct: 423 RRRFERR 429


>gi|15887770|ref|NP_353451.1| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
 gi|15155340|gb|AAK86236.1| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
          Length = 440

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 230/417 (55%), Positives = 305/417 (73%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  FR Y + A+    +FL LLL S+VSKG  A  QT I++P+EFSE I+DP+
Sbjct: 24  IKRRYAAERRFRAYGMAAISFGLLFLFLLLFSVVSKGYTAFQQTMITVPVEFSEQIIDPK 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            +R  +PA L+ A+Y ++ R A+A+ L I+ ++ A LR  + ++S + R  LR  ++ DP
Sbjct: 84  NERATNPAKLMTANYPVVARDAVAKVLGIAPTDRAGLRAVNLLISDSVRTQLRDIVVADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANV--HRMSDYQWKWFQKLDSDGALFLDFNYG 188
           ++IG T  V+LLAS ++DSA KG +   A+    R+S+ Q  W  +L   G L   FN G
Sbjct: 144 AVIGTTRTVTLLASGDVDSAFKGQVDLTADEANRRISNQQLGWMNQLAESGQLGKHFNTG 203

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            FINGASSRPE AG+GVA++GS YMMLIV+ L+ P+G+A++IYLEEF+ K   +  ++ N
Sbjct: 204 IFINGASSRPEAAGVGVALIGSFYMMLIVLVLALPIGVAASIYLEEFAPKNRLTDLIEVN 263

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIVYG+LG +V INF   PRS +LVGGL+L LMTLP+IIIAT  AL+ VP S
Sbjct: 264 INNLAAVPSIVYGLLGLSVFINFMGFPRSASLVGGLVLTLMTLPTIIIATRAALKAVPPS 323

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK+QT+FHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV +YP 
Sbjct: 324 IRAAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANYPT 383

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              D +TA PVQIY+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 384 TPMDPSTALPVQIYMWANEAERAFVERTSGAIIILLLFLIVMNVGAILLRRRFERRW 440


>gi|325291855|ref|YP_004277719.1| phosphate ABC transporter, permease protein [Agrobacterium sp.
           H13-3]
 gi|325059708|gb|ADY63399.1| phosphate ABC transporter, permease protein [Agrobacterium sp.
           H13-3]
          Length = 440

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 232/418 (55%), Positives = 305/418 (72%), Gaps = 4/418 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  FR Y + A+    +FL LLL S+VSKG  A  QT I++P+EFSE I+DP+
Sbjct: 24  IKRRYAAERRFRGYGLAAISFGLIFLFLLLWSVVSKGHTAFQQTMITVPVEFSELIIDPK 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            +R  +PA L+ A+Y +L R A+A+ L ++ ++ A LR  + M+S + R  LR  ++ DP
Sbjct: 84  NERATNPAKLMTANYPVLARDAVAKVLGVAPTDKAGLRAVNVMISDSVRTQLRDIVVADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGYLY---SPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           S+IG T  V+LLAS ++DSA KG +      AN  R+S+ Q  W  +L   G L   FN 
Sbjct: 144 SVIGTTRSVTLLASGDVDSAFKGQVDMSGDEAN-RRISNQQLGWMNQLVESGQLGKHFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+NGASSRPE AG+GVA++GS YMMLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GIFVNGASSRPEAAGVGVALIGSFYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V INF   PRS +LVGGL+L LMTLP+IIIAT  AL+ VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLSVFINFMGFPRSASLVGGLVLTLMTLPTIIIATRAALKAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+QT+FHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV +YP
Sbjct: 323 SIRAAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANYP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FL ++N   + LR RF++RW
Sbjct: 383 TTPMDPSTALPVQIYMWANEAERAFVERTSGAIIILLLFLILMNVGAILLRRRFERRW 440


>gi|240849906|ref|YP_002971295.1| phosphate ABC transporter, permease protein PstA [Bartonella
           grahamii as4aup]
 gi|240267029|gb|ACS50617.1| phosphate ABC transporter, permease protein PstA [Bartonella
           grahamii as4aup]
          Length = 429

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 219/417 (52%), Positives = 302/417 (72%), Gaps = 2/417 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
           +LK RY +E  FR Y ++A+ +   FL  LL SI+S+G  A +Q+ ++L I   E I+DP
Sbjct: 12  SLKRRYWAERRFRAYGLIAIFIGLFFLFTLLWSIISQGYTAFFQSEMTLLIYLDEKIIDP 71

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             +    P +L+ A+Y LLVR ALA+KL+I  ++ A LR+ ++M S   R  LR+ +  +
Sbjct: 72  SGQHKTKPRVLMTANYPLLVRNALAKKLNIDQNDRASLREVNRMFSNGVRVQLREMVTKN 131

Query: 130 PSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P LIG   +V +LASA+IDSA KG   L       ++S+ Q +W ++L  DG L+  FN 
Sbjct: 132 PKLIGTMQKVKVLASADIDSAYKGQIDLRVAEKNRKVSNRQVEWIKRLAHDGTLYKTFNI 191

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFF  GASSRPE AG+GVA++GSLYM+ IV+ +S P+GIA+A+YL E++ K  F+ F++ 
Sbjct: 192 GFFTFGASSRPETAGLGVAIIGSLYMIGIVLLVSLPIGIATALYLAEYARKNKFTDFIEV 251

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG +  +NF  +PRS + VGGL+LALMTLP+IIIAT  ALR VP 
Sbjct: 252 NINNLAAVPSIVFGLLGLSFFVNFLGLPRSASFVGGLVLALMTLPTIIIATRSALRAVPL 311

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK Q +FHHV+PLA P ILTG+ + +A+ALGETAPLL +GMVAFV + P
Sbjct: 312 SIRAAALGLGASKTQMIFHHVVPLAAPGILTGTIIGVAQALGETAPLLLIGMVAFVVNIP 371

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
               D ATA PVQI++WA +AER FVE+T GAI++L+IFLA++N + ++LR RF++R
Sbjct: 372 TTPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLMIFLAIMNISAVFLRRRFERR 428


>gi|319403657|emb|CBI77242.1| phosphate ABC transporter, permease protein [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 430

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 229/429 (53%), Positives = 312/429 (72%), Gaps = 6/429 (1%)

Query: 2   KSFSINKKN--LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           ++F  +++N  LK RY +E  FR Y + A+ +   FL +LL SIVS+G  A +Q+ + L 
Sbjct: 3   EAFFSHRRNIDLKGRYRAERRFRIYGLSAIFISLFFLAILLWSIVSQGYTAFFQSEMILS 62

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTA 118
           +   E ++DP  +R  +P IL+ A+Y LLV+ ALA KL + D NH + +R  ++M S + 
Sbjct: 63  VYLDEKVIDPSGQRESNPKILVTANYPLLVQNALATKLGV-DLNHQISMRNVNRMFSQSV 121

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLD 176
           R  LR  ++ +P LIG T +V +LA+++IDSA KG   L+ P    ++SD Q +W + L 
Sbjct: 122 RVQLRDIVVKNPHLIGTTQKVKVLAASDIDSAYKGQINLHVPEKNRKISDQQIQWMKYLI 181

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           +DG L+  FN  FF  GASSRPE +G+GVA++GSLYMM+IV+ +S P+GIA+A+YLEE++
Sbjct: 182 NDGTLYKTFNRHFFTFGASSRPETSGLGVAMIGSLYMMIIVLVISLPIGIATALYLEEYA 241

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K  F+ F++ NINNLA+VPSIV+G+LG AV INF  MPRS + VGGL+LALMTLP+III
Sbjct: 242 RKNKFTDFIEININNLAAVPSIVFGLLGLAVFINFMGMPRSASFVGGLVLALMTLPTIII 301

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           AT  ALR VP SIR+ ALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 302 ATRSALRAVPFSIRAGALGLGASKTQMVFHHVIPLAAPGILTGTIIGLAQALGETAPLLL 361

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           +GMVAFV D P+   D ATA PVQI++WA++AER FVE+T GAI++L+IFL  +N A + 
Sbjct: 362 IGMVAFVVDIPITPMDPATALPVQIFMWASEAERSFVEKTSGAIIILMIFLIFMNIAAVL 421

Query: 417 LRNRFKKRW 425
           LR RF++RW
Sbjct: 422 LRRRFERRW 430


>gi|163867537|ref|YP_001608736.1| phosphate ABC transporter, permease protein [Bartonella tribocorum
           CIP 105476]
 gi|161017183|emb|CAK00741.1| phosphate ABC transporter, permease protein [Bartonella tribocorum
           CIP 105476]
          Length = 429

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 212/403 (52%), Positives = 298/403 (73%), Gaps = 2/403 (0%)

Query: 24  YCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRA 83
           Y ++A+ +   FL  LL SI+S+G  A +Q+ ++L I   E I+DP  +R   P +L+ A
Sbjct: 26  YGLIAIFIGLFFLFALLWSIISQGYTAFFQSEMTLSIYLDEKIIDPSGQRQTKPQVLITA 85

Query: 84  DYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLA 143
           +Y LLVR ALA+KL ++ ++ A LR  ++M S   R  LR+ +  +P LIG T ++ +LA
Sbjct: 86  NYPLLVRNALAKKLDVNQNDRASLRDINRMFSNGVRVQLREMVTKNPKLIGTTQKIKVLA 145

Query: 144 SANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVA 201
           +A+IDSA KG   L+      ++S+ Q +W ++L  DG L+  FN GFF  GASSRPE+A
Sbjct: 146 AADIDSAYKGQIDLHVAEKNRKVSNRQVEWIKRLAHDGTLYKTFNIGFFTFGASSRPEIA 205

Query: 202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYG 261
           G+GVA++GSLYM+ IV+ +S P+GIA+A+YLEE++ K  F+ F++ NINNLA+VPSIV+G
Sbjct: 206 GLGVAIIGSLYMIGIVLLVSLPIGIATALYLEEYARKNKFTDFIEVNINNLAAVPSIVFG 265

Query: 262 ILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKV 321
           +LG +V +NF  +PRS + VGGL+LALMTLP+IIIAT  ALR VP SIR+AALGLGASK 
Sbjct: 266 LLGLSVFVNFLGLPRSASFVGGLVLALMTLPTIIIATRSALRAVPLSIRAAALGLGASKT 325

Query: 322 QTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQI 381
           Q +FHHV+PLA P ILTG+ + +A+ALGETAPLL +GMVAFV + P    D ATA PVQI
Sbjct: 326 QMIFHHVVPLAAPGILTGTIIGVAQALGETAPLLLIGMVAFVVNIPTTPMDPATALPVQI 385

Query: 382 YLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           ++WA +AER FVE+T GAI++L++FLA++N + ++LR RF++R
Sbjct: 386 FMWAGEAERAFVEKTSGAIIVLMMFLAIMNISAVFLRRRFERR 428


>gi|319405128|emb|CBI78734.1| phosphate ABC transporter, permease protein [Bartonella sp. AR
           15-3]
          Length = 430

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 224/417 (53%), Positives = 302/417 (72%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           LK RY +E  FR Y + A+ +   FL +LL SIVS+G  A +Q+ + L +   E ++DP 
Sbjct: 14  LKGRYRAERRFRAYGLSAIFISLFFLAVLLWSIVSQGYTAFFQSEMILSVYLDEKVIDPS 73

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
             R  DP IL+ A+Y LLVR ALA+KL +  ++   +R  ++M S + R  LR  ++ +P
Sbjct: 74  GHRKSDPKILITANYPLLVRNALAKKLGVDHNDQISMRDVNRMFSQSVRVQLRDIVIKNP 133

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           +LIG   +V +LA+++IDSA KG   L+ P    ++SD Q KW + L +DG L+  FN  
Sbjct: 134 NLIGTMQKVKVLAASDIDSAYKGQIDLHVPEKNRKVSDQQIKWMKHLINDGTLYKTFNRH 193

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF  GASSRPE +G+GVA++GS YMM+IV+ +S P+GIA+A+YLEE++ K  F+ F++ N
Sbjct: 194 FFTFGASSRPETSGLGVAMIGSFYMMIIVLVISLPIGIATALYLEEYARKNKFTDFIEIN 253

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIV+G+LG AV INF  MPRS + VGGL+LALMTLP+IIIAT  AL+ VP S
Sbjct: 254 INNLAAVPSIVFGLLGLAVFINFMGMPRSASFVGGLVLALMTLPTIIIATRSALQAVPFS 313

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+ ALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL +GMVAFV D PV
Sbjct: 314 IRAGALGLGASKTQMVFHHVIPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVVDIPV 373

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              D ATA PVQI++WA++AER FVE+T GAI++L+IFL  +N + + LR RF++RW
Sbjct: 374 TPMDPATALPVQIFMWASEAERSFVEKTSGAIIILMIFLIFMNISAVLLRRRFERRW 430


>gi|319406575|emb|CBI80217.1| phosphate ABC transporter, permease protein [Bartonella sp. 1-1C]
          Length = 430

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 227/428 (53%), Positives = 310/428 (72%), Gaps = 4/428 (0%)

Query: 2   KSFSINKKN--LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           ++F  +++N  LK RY +E  FR Y + A+ +   FL +LL SIVS+G  A +Q+ + L 
Sbjct: 3   EAFFSHRRNIDLKGRYRAERRFRIYGLSAIFISLFFLAILLWSIVSQGYTAFFQSEMILS 62

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR 119
           +   E ++DP  +R  +  IL+ A+Y LLV+ ALA KL +  ++   +R  ++M S + R
Sbjct: 63  VYLDEKVIDPSGQRESNSKILVTANYPLLVQNALATKLGVDLNDQISMRNVNRMFSQSVR 122

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ +P LIG T +V +LA+++IDSA KG   L+ P    ++SD Q +W + L +
Sbjct: 123 VQLRDIVVKNPHLIGTTQKVKVLAASDIDSAYKGQINLHVPEKNRKISDQQIQWMKYLIN 182

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DG L+  FN  FFI GASSRPE +G+GVA++GSLYMM+IV+ +S P+GIA+A+YLEE++ 
Sbjct: 183 DGTLYKTFNRHFFIFGASSRPETSGLGVAMIGSLYMMIIVLVISLPIGIATALYLEEYAR 242

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K  F+ F++ NINNLA+VPSIV+G+LG AV INF  MPRS + VGGL+LALMTLP+IIIA
Sbjct: 243 KNKFTDFIEININNLAAVPSIVFGLLGLAVFINFMGMPRSASFVGGLVLALMTLPTIIIA 302

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  ALR VP SIR+ ALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL +
Sbjct: 303 TRSALRAVPFSIRAGALGLGASKTQMVFHHVIPLAAPGILTGTIIGLAQALGETAPLLLI 362

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAFV D PV   D ATA PVQI++WA++AER FVE+T GAI++L+IFL  +N A + L
Sbjct: 363 GMVAFVVDIPVTPMDPATALPVQIFMWASEAERSFVEKTSGAIIILMIFLIFMNIAAVLL 422

Query: 418 RNRFKKRW 425
           R RF++RW
Sbjct: 423 RRRFERRW 430


>gi|114706440|ref|ZP_01439342.1| ABC transporter, membrane spanning protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538301|gb|EAU41423.1| ABC transporter, membrane spanning protein [Fulvimarina pelagi
           HTCC2506]
          Length = 440

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 224/418 (53%), Positives = 295/418 (70%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y ++A+ +   FL +LL S+VSKG  A WQT I +PI FSE ++  
Sbjct: 23  GIKRRYAAERRFKAYGMIAIGLGIAFLFILLWSVVSKGYTAFWQTEIRVPITFSEEVIGT 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
            ++   + + L+ A+Y  L R  L + L I   N   +  A+ ++S   R  LR  ++ D
Sbjct: 83  AEEGAANQSKLMMANYPQLARDGLIQLLEIDPENSEAVSAANGLVSQGVRMELRDMVLND 142

Query: 130 PSLIGKTVEVSLLASANIDSALKG-YLYSPANVHR-MSDYQWKWFQKLDSDGALFLDFNY 187
             +IG T +V L AS+++DSALKG Y  S     R +SD Q ++ ++L+  GAL  +FN+
Sbjct: 143 LQVIGTTEDVWLYASSDLDSALKGSYDLSVEESRRPISDLQLEFIERLEEMGALEQNFNW 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSR E AG+GVA++GS YMMLIV+ L+ P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 203 GLFTFGASSRAETAGVGVAIIGSAYMMLIVLALALPIGVAASIYLEEFAPKNRFTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+GILG AV IN+F +PRS ALVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 263 NINNLAAVPSIVFGILGLAVFINWFGLPRSAALVGGLVLTLMTLPTIIIATRAALRAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALGLGASK QTVF HVLPLA P ILTG+ + LA+ALGETAPLL +GMVAFV DYP
Sbjct: 323 SIRWAALGLGASKTQTVFQHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVADYP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQIY+WA +AER F ERT GAI++LL FLA++N   ++LR RF++RW
Sbjct: 383 ETPLDAATALPVQIYMWANEAERAFQERTSGAIMILLGFLALMNLTAIFLRRRFERRW 440


>gi|49473894|ref|YP_031936.1| phosphate ABC transporter permease [Bartonella quintana str.
           Toulouse]
 gi|49239397|emb|CAF25735.1| Phosphate transport system permease protein [Bartonella quintana
           str. Toulouse]
          Length = 430

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 219/420 (52%), Positives = 308/420 (73%), Gaps = 4/420 (0%)

Query: 2   KSFSINKKNL--KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           ++F ++++N+  K RY +E  FR Y ++A+ +   FL  LL SI+S+G  A +Q+ ++L 
Sbjct: 3   EAFFLHRRNIGIKRRYWAERRFRAYGLIAIFIGLFFLFALLWSIMSQGYAAFFQSEMTLS 62

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR 119
           I   E ++DP  +R  +P +L+ A+Y LLV+ ALA KL I  +N   LR  ++M S + R
Sbjct: 63  IYLDEKVIDPSGQRETNPQVLITANYPLLVQNALATKLGIDQNNRVALRDVNRMFSNSVR 122

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR+ +  +P LIGKT ++ +LA+ANID+A KG   L+      ++S+ Q +W ++L  
Sbjct: 123 VQLREMVTKNPKLIGKTQKIKVLAAANIDAAYKGQIDLHVAEKNRKVSNRQVEWMRRLAY 182

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DG L+  FN+GFF  GASSRPE AG+GVA++GS YM+ IV+ +S P+GIA+A+YLEE++ 
Sbjct: 183 DGTLYKTFNFGFFTFGASSRPETAGLGVAIIGSFYMIAIVLVISLPIGIATALYLEEYAR 242

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K  F+ F++ NINNLA+VPSIV+G+LG AV +NFF +PRS + VGGL+LALMTLP+IIIA
Sbjct: 243 KNKFTDFIEVNINNLAAVPSIVFGLLGLAVFVNFFGLPRSASFVGGLVLALMTLPTIIIA 302

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  ALR VP SIR+AALGLGASK Q VFHHV+PLA P ILTG+ + +A+ALGETAPLL +
Sbjct: 303 TRSALRAVPLSIRAAALGLGASKTQMVFHHVVPLAAPGILTGTIIGVAQALGETAPLLLI 362

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAFV + P    D ATA PVQI++WA +AER FVE+T GAI++LL+FL+V+N + ++L
Sbjct: 363 GMVAFVANIPATPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLLVFLSVMNISAVFL 422


>gi|319408037|emb|CBI81691.1| phosphate ABC transporter, permease protein [Bartonella
           schoenbuchensis R1]
          Length = 430

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/403 (51%), Positives = 290/403 (71%), Gaps = 2/403 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           L+ RY +E  FR Y +VA+ +   FLI+LL SIVS+G  A + + ++L I   E ++DP 
Sbjct: 14  LRRRYWAERRFRAYGLVAIFIGLFFLIILLWSIVSQGYTAFFHSEMTLSIYLDEKVIDPG 73

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            +R  +P +L+ A+Y LLVR ALA KL +  ++ A +R  ++M S   R  LR  ++ +P
Sbjct: 74  GQRATNPKVLITANYPLLVRNALATKLGVDYNDRAAMRDINRMFSGNVRVQLRDMVVKNP 133

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           +LIG T ++ +LA+A++D   K    L       ++S+ Q +W ++L  D  L+  FN G
Sbjct: 134 NLIGTTQKIKILAAADVDLVYKRQINLQVAEEKRKVSNRQVEWIRRLIDDNTLYKTFNRG 193

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF  G+SSRPE +G+GVA++GS YMM IV+ ++ P+G+A+A+YLEE++ K  F+ F++ N
Sbjct: 194 FFTFGSSSRPETSGLGVAIIGSFYMMFIVLAVALPIGVATALYLEEYARKNTFTDFIEIN 253

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA++PSI++G+LG +V INF  MPRS + VGGL+L LMTLP+IIIAT  ALR VP S
Sbjct: 254 INNLAAIPSIIFGLLGLSVFINFLGMPRSASFVGGLVLTLMTLPTIIIATRSALRAVPLS 313

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+AALGLGASK Q VFHHV+PLA+P ILTG+ + LA+ALGETAPLL +GMVAFV + P 
Sbjct: 314 IRTAALGLGASKTQVVFHHVVPLAVPGILTGTIIGLAQALGETAPLLLIGMVAFVANIPT 373

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
              D ATA PVQI++WA +AER FVE+T GAI++L++FLAV+N
Sbjct: 374 TPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLMVFLAVMN 416


>gi|288940131|ref|YP_003442371.1| phosphate ABC transporter inner membrane subunit PstA
           [Allochromatium vinosum DSM 180]
 gi|288895503|gb|ADC61339.1| phosphate ABC transporter, inner membrane subunit PstA
           [Allochromatium vinosum DSM 180]
          Length = 434

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 212/427 (49%), Positives = 288/427 (67%), Gaps = 7/427 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++  I   +LK RY  E  FR+    AV +  VF++LL + I+ KG  A  QT+I LPIE
Sbjct: 12  RAIDIVNASLKRRYARERRFRWLGATAVTLGMVFVVLLFADIILKGYTAFQQTYIQLPIE 71

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKL-SISDSNHALLRQASQMLSTTARY 120
            +   +DP   R  DPA L RADY  L+R+AL  +   ++D      R  + M+S  A  
Sbjct: 72  LAAATIDPDGAR--DPATLARADYMKLIREALRERFPEVTDRRDR--RLLNSMISVGAPD 127

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSD 178
            LR+ +M DP+LIG T E+ +LA  +ID  +KGY+   +PA+  R+ D    W  +L+++
Sbjct: 128 LLRERVMADPALIGTTQELWILADDDIDMLVKGYIDRNAPASDRRVGDQMIAWVDRLEAE 187

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G +   FN  FF +G S  PE+AGI  A++GS Y +++   LSFP+G+ +A+YLEEF+ K
Sbjct: 188 GRVAKRFNTIFFTHGTSREPELAGIAGALMGSFYTLVLTFLLSFPIGVGAALYLEEFAPK 247

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ N+NNLA+VPSIV+G+LG AV I FF +PRST LV  L++ LMTLP+IIIA+
Sbjct: 248 NRWTDLIEVNVNNLAAVPSIVFGLLGLAVFIGFFGVPRSTPLVAALVMTLMTLPTIIIAS 307

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
            VAL++VP SIR AALG+GAS +QT FHHVLPLA+P ILTGS + +ARALGETAPLL +G
Sbjct: 308 RVALKSVPPSIREAALGVGASPLQTQFHHVLPLALPGILTGSIIGMARALGETAPLLMIG 367

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           M+AF+ D P G  D AT  PVQI+LWA   ER FVERT  AIL+LL FL V+N A + LR
Sbjct: 368 MIAFIVDIPKGFNDAATVLPVQIFLWADSPERGFVERTSAAILVLLAFLFVMNLAAVLLR 427

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 428 RRFERRW 434


>gi|312115107|ref|YP_004012703.1| phosphate ABC transporter inner membrane protein PstA
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311220236|gb|ADP71604.1| phosphate ABC transporter, inner membrane subunit PstA
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 442

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/407 (48%), Positives = 276/407 (67%), Gaps = 4/407 (0%)

Query: 21  FRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAIL 80
           F+ Y ++A+ +   FL++L  +I+  G  A +QT I LPI+F    +DP+  R  +   L
Sbjct: 38  FQAYGLIAIALGMSFLVILFGTIIRDGWTAFFQTSIELPIKFDAAEIDPEGTRNAN--TL 95

Query: 81  LRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVS 140
            +A+Y  L  +AL  +L +  S+ A  + A+ ++S      LR  +  DP +IG T  V 
Sbjct: 96  AQANYQKLANQALYGQLGVDPSSRAQRQAANALISRDVDSQLRAMVAADPKIIGTTQNVW 155

Query: 141 LLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRP 198
           +LAS N+D+  KG +    P    ++SD Q  W  KL + GA+   FN G F N ASS+P
Sbjct: 156 VLASGNVDAFAKGKIDRQLPQQNRQISDQQISWIDKLTASGAMEKSFNSGLFTNTASSQP 215

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSI 258
           E AG+ VA++GS Y+MLIV+ LS PLG+A+AIYLEEF+ +   +  ++ NINNLA+VPSI
Sbjct: 216 ETAGLAVALLGSFYIMLIVVLLSVPLGVAAAIYLEEFAPRNRITDIIEVNINNLAAVPSI 275

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           V+G+LG AV INF  +PRS +LVGGL+L L TLP++IIAT  ++  VP SIR AALG+GA
Sbjct: 276 VFGLLGLAVFINFAGLPRSASLVGGLVLTLRTLPTVIIATRASITAVPPSIREAALGVGA 335

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
           SKVQ+VFHHVLPL++P I+TG+ + L +A+GETAPLL +GMVAFV D P    D ATA P
Sbjct: 336 SKVQSVFHHVLPLSLPGIITGTIIGLVQAIGETAPLLMIGMVAFVVDVPSSPLDPATALP 395

Query: 379 VQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           VQIY+WA +AER FVE+T GA ++LL  LAV+N   + LR R++++W
Sbjct: 396 VQIYMWATEAERGFVEKTAGATIVLLGILAVMNILAMVLRKRYERKW 442


>gi|46202105|ref|ZP_00053763.2| COG0581: ABC-type phosphate transport system, permease component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 419

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 273/415 (65%), Gaps = 8/415 (1%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           L  RY +E  FR   + ++L+   FL+LLL ++V+KG    +QT I++ + F   ++DP 
Sbjct: 13  LGRRYAAERRFRLLGLASILISAGFLVLLLGTVVAKGWTGFFQTQIAMEVSFDADVIDPD 72

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
             R  DPAIL  ADY  LVR ALA +L + D + +  R  S ++ST     LR+ +  DP
Sbjct: 73  GNR--DPAILDAADYPALVRNALAARL-VPDGDRSARRDLSALVSTMGAEQLRRMVAQDP 129

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
            LIG    V LLAS  +D   KG          +++ Q  W  +L+  G +   FN  FF
Sbjct: 130 GLIGAKANVWLLASDKLDMVNKGQ-----ATDTLNERQLGWLAELNKAGLIRKAFNAQFF 184

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
             G S  PE AGI  AVVGS + +L+ + +SFPLG+A+A+YLEEF+ K  ++  ++ NIN
Sbjct: 185 TGGDSRAPEQAGIWGAVVGSFFSLLVTLAVSFPLGVATAVYLEEFAPKNRWTDLIEVNIN 244

Query: 251 NLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIR 310
           NLA+VPS+V+G+LG AV +N F +PRS+ + GGL+LAL+ LP+IIIA   AL+ VP SIR
Sbjct: 245 NLAAVPSVVFGLLGLAVFLNVFHLPRSSPVAGGLVLALICLPTIIIAGRAALKAVPPSIR 304

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
            AA GLGAS +Q V HHVLPLAMP +LTG+ + +ARALGETAPLL +GMVAF+ D P   
Sbjct: 305 QAAAGLGASPLQIVAHHVLPLAMPGMLTGTILGMARALGETAPLLMIGMVAFIVDIPKSP 364

Query: 371 TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            D +   PVQIYLWA  +ER FVE+T  AI++LL+FL V+N A +WLRN+F++RW
Sbjct: 365 LDPSAVLPVQIYLWAGSSERAFVEKTSAAIMVLLLFLVVMNMAAIWLRNKFERRW 419


>gi|163797107|ref|ZP_02191062.1| phosphate ABC transporter, permease protein PstA [alpha
           proteobacterium BAL199]
 gi|159177623|gb|EDP62176.1| phosphate ABC transporter, permease protein PstA [alpha
           proteobacterium BAL199]
          Length = 444

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/422 (48%), Positives = 279/422 (66%), Gaps = 3/422 (0%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           ++  +L+ RY +E  FR Y + ++ V  + L+LL+ SI  KG  A WQT++ + + FSE 
Sbjct: 24  LSGPHLRRRYAAERRFRLYGLASIAVAGLMLLLLVGSIWQKGHSAFWQTYVEITVTFSEG 83

Query: 66  IVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKT 125
           +++P     +D   L RADY  LVR AL  +   +  +  L RQ   ++ST A + LR+ 
Sbjct: 84  VLNPDGGP-VDHHELERADYLSLVRDALKEQFPEATGDRRLRRQLYGIVSTNADFALRRM 142

Query: 126 LMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFL 183
           ++ DPSL+G+   V +  S ++DS  KG++    P +  R+SD +  W+  LD  G +  
Sbjct: 143 VLDDPSLVGQRRPVWVKLSDDLDSLAKGHIRRDLPESDRRVSDIELGWYDVLDKAGRIES 202

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
            FN   F  G S  P  AGI  A++GS+  M I + +SFP+G+ +A+YLEEF+ +   + 
Sbjct: 203 RFNVDLFTAGDSREPVEAGIYGALIGSILTMTITLLVSFPVGVMAAVYLEEFAPRNRLTD 262

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NINNLA+VPSIV+G+LG AV +NFF +PRS  LVGGL+LALMTLP+IIIA+  AL+
Sbjct: 263 VIEVNINNLAAVPSIVFGLLGLAVFLNFFGLPRSAPLVGGLVLALMTLPTIIIASRSALK 322

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP SIR AA GLGAS +Q V HHVLPLAMP ILTG+ + +A+ALGETAPLL +GMVAF+
Sbjct: 323 AVPPSIREAAFGLGASPLQVVTHHVLPLAMPGILTGTIIGMAQALGETAPLLMIGMVAFI 382

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            D P G TD AT  PVQIYLWA   ER FVERT  AIL+LL FL ++N   + LR RF++
Sbjct: 383 VDIPQGFTDPATVLPVQIYLWADSPERAFVERTSAAILVLLGFLVLMNAVAVLLRKRFER 442

Query: 424 RW 425
           RW
Sbjct: 443 RW 444


>gi|189500176|ref|YP_001959646.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides BS1]
 gi|189495617|gb|ACE04165.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides BS1]
          Length = 436

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 278/427 (65%), Gaps = 11/427 (2%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           +K+  I  K LK RY  E  FR Y ++++L    FL  LL+SIV  G  A  QT+I L +
Sbjct: 19  IKAIDIVNKGLKRRYRKEKRFRLYGMLSILASVAFLAFLLTSIVFNGYSAFLQTYIKLDV 78

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
                ++D Q     +P    R+D+  +++ A+ R      +     R+   + S+ A +
Sbjct: 79  PLEAGMIDKQ-----EPG---RSDFQGIIKSAI-RSYYPEVTERQDKRELYALFSSGAAF 129

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSD 178
            LR T++++P   G T+ + +LA  ++D  +KG++    P    R++D Q +W ++L++D
Sbjct: 130 QLRDTVLSNPPEEGTTLSLWVLADDDVDMLMKGHMKRDVPEGSRRLNDKQLRWIERLEAD 189

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
             +   FN  FF  G S  PE+AGI  AV GS+Y ML+ + LSFP+GI +A+YLEEF+ K
Sbjct: 190 KRVEKRFNTTFFSAGDSREPELAGIWGAVKGSIYTMLVTLALSFPIGICAAVYLEEFAPK 249

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
              + F++ NINNLA+VPSIV+G+LG AV +NFF MPRST LVGG++L LMTLP+IIIA+
Sbjct: 250 NLATDFIEVNINNLAAVPSIVFGLLGLAVFLNFFGMPRSTPLVGGIVLMLMTLPTIIIAS 309

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR AALG+G+SK+Q V  HVLPLA+P +LTG+ + +A+ALGETAPLL +G
Sbjct: 310 RAALKAVPPSIREAALGVGSSKLQVVASHVLPLALPGMLTGTIIGMAQALGETAPLLMIG 369

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAF+ D P G TD A   PVQIYLWA   ER FVERT  AI++LL FL  +N   + +R
Sbjct: 370 MVAFIVDIPGGFTDPAAVMPVQIYLWADSPERAFVERTSAAIMVLLAFLISMNAVAVVMR 429

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 430 KRFERRW 436


>gi|301063526|ref|ZP_07204058.1| phosphate ABC transporter, permease protein PstA [delta
           proteobacterium NaphS2]
 gi|300442465|gb|EFK06698.1| phosphate ABC transporter, permease protein PstA [delta
           proteobacterium NaphS2]
          Length = 422

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 202/426 (47%), Positives = 281/426 (65%), Gaps = 11/426 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++  I K+ L  RY SE  F+ Y + A+LV  +FL LL  SI+  G  A ++T + L I 
Sbjct: 6   RTIDIVKRGLNKRYRSEKRFKIYGLSAILVSIIFLALLFISIIGTGYSAFFRTVVKLDIT 65

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           F     DP+    +    L  A+Y+ LV+K+L R L  +  +    RQ   ++S+ A + 
Sbjct: 66  F-----DPES---ISKETLSTANYSGLVKKSL-RGLFPNVEDRREKRQLYGLVSSGAAFQ 116

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           LR+  M DP +IGKTV V + A+ ++D  +KG +    P +  R++D Q  W  KL  + 
Sbjct: 117 LRRLAMADPGVIGKTVSVWVPANDDVDMLMKGQMERNVPQSERRLTDKQLTWIDKLSGED 176

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            L   FN  FF  G S  PE+AGI  AV+GS Y +++ + LSFP+G+++A+YLEEF+ K 
Sbjct: 177 RLEKRFNTAFFTGGDSREPELAGIWGAVMGSFYTLVVTLLLSFPIGVSAAVYLEEFAPKN 236

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++  ++ NINNLA+VPSIV+G+LG AV +NFF +PRST LVGGL+L LMTLP+IIIA+ 
Sbjct: 237 KWTDLIEVNINNLAAVPSIVFGLLGLAVFLNFFGLPRSTPLVGGLVLTLMTLPTIIIASR 296

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L++VP SIR AALG+GASK Q V HHVLPLAMP ++TG+ + +A+ALGETAPLL +GM
Sbjct: 297 ASLKSVPPSIRDAALGIGASKTQMVSHHVLPLAMPGMMTGTIIGMAQALGETAPLLMIGM 356

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P G TD AT  PVQIYLWA   ER F   T  AI++LL FL  +N+A + LR 
Sbjct: 357 VAFIVDVPHGFTDPATVLPVQIYLWADSPERAFTALTSAAIMVLLAFLIFMNSAAVLLRK 416

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 417 KFERRW 422


>gi|53804609|ref|YP_113548.1| phosphate ABC transporter permease PstA [Methylococcus capsulatus
           str. Bath]
 gi|53758370|gb|AAU92661.1| phosphate ABC transporter, permease protein PstA [Methylococcus
           capsulatus str. Bath]
          Length = 434

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/426 (46%), Positives = 276/426 (64%), Gaps = 5/426 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++  I K +L  R+ +E  FR Y ++++    + L++LL SI  +G  A  QT++ L + 
Sbjct: 12  RTADIVKASLGRRHAAERRFRLYGLMSIGAGILMLVILLVSIFGQGYRAFSQTYVGLDVS 71

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           F   ++DP   R   P  L  ADY  L+++AL  +L    +     R   +++S  A Y 
Sbjct: 72  FDPAVIDPDGGR--SPEALASADYGALLKRALG-ELFPDVTERQDKRALHRLISAGASYA 128

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANV--HRMSDYQWKWFQKLDSDG 179
           +R  ++  P L+G +  + + A A++D   KGY    A     RM D +  W  +L ++G
Sbjct: 129 VRDEILAHPELVGHSARIWVAAGADVDLLEKGYFDRSAAEAERRMKDRELAWVDRLKAEG 188

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            L   FN  FF  G S  PE AGIG A++GS Y +L+ + LS P+G+A+AIYLEEF+ + 
Sbjct: 189 RLERRFNAKFFTAGDSRDPEQAGIGGALMGSFYTVLVTLVLSLPIGVAAAIYLEEFAPRN 248

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            +  F++ NINNLA+VPSIV+G+LG AV INF  +PRS+ LVGGL+L LMTLP IIIA  
Sbjct: 249 HWVDFIEVNINNLAAVPSIVFGLLGLAVFINFLGVPRSSPLVGGLVLTLMTLPVIIIAAR 308

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL+ VP SIR AA+G+GAS +QTVFHHV+PLAMP +LTG+ + ++RALGE+APLL +GM
Sbjct: 309 SALKAVPPSIREAAMGVGASPMQTVFHHVVPLAMPGMLTGAIIGMSRALGESAPLLMIGM 368

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P G+ D AT  PVQ+YLWA   ER FVERT  AIL+LL FL ++N   ++LR 
Sbjct: 369 VAFIVDIPHGIFDPATVLPVQVYLWADSPERGFVERTSAAILVLLAFLILMNGTAVYLRR 428

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 429 RFERRW 434


>gi|146329206|ref|YP_001210066.1| ABC-type phosphate-dependent transport system family protein
           [Dichelobacter nodosus VCS1703A]
 gi|146232676|gb|ABQ13654.1| ABC-type phosphate-dependent transport system family protein
           [Dichelobacter nodosus VCS1703A]
          Length = 438

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/425 (47%), Positives = 280/425 (65%), Gaps = 10/425 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +++LK R+ SE  FR   + ++ +  VFLI+ + SIV     A  QT I L + +   ++
Sbjct: 17  EQHLKKRHRSERRFRLLGICSLTISLVFLIVFIISIVRDAAPAFSQTEIQLTVNYDTDVI 76

Query: 68  -----DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
                D   +  ++ A L + +YNLL+ +ALA+  S    N   LRQ  ++LS++A+Y L
Sbjct: 77  NLKNIDKNDEHAVEQA-LFKVNYNLLIERALAKLSSYQGENPNQLRQ--KLLSSSAQYQL 133

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPAN-VHRMSDYQW-KWFQKLDSDGA 180
              L  +P LIGK   + L AS  IDSA +GY+ S  +  +R  D Q  KW Q+L   G 
Sbjct: 134 MNRLQANPDLIGKQETLWLSASGGIDSAHQGYVDSSIDEANRAVDDQTVKWAQRLHEQGL 193

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           L    N   F +  S  P+ AG+  A++GS Y +L+ + LSFP+ + +AIYLEEF+ K  
Sbjct: 194 LRTSLNTTIFTHTDSRSPQDAGVRGAIIGSAYTLLVTLALSFPIAVLAAIYLEEFAPKNR 253

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           F+ F++ANINNLA+VPSI++G+LG AV INFF +PRST LVGGL+L LMTLP+III++  
Sbjct: 254 FTDFLEANINNLAAVPSIIFGLLGLAVFINFFGLPRSTPLVGGLVLTLMTLPTIIISSRA 313

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           AL+ VP SIR+AALGLGASK+Q  FHHVLPLAMP +LTG+ + +A+ALGETAPLL +GMV
Sbjct: 314 ALKAVPPSIRAAALGLGASKMQVTFHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGMV 373

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AF++D P G+ D A   PVQIYLW+   ER F+ RT  AI++LL FL  +N   + LR +
Sbjct: 374 AFISDVPNGILDPAAVMPVQIYLWSDLPERAFIARTSFAIIILLFFLIAMNALAVILRKK 433

Query: 421 FKKRW 425
           F+++W
Sbjct: 434 FERKW 438


>gi|117924838|ref|YP_865455.1| phosphate ABC transporter inner membrane subunit PstA
           [Magnetococcus sp. MC-1]
 gi|117608594|gb|ABK44049.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Magnetococcus sp. MC-1]
          Length = 432

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/417 (47%), Positives = 266/417 (63%), Gaps = 4/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           LK R  SE  FR   +  ++V    L++LL++++  G+ A  QT I L I F E ++DP+
Sbjct: 18  LKKRRASETRFRLLGISGIVVALAALVILLTTMLGNGLTAFQQTQIKLKIHFDEQVIDPE 77

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP +L  ADY  L    L        S          ++S++A+Y LR  ++  P
Sbjct: 78  GKR--DPKVLSHADYRKLYTNGLYALFPDVKSRRDKSELRKTLISSSAQYALRDVVLEQP 135

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
            L+G T E+ L+AS ++D  LKGY     P +   + D    W ++L  +G +   FN  
Sbjct: 136 ELVGTTRELWLVASDDVDMYLKGYFTKDVPESDRPIKDITISWIEQLQHEGRIDKKFNRD 195

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF NG+S  PE AGI  A+VGS   +L+    SFP+G+A+A+YLEEF+ K  ++  ++ N
Sbjct: 196 FFTNGSSQDPEQAGILGALVGSGLTLLVTFLASFPVGLATAVYLEEFAPKNGWTDLIEVN 255

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIV+G+LG AV +N   MPRS  +VGGL LALMTLP+IIIAT  AL+ VP S
Sbjct: 256 INNLAAVPSIVFGLLGLAVFLNVMHMPRSAPVVGGLTLALMTLPTIIIATRAALKAVPPS 315

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R AA GLGAS +Q V HHV+PLAMP ILTG+ + +A+ALGETAPLL +GMVAF+ D P 
Sbjct: 316 LRDAARGLGASPLQVVLHHVVPLAMPGILTGTIIGMAQALGETAPLLMIGMVAFLVDIPH 375

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
             TD AT  PVQIYLWA  AER FVE+T  A L+LL FL ++N   + LR +F++RW
Sbjct: 376 SATDAATVMPVQIYLWADSAERGFVEKTAAATLVLLGFLVLMNLLAVLLRKKFERRW 432


>gi|153870079|ref|ZP_01999552.1| phosphate ABC transporter, permease protein PstA [Beggiatoa sp. PS]
 gi|152073452|gb|EDN70445.1| phosphate ABC transporter, permease protein PstA [Beggiatoa sp. PS]
          Length = 418

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 279/427 (65%), Gaps = 25/427 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK+LK RY  E  FR   ++AVL  F  L++LL  ++ K   A  QT + L IEFS    
Sbjct: 8   KKSLKKRYRQEKRFRLLSLLAVLTGFACLLILLVDMLIKAWPAFIQTEVKLDIEFS---- 63

Query: 68  DPQKKRF---MDPAILLRADYNLLVRKAL------ARKLSISDSNHALLRQASQMLSTTA 118
            P+K       +P  L  A++  L++++L       RK S      AL+R    ++S  A
Sbjct: 64  -PEKLNISANFEPEELQNANFRSLIKQSLHQLFPTVRKRS---DKRALMR----LISVDA 115

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSD 178
            Y LR  L  +P L+GKTV + LL   ++D+    YL S     R+S+ Q  W  +L+  
Sbjct: 116 EYRLRDKLQAEPQLLGKTVPIWLLVDDDVDT----YLKSDKQFGRVSNQQIAWITELEQQ 171

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G     FNY FF  G S  PE+AGI  AV+GS Y +LI + LSFP+G+ +AIYLEEF+ +
Sbjct: 172 GRFQQRFNYWFFQTGDSREPELAGIWGAVMGSFYTLLITLLLSFPIGVMAAIYLEEFAPR 231

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             +  FV+ NINNLA+VPSIV+G+LG A+ INFF +PRS  LVGG++LALMTLP+IIIA+
Sbjct: 232 NRWIDFVEVNINNLAAVPSIVFGLLGLAIFINFFGVPRSAPLVGGMVLALMTLPTIIIAS 291

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             A++ VP S+R AALGLGASK+Q  FHHV+PLAMP ILTG+ + LA+ALGETAPLL +G
Sbjct: 292 RSAIKAVPPSMREAALGLGASKIQVAFHHVVPLAMPGILTGTIIGLAQALGETAPLLMIG 351

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAF+ D P G+TD AT  P+QIYLWA   ER FV +T  AIL+LL+FL V+N   +WLR
Sbjct: 352 MVAFIVDIPQGITDAATVLPIQIYLWADSPERAFVAKTAAAILVLLLFLVVMNGLAVWLR 411

Query: 419 NRFKKRW 425
            +F++RW
Sbjct: 412 KKFERRW 418


>gi|90023393|ref|YP_529220.1| phosphate ABC transporter permease [Saccharophagus degradans 2-40]
 gi|89952993|gb|ABD83008.1| Phosphate transport system permease protein 2 [Saccharophagus
           degradans 2-40]
          Length = 430

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/419 (44%), Positives = 277/419 (66%), Gaps = 5/419 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +++LK RY +E  F+ + + +V V  + L++L + I+SKG GA  QT++ L +      +
Sbjct: 16  ERSLKKRYAAERRFKAFGIASVGVGILALLILFTEIISKGSGAFTQTYVQLEVHLDADTL 75

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLS-ISDSNHALLRQASQMLSTTARYHLRKTL 126
                   DP  L   DYN ++RKAL ++   +   N    R    ++S  A Y ++  +
Sbjct: 76  GIYDA--TDPQQLAVGDYNAVIRKALLKRFDGVKTRNDK--RALYSLISIGASYQVQNII 131

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
             DP +IG+T  + +LA  ++D+  K    +   V R+S+ Q +W       G L   FN
Sbjct: 132 EADPGVIGQTQTLWVLADDDLDTYYKSLSDAEPFVGRLSEKQLEWVTSWVEFGQLKRKFN 191

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
              F +G SS PE+AGI  A++GSL+ +L+ + LSFP+G+A+A+YLEE++ +  F+ F++
Sbjct: 192 TILFTSGDSSEPELAGILGALMGSLFTLLVTLSLSFPIGVAAAVYLEEYAGRNKFTDFIE 251

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
            NINNLA+VPS+++G+LG A+ +NF +MPRS  LVGGL+L LMTLP+III++  A++ VP
Sbjct: 252 VNINNLAAVPSVIFGLLGLAIFLNFMEMPRSVPLVGGLVLTLMTLPTIIISSRAAIKAVP 311

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            SIR A+LG+GASK+Q + HHVLPLAMP +LTG+ + LA+ALGETAPLL +GMVAF+ D 
Sbjct: 312 PSIREASLGMGASKMQMIIHHVLPLAMPGMLTGAIIGLAQALGETAPLLMIGMVAFIVDI 371

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           P G+TD ++  PVQI+LWA   ER FVERT  AI++LL FL  +NT  +WLR R ++RW
Sbjct: 372 PAGITDPSSVLPVQIFLWADSPERAFVERTSAAIMVLLAFLITMNTLAIWLRTRLERRW 430


>gi|83310472|ref|YP_420736.1| ABC-type phosphate transport system [Magnetospirillum magneticum
           AMB-1]
 gi|82945313|dbj|BAE50177.1| ABC-type phosphate transport system [Magnetospirillum magneticum
           AMB-1]
          Length = 431

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/420 (45%), Positives = 270/420 (64%), Gaps = 9/420 (2%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            L  RY +E  FR   + ++L+   FL+LLL ++V+KG     QT I++ + F   ++DP
Sbjct: 17  RLGRRYAAERRFRILGLASILISAGFLVLLLGTVVAKGWTGFLQTQIAVEVSFDAEVIDP 76

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
              R   P +L  ADY  LVR  LA +L + D + +  R  S ++ST     +R+ +  D
Sbjct: 77  DGTR--APDVLDAADYPALVRNGLAARL-VPDGDRSARRDLSALVSTMGAEQMRRMVAAD 133

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYSPANV----HRMSDYQWKWFQKLDSDGALFLDF 185
           P +IG    + L AS  +D   KG   +P  V    + ++D Q  W  +L+  G +   F
Sbjct: 134 PKVIGTRTTLWLTASDKLDMVYKGQ--APREVGAAGNVLNDRQLGWLAQLEQAGQIRKAF 191

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  FF  G S  PE AGI  AVVGS + + + + +SFPLG+A+A+YLEEF+ K  ++  +
Sbjct: 192 NLQFFTGGDSRAPEQAGIWGAVVGSFFSLAVTLLISFPLGVATAVYLEEFAAKNRWTDLI 251

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPS+V+G+LG AV +N F +PRS+ + GGL+LAL+ LP+IIIA   AL+ V
Sbjct: 252 EVNINNLAAVPSVVFGLLGLAVFLNVFHLPRSSPVAGGLVLALICLPTIIIAGRAALKAV 311

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AA GLGAS +Q V HHVLPLAMP +LTG+ + +ARALGETAPLL +GMVAF+ D
Sbjct: 312 PPSIRQAAAGLGASPLQIVAHHVLPLAMPGMLTGTILGMARALGETAPLLMIGMVAFIVD 371

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P    D +   PVQIYLWA  +ER FVE+T  AI++LL+FL  +N A +WLRN+F++RW
Sbjct: 372 IPKSPLDPSAVLPVQIYLWAGSSERAFVEKTSAAIMVLLLFLVAMNMAAIWLRNKFERRW 431


>gi|109899621|ref|YP_662876.1| phosphate ABC transporter, inner membrane subunit PstA
           [Pseudoalteromonas atlantica T6c]
 gi|109701902|gb|ABG41822.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Pseudoalteromonas atlantica T6c]
          Length = 441

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/423 (46%), Positives = 278/423 (65%), Gaps = 12/423 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
            +NL  R  +EW FR Y + A+L  F  L++L S I+SKG GA ++T I L + F     
Sbjct: 21  NRNLAKRKRAEWRFRVYGIGAILFGFACLLILFSDIISKGHGAFFKTQIHLQVHF----- 75

Query: 68  DPQKKRFMDPAILLR---ADYNLLVRKAL-ARKLSISDSNHALL--RQASQMLSTTARYH 121
           +PQ+ +   P+ + +   A+Y+ +V+ AL A    IS ++ + +  RQ   ++ST A Y 
Sbjct: 76  NPQRLQVSQPSAIEQFNNANYDNIVQDALFADNARISPTSLSAVDKRQLLSLISTGAVYS 135

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPAN-VHRMSDYQWKWFQKLDSDGA 180
           LR+ L   PS+  ++V + L    ++D+ +K   +       R+S  Q  W  +   +G 
Sbjct: 136 LREILTDSPSVFNQSVGIWLTVDDDVDNYVKSLAHGGKGYTGRLSQQQQSWVNRWIENGQ 195

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           +   FN  FF +G S  PE AGI  A++GSLYM+L+ IGLSFP+GIA+A+YLEE++ K  
Sbjct: 196 VRQTFNTTFFTSGDSREPEQAGIRSALMGSLYMLLVTIGLSFPIGIAAAVYLEEYAPKNR 255

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            + F++ NINNLA+VPSI++G+LG A+ I FF MPRS  LVGGL+L LMTLP+III++  
Sbjct: 256 ATDFIEVNINNLAAVPSIIFGLLGLAIFIGFFDMPRSVPLVGGLVLTLMTLPTIIISSRA 315

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           A++ VPSSIR AA GLGASK+Q V HHVLPLAMP +LTG+ +  A+ALGETAPLL +GMV
Sbjct: 316 AIKAVPSSIRDAAYGLGASKMQVVLHHVLPLAMPGVLTGAIIGFAQALGETAPLLMIGMV 375

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AF+ D P  + D ++A PVQI+LW+   ER FVERT  AI++LL FL  +N   +WLR+R
Sbjct: 376 AFIVDVPADLMDPSSALPVQIFLWSDSPERAFVERTSAAIMVLLAFLISMNGLAVWLRHR 435

Query: 421 FKK 423
             +
Sbjct: 436 LGR 438


>gi|332305413|ref|YP_004433264.1| phosphate ABC transporter, inner membrane subunit PstA [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172742|gb|AEE21996.1| phosphate ABC transporter, inner membrane subunit PstA [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 440

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/433 (45%), Positives = 274/433 (63%), Gaps = 32/433 (7%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET-- 65
            +NL  R  +E  FRFY + A+L  F  L++L S I+ KG GA +QT I L + F+    
Sbjct: 21  NRNLAKRKRAERRFRFYGIGAILFGFACLLILFSDIIGKGHGAFFQTQIQLQVRFNAQQL 80

Query: 66  -IVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALL---------RQASQMLS 115
            I DP  K  +D      A+Y+ ++  AL R       N ALL         RQ   ++S
Sbjct: 81  QITDPTSKTQLD-----NANYDAVIENALLR------DNGALLDAELPALEKRQLLSLVS 129

Query: 116 TTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALK-----GYLYSPANVHRMSDYQWK 170
           T A Y L+  L   P  + +TV + L A  ++D+ +K     G  +S     R+S  Q K
Sbjct: 130 TGAVYSLKTVLKNAPETLNQTVSIWLTADDDVDNYVKSIGRDGQGFS----GRLSLQQQK 185

Query: 171 WFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAI 230
           W ++   +G +   FN  FF  G S  PE AGI  A++GSLYM+L+ IGLSFP+GI++A+
Sbjct: 186 WVERWVENGQVRQTFNTTFFTEGDSREPEQAGIRSALMGSLYMLLVTIGLSFPIGISAAV 245

Query: 231 YLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMT 290
           YLEE++ +   + F++ NINNLA+VPSI++G+LG A+ I FF MPRS  LVGGL+L LMT
Sbjct: 246 YLEEYAPRNRLTDFIEVNINNLAAVPSIIFGLLGLAIFIGFFDMPRSIPLVGGLVLTLMT 305

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP+III++  A++ VPSSIR AA GLGASK+Q V HHV+PLAMP +LTG+ +  A+ALGE
Sbjct: 306 LPTIIISSRAAIKAVPSSIRDAAFGLGASKMQVVLHHVVPLAMPGMLTGAIIGFAQALGE 365

Query: 351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
           TAPLL +GMVAF+ D P  + D ++A PVQI+LWA   ER F+ERT  AI++LL FL  +
Sbjct: 366 TAPLLMIGMVAFIVDVPADLLDPSSALPVQIFLWADSPERAFIERTSAAIMVLLAFLITM 425

Query: 411 NTAMLWLRNRFKK 423
           N   +WLR+R  +
Sbjct: 426 NGLAVWLRHRLGR 438


>gi|254448603|ref|ZP_05062062.1| phosphate ABC transporter, permease protein PstA [gamma
           proteobacterium HTCC5015]
 gi|198261792|gb|EDY86078.1| phosphate ABC transporter, permease protein PstA [gamma
           proteobacterium HTCC5015]
          Length = 426

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 191/430 (44%), Positives = 286/430 (66%), Gaps = 13/430 (3%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +S S  + +L  RY  E  FRFY +++V V F FL++L +SI+SKG  A  QT+I L + 
Sbjct: 4   QSMSKVEAHLARRYAREKRFRFYGLLSVFVGFAFLVVLFTSIISKGYTAFQQTYIQLDVT 63

Query: 62  FSETIV----DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTT 117
           +   I+    +P +  +      L A+Y+ L++ AL  +     ++ +  R+  +++S+ 
Sbjct: 64  YDADILGLYDNPTESDW------LYANYDGLIKAALRERFP-EVTSRSEKRELYKLVSSG 116

Query: 118 ARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKL 175
           A++ +R +L  +  L+G T  + +LA  ++DS LKG++    P    R+ D    W   L
Sbjct: 117 AKFSVRDSLDNNEELLGTTATLWVLADDDLDSVLKGHIDRTLPEADRRVKDQHLVWIDSL 176

Query: 176 DSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
             +G +   FN  FF + AS+ PE AG+  A+ GS + +++ + LSFP+G+A+A+YLEEF
Sbjct: 177 VENGEVEKRFNTVFFTHSASAEPEQAGVWGAIKGSFFTLIVTLVLSFPVGVAAAVYLEEF 236

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + +  ++  ++ NINNLA+VPSIV+G+LG AV +NF  +PRS  LVGGL+L LMTLP+II
Sbjct: 237 APQNRWTDLIEVNINNLAAVPSIVFGLLGLAVFLNFMGLPRSAPLVGGLVLTLMTLPTII 296

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I++  AL+ VP SIR AALG+GAS++QT+FHHVLPLAMP +LTG+ + +A+ALGE+APLL
Sbjct: 297 ISSRAALKAVPPSIREAALGMGASRMQTIFHHVLPLAMPGMLTGTIIGMAQALGESAPLL 356

Query: 356 FVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            +GMVAFV + P G+TD AT  PVQI+ WA   ER FVERT  AI++LL FL  +N   +
Sbjct: 357 MIGMVAFVAEVPQGITDPATVLPVQIFQWADLPERGFVERTSAAIMVLLAFLIAMNAFAV 416

Query: 416 WLRNRFKKRW 425
           +LR RF++RW
Sbjct: 417 YLRKRFERRW 426


>gi|88799185|ref|ZP_01114765.1| phosphate ABC transporter, permease protein (PstA) [Reinekea sp.
           MED297]
 gi|88778168|gb|EAR09363.1| phosphate ABC transporter, permease protein (PstA) [Reinekea sp.
           MED297]
          Length = 437

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 194/420 (46%), Positives = 265/420 (63%), Gaps = 5/420 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           K  L  RY  E  FR Y V ++++   FL +LL +I + G    + T I L + +    +
Sbjct: 21  KAKLGKRYAKEKRFRAYGVASIVIGLCFLAMLLGTIFTAGWSTFYATEIRLTVTYDADAI 80

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                   D + L+ AD+  LV+ A+  +     S  +  R    ++S+ A Y L+  L 
Sbjct: 81  GVSD--LNDESQLMFADWGALVKNAMKERFPYV-SGRSDRRAMYSLVSSVAEYDLKDRLE 137

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P L+G T EV L+A   ID+ +KG   +  P N  R+SD Q    + L   G L   F
Sbjct: 138 ANPELLGTTEEVWLMADDEIDALMKGQVDMSVPENERRISDLQNSLVESLIESGELKKSF 197

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  FF NG S  PE AGI  A++GS + +L+ + LSFP+G+A+AIYLEEF+ K   +  +
Sbjct: 198 NTTFFTNGDSREPEQAGIRGAMLGSFFTLLVTLALSFPIGVAAAIYLEEFAPKNRLTEII 257

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+LG AV IN F +PRS  +VGGL+L LMTLP+III++  A++ V
Sbjct: 258 EVNINNLAAVPSIVFGLLGLAVFINVFHLPRSAPVVGGLVLTLMTLPTIIISSRSAIKAV 317

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AALGLGASKVQ V HHVLPLAMP +LTG+ + +A+ALGETAPLL +GMVAF+ D
Sbjct: 318 PPSIREAALGLGASKVQMVMHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGMVAFIAD 377

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P G  D AT  PVQI+LW+   ER FV +T GAI++LL FLA +N   ++LR +F+ RW
Sbjct: 378 IPSGPLDSATVLPVQIFLWSDLPERAFVAKTSGAIMVLLGFLAAMNLLAVYLRKKFETRW 437


>gi|254480369|ref|ZP_05093616.1| phosphate ABC transporter, permease protein PstA [marine gamma
           proteobacterium HTCC2148]
 gi|214038952|gb|EEB79612.1| phosphate ABC transporter, permease protein PstA [marine gamma
           proteobacterium HTCC2148]
          Length = 428

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 191/423 (45%), Positives = 274/423 (64%), Gaps = 5/423 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           K+ ++ + +LK RY  E  F+ Y  +AVL  FVFL +LL  IVSKG  A  Q HIS+ + 
Sbjct: 7   KNTALIQASLKKRYARERRFQMYGKLAVLAGFVFLFVLLFDIVSKGTPAFTQQHISIAVN 66

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
                +        D   + +AD++ L++ +L R++     +    RQ  +++S  A Y 
Sbjct: 67  IDVDALGVSSTASQDE--ISKADFSSLIKSSL-REMFPDVKSRGDKRQLYRLVSIGAEYD 123

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           LR  ++ DP+L+GK  ++ +LA +   S LKG +    P    ++ + Q  W  +L   G
Sbjct: 124 LRDKVLADPTLLGKKQDIWMLAHSQAASYLKGQITRVIPEAERKVKNQQMDWLDRLREQG 183

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
                FN  FF  G S  PE+AGI  A+ GSL+ +++   L+FP+G+ +A+YLEEF+ + 
Sbjct: 184 RTKSSFNTTFFTYGDSREPELAGIRAALQGSLFTLMVTFALAFPIGVFAAVYLEEFAPRN 243

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
             +  ++ NINNLA+VPSIV+G+LG AV INFF++PRS  LVGG++L+LMTLP+III + 
Sbjct: 244 RLTDLIEININNLAAVPSIVFGLLGLAVFINFFELPRSAPLVGGIVLSLMTLPTIIITSR 303

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A++ V  SIR AALG+GASK+QTVFHHVLP+AMP ILTGS + +A+ALGE+APLL +GM
Sbjct: 304 AAIQAVSPSIREAALGVGASKLQTVFHHVLPVAMPGILTGSIIGMAQALGESAPLLMIGM 363

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P GVTD +T  PVQIYLWA   ER F E+T  AI++L+ FL ++N   + LR 
Sbjct: 364 VAFIMDVPGGVTDSSTVLPVQIYLWADSPERGFTEKTSAAIMVLMGFLILMNALAIILRK 423

Query: 420 RFK 422
           RF+
Sbjct: 424 RFE 426


>gi|262276140|ref|ZP_06053949.1| phosphate transport system permease protein PstA [Grimontia
           hollisae CIP 101886]
 gi|262219948|gb|EEY71264.1| phosphate transport system permease protein PstA [Grimontia
           hollisae CIP 101886]
          Length = 433

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 182/404 (45%), Positives = 268/404 (66%), Gaps = 5/404 (1%)

Query: 24  YCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRA 83
           Y + ++ + F FLI+++++I S+G  A   T I L ++ S  ++        DP +L+ A
Sbjct: 33  YGIASISMAFAFLIVMMTTIFSEGYTAFLTTEIKLQVDLSPEMLGIDGDE-TDPKVLMGA 91

Query: 84  DYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLA 143
            Y  ++R+AL  ++++   N    R   + +S  A Y LR  +++DPSLIG+T+     A
Sbjct: 92  SYRKVLRQALRDEIAVDGRNQR--RALYRFISNGAEYELRNKVVSDPSLIGQTITYWAQA 149

Query: 144 SANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVA 201
             N++   KG + +  P +  +  + Q +W+ +L  +G +   FN  FF +G S  PE+A
Sbjct: 150 GDNLNQYNKGNIKTDAPEDDRQFKNLQIEWYGELKKEGRVRTVFNTKFFTHGDSRDPELA 209

Query: 202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYG 261
           GI  A VGS Y +L+ + LSFP+G+A+AIYLEEF+ +   +  ++ NINNLA+VPSIV+G
Sbjct: 210 GIWGATVGSFYTLLVTLVLSFPIGVAAAIYLEEFAPRNRATELIEININNLAAVPSIVFG 269

Query: 262 ILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKV 321
           +LG AV +N   +PRS  LVGGL+L LMTLP+III++  A++ VP S+R AALG+GASK+
Sbjct: 270 LLGLAVFLNVADLPRSAPLVGGLVLTLMTLPTIIISSRAAIKAVPPSVRDAALGVGASKM 329

Query: 322 QTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQI 381
           Q V HHVLPLAMP +LTG+ + +A+ALGETAPLL +GMVAF+ D P G  D ATA PVQI
Sbjct: 330 QMVLHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGMVAFIVDVPSGPLDAATALPVQI 389

Query: 382 YLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           YLWA + E+ F E T GAI++LL FLA++N   + +R R ++RW
Sbjct: 390 YLWAENPEKGFAENTSGAIMVLLAFLALMNACAVIMRKRLERRW 433


>gi|83591939|ref|YP_425691.1| phosphate ABC transporter permease [Rhodospirillum rubrum ATCC
           11170]
 gi|83574853|gb|ABC21404.1| Phosphate transport system permease protein 2 [Rhodospirillum
           rubrum ATCC 11170]
          Length = 426

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 197/421 (46%), Positives = 273/421 (64%), Gaps = 7/421 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +  LK RY  E  FR   + A+L     L+ L  +I S G+ A   T + L +  +   V
Sbjct: 10  RAGLKRRYRQERWFRGLGLAAILTALAMLLTLFVTIFSNGVSAFVTTELVLDVPVTAAEV 69

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKL-SISDSNHALLRQASQMLSTTARYHLRKTL 126
           DPQ  R  DPA+L  A+Y  LV  A++     ++D      R    ++S  A Y LR  +
Sbjct: 70  DPQGTR--DPAVLSAANYRKLVSDAMSALFPEVTDRRER--RVLMGIVSDGAAYRLRAQV 125

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLD 184
           M DPSLIG+TV +++  S++ D   KG +   S     R++D Q  +F  L+  G +   
Sbjct: 126 MADPSLIGQTVRLNVPVSSDYDMLAKGLVDRDSLEGDRRLADNQITYFLSLEERGLITKT 185

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN G F  G S +PE+AGI   VVGS+Y++L+ + LSFP+G+A+AIYLEE++ + +F+  
Sbjct: 186 FNSGLFTEGDSRQPELAGIWGGVVGSVYVLLVTLALSFPIGVATAIYLEEYAPRNWFTDL 245

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPSIV+G+LG AV +N F MPRS  +VGGL+L LMTLP+IIIA+  AL +
Sbjct: 246 IEVNINNLAAVPSIVFGLLGLAVFLNVFGMPRSAPVVGGLVLTLMTLPTIIIASRAALTS 305

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AALG+GASK+Q V HHVLPLAMP +LTG+ + +A+ALGETAPLL +GMVAF+ 
Sbjct: 306 VPPSIREAALGVGASKMQMVTHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGMVAFIA 365

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P G    AT  PVQI+LW+   ER FVERT  AI++LL FL ++N   + LR +F+++
Sbjct: 366 DIPSGPMAPATVLPVQIFLWSDSPERAFVERTSAAIIVLLAFLVLMNAGAVLLRKKFERK 425

Query: 425 W 425
           W
Sbjct: 426 W 426


>gi|302382811|ref|YP_003818634.1| phosphate ABC transporter inner membrane subunit PstA
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302193439|gb|ADL01011.1| phosphate ABC transporter, inner membrane subunit PstA
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 431

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 193/429 (44%), Positives = 270/429 (62%), Gaps = 21/429 (4%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
           S+ K+ LK RY  E  F+ Y ++A+ V   FL+LLL  I+ +G  A +   I++P+    
Sbjct: 16  SLLKRGLKARYAREGRFKLYGLLAIGVAMSFLLLLLGRIIEQGHTAFYANQITVPV---- 71

Query: 65  TIVDPQKKRFMDPAILLRA-----DYNLLVRKALARKLSISDSNHALLRQASQ-MLSTTA 118
                    +MDPA + RA     ++  +V +    ++ ++D        A + +LS+  
Sbjct: 72  ---------YMDPARIDRAYPQGTNFQQMVAQQSLARMGVTDDERGTKTTAYRALLSSEL 122

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLD 176
           ++     +  +P+LIG+TV V+   S   D   KG +   +PA+  ++SD Q  W   L 
Sbjct: 123 KFRAAAMIRENPALIGQTVTVTAPVSDEADLYYKGEVTRETPADQRKVSDQQMAWLDGLK 182

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
            DGA+   FN   F NG S+ PE+AG+  AVVGS  M+L+   L+ PLG+ +A+YLEEFS
Sbjct: 183 RDGAVSTTFNTLLFTNGDSTEPELAGVLGAVVGSALMLLVTAALAIPLGVGAAVYLEEFS 242

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            KG  +  ++ NINNLA+VPSIVYG+LG A+ IN+  +PRS+ LVGGL+LALM LP+III
Sbjct: 243 KKGRITDLIEVNINNLAAVPSIVYGLLGVALFINWAHLPRSSPLVGGLVLALMALPTIII 302

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           AT  AL+ VP SIR AAL +GAS+ QTVFHHVLPLAMP +LTG+ +S+A ALGETAPLL 
Sbjct: 303 ATRSALKAVPPSIREAALAMGASRTQTVFHHVLPLAMPGVLTGTIISMAHALGETAPLLL 362

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           +GMV+FV   P  VT    A P  +Y+W   +ER F ERT  AIL+LL F+ V+N A + 
Sbjct: 363 IGMVSFVPGIPHSVTAPTGALPSLVYIWENASERAFHERTAAAILVLLAFMIVMNAAAIL 422

Query: 417 LRNRFKKRW 425
           LR RF++RW
Sbjct: 423 LRRRFERRW 431


>gi|255263961|ref|ZP_05343303.1| phosphate ABC transporter, permease protein PstA [Thalassiobium sp.
           R2A62]
 gi|255106296|gb|EET48970.1| phosphate ABC transporter, permease protein PstA [Thalassiobium sp.
           R2A62]
          Length = 441

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 200/430 (46%), Positives = 279/430 (64%), Gaps = 22/430 (5%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  F+ Y + AV+   + L +LL+SI+S G+GA  QT +++ I   E  +D  K
Sbjct: 18  RKRNRAESRFKAYGLTAVIASVLALFMLLASILSNGLGAFQQTFVTINIALPEDKLD--K 75

Query: 72  KRFMDPAILLRAD---YNLLVRKALARKLS-----ISDSNHALLRQASQMLSTTARYHLR 123
               DP ++ +     Y  L+R  L + L+        S  ALL     ++S  A   LR
Sbjct: 76  SGVRDPEVMAKVSTFGYTPLIRDGLVQTLANAGIETDQSAKALL----GLISKEAPAALR 131

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGAL 181
             ++ +P L+G+TV + LLA+  ID   KG   + S A     S    +  Q+L  DG +
Sbjct: 132 YRVLANPDLVGQTVSMELLANGRIDGFFKGRVTMESAALDKNTSPEILQVAQQLADDGLM 191

Query: 182 FLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
              FN+GF    + +  RPE AG+GVA++GSLYMM++V+ L+ PLG+A++IYLEEF+   
Sbjct: 192 TTRFNWGFLTKPDASDQRPESAGLGVAILGSLYMMIVVLALALPLGVAASIYLEEFAPNN 251

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
           + +  ++ NI+NLA+VPSIVYGILG A+ INF  +P+S  LVGGL+L LMTLP+III+T 
Sbjct: 252 WITDLIEVNISNLAAVPSIVYGILGLAIFINFAGLPQSAPLVGGLVLTLMTLPTIIISTR 311

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL++VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GM
Sbjct: 312 AALKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGM 371

Query: 360 VAFVTDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
           VAFV +YP     G TD ATA PVQI+ W   A+  FVER FGAI+ LL+FL  +N   +
Sbjct: 372 VAFVKEYPEIGIEGFTDPATALPVQIFNWTQRADPAFVERAFGAIITLLVFLLFMNLLAI 431

Query: 416 WLRNRFKKRW 425
           +LR +F++RW
Sbjct: 432 FLRRKFERRW 441


>gi|304394456|ref|ZP_07376377.1| phosphate ABC transporter, permease protein PstA [Ahrensia sp.
           R2A130]
 gi|303293366|gb|EFL87745.1| phosphate ABC transporter, permease protein PstA [Ahrensia sp.
           R2A130]
          Length = 419

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 191/423 (45%), Positives = 272/423 (64%), Gaps = 12/423 (2%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
           SI +     R  +E  F+ Y + A+++   FL L+++SIV +G GA  Q+ I+L +    
Sbjct: 7   SILRSGPTKRSKAETRFKMYGLAAIILSLGFLALMVTSIVVRGTGAFQQSFITLDVAIPA 66

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
            +         D   +   ++  +++KAL  +   + S +   R   +++S+TA + +R 
Sbjct: 67  DV---------DVNDINAPNWGGVLKKALRERFPDAKSRNDK-RSLYRLVSSTAEFTVRD 116

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALF 182
            +  +P+LIG T  +++ AS++ID  +KG   L  P N  R++D Q  W   L   G + 
Sbjct: 117 AVAANPALIGTTAPIAIRASSDIDMLIKGNVDLELPENQRRVTDQQAAWLTDLQQAGVVE 176

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
             FN  FF  G S  PE AGI  AVVGS   +++   L+FPLG  +A+YLEEF+ KG  S
Sbjct: 177 TSFNKQFFTGGDSREPEQAGIWGAVVGSFLSLMVCFTLAFPLGTLAAVYLEEFAPKGRIS 236

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NINNLA+VPSIV+G+LG A+ +NFF +PRST LVGG++LALMTLP+IIIA+  +L
Sbjct: 237 QIIEVNINNLAAVPSIVFGLLGLAIFLNFFDLPRSTPLVGGMVLALMTLPTIIIASRASL 296

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP SIR AA GLGASKVQT FHHV+PLA+P +LTGS + +A+ALGETAPLL +GMVAF
Sbjct: 297 RAVPPSIREAAYGLGASKVQTTFHHVVPLAIPGMLTGSIIGMAQALGETAPLLMIGMVAF 356

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           + D P GV D ATA PVQI+LWA   +R F+E+T  AI++LL FL ++N   + LR + +
Sbjct: 357 IVDIPSGVLDAATALPVQIFLWADAPDRGFLEKTSAAIMVLLGFLIIMNIIAIVLRKKLE 416

Query: 423 KRW 425
            RW
Sbjct: 417 VRW 419


>gi|126736261|ref|ZP_01752003.1| Phosphate transport system permease protein 2 [Roseobacter sp.
           CCS2]
 gi|126714082|gb|EBA10951.1| Phosphate transport system permease protein 2 [Roseobacter sp.
           CCS2]
          Length = 439

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 197/429 (45%), Positives = 276/429 (64%), Gaps = 17/429 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  F+ Y + A++V  + L +LL+S+++ G+ +  QT ISLPIE +E  VD Q 
Sbjct: 13  KKRNAAEARFKAYGLSAIVVAMLALAILLTSVLTNGLSSFQQTFISLPIELAEERVDKQG 72

Query: 72  KRFMDPAILLRA---DYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARYHLRKTLM 127
            R  DPA + R     Y  L+R A+  ++        L  +    M+S  A   +R  ++
Sbjct: 73  NR--DPAEMARTTTIGYAPLLRAAIVAEVERQGLTTELSDKDLGDMISKEAAATVRNRVL 130

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P L+G+T+   LLA+  ID   KG   L + A     S       Q L   G +   F
Sbjct: 131 ANPDLVGETITFDLLAAGRIDGYFKGRVTLETAALDGNTSPEALMVAQALADAGVIETKF 190

Query: 186 NYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           N+ FF   + +  RPE AG+GVA++GSLYMML+V+ L+ P+G+AS+IYLEEF+ K   + 
Sbjct: 191 NWNFFTAPDASVQRPEAAGLGVAILGSLYMMLVVLFLALPIGVASSIYLEEFAPKNRITD 250

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI+NLA+VPSIVYGILG A+ INF +  +S+ LVGGL+L LMTLP+III+T  AL+
Sbjct: 251 IIEVNISNLAAVPSIVYGILGLAIFINFMEFNQSSPLVGGLVLTLMTLPTIIISTRAALK 310

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMVAFV
Sbjct: 311 SVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFV 370

Query: 364 TDYPVGVT-------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
            +YP   T       + +TA PVQ+Y W   ++  FVER  GAI+ LL+FL ++N   ++
Sbjct: 371 REYPAAYTPEAGLFGEASTALPVQVYNWTQRSDPAFVERASGAIITLLVFLLIMNAVAIY 430

Query: 417 LRNRFKKRW 425
           LR RF++RW
Sbjct: 431 LRRRFERRW 439


>gi|154250852|ref|YP_001411676.1| phosphate ABC transporter inner membrane subunit PstA [Parvibaculum
           lavamentivorans DS-1]
 gi|154154802|gb|ABS62019.1| phosphate ABC transporter, inner membrane subunit PstA
           [Parvibaculum lavamentivorans DS-1]
          Length = 430

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 264/417 (63%), Gaps = 11/417 (2%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           LK RY ++   R Y V A+L     L  L+ +I S  I A+ QT ++L +E     +D  
Sbjct: 23  LKRRYAADKRLRLYGVAAILFALGMLATLVLTIASTAIPAITQTMVTLDVELPAEAIDAA 82

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
             R         A+Y   +  A+AR     D+   + R+  Q+ +++A+Y LR  ++ DP
Sbjct: 83  NPR--------EANYQKFINDAIARMFPEVDTPREM-RELRQLFTSSAQYQLRDRVIEDP 133

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           S+IG TV  +   S   D   KG +    P +  R+SD Q  W+ +L     +   FN+G
Sbjct: 134 SMIGSTVAFTFPLSDIGDQLHKGGIDRDLPRDQRRISDDQIGWYDRLVEQDRISTPFNWG 193

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
              N  S  PE+AG+  A+VGS Y +LI   +SFP+GI++A+YLEEF+ K  ++  ++ N
Sbjct: 194 LLTNADSRFPELAGLWGALVGSFYALLICFLISFPVGISAAVYLEEFAPKNRWTDLIEVN 253

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIV+G+LG AV +NFF MPRS  +VGGL+L+LMTLP+IIIAT  AL+ VP S
Sbjct: 254 INNLAAVPSIVFGLLGLAVFLNFFGMPRSAPIVGGLVLSLMTLPTIIIATRAALKAVPPS 313

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR AA+G+GASK+QTV HHVLPLAMP ILTG+ + LA+ALGETAPLL +GM AF+T  P 
Sbjct: 314 IREAAIGVGASKMQTVAHHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMNAFITAAPD 373

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            + + +TA P QIY+WA   ER F  RT  AI++LL FL  +N   +++R RF+KRW
Sbjct: 374 SMFNPSTALPTQIYIWADSPERGFTSRTSAAIVVLLGFLVCMNAIAIYMRKRFEKRW 430


>gi|89054782|ref|YP_510233.1| phosphate ABC transporter permease [Jannaschia sp. CCS1]
 gi|88864331|gb|ABD55208.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Jannaschia sp. CCS1]
          Length = 457

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 203/440 (46%), Positives = 280/440 (63%), Gaps = 21/440 (4%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
           F+ + +  K R  +E  FR Y + AV V  + LI+LL+SI+  G+ A  QT+IS P+  S
Sbjct: 21  FASDARTAK-RNRAERRFRVYGMAAVGVGILALIVLLASILGNGLSAFKQTYISYPLVLS 79

Query: 64  ETIVDPQKKRFMDPAILLRA---DYNLLVRKALARKLSISDSNHALL-RQASQMLSTTAR 119
           E  +DP   R  DPA + R     Y  ++  +L   L      H +  R+ + MLS  A 
Sbjct: 80  EDRLDPDGNR--DPAEMARVTTFGYLPVLALSLEAFLEAEGIEHEMGGRELAAMLSEEAP 137

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             +R  ++ +P L+G+T++  +L    ID   KG   + S      +S  Q    Q L  
Sbjct: 138 AQVRAMVLANPDLLGQTIDAEILLGGRIDGFFKGRVTMESAERDRNVSVNQLLLAQALAE 197

Query: 178 DGALFLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G + + FN+ F    + + SRPE AG+GVA++GSLYMM++V+ L+ P+G+A++IYLEEF
Sbjct: 198 RGEVVIRFNWDFITWPDASGSRPEAAGLGVAIIGSLYMMIVVLVLALPIGVAASIYLEEF 257

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K   +  ++ NI+NLA+VPSIVYGILG AV INF +  +S+ LVGGL+L LMTLP+II
Sbjct: 258 APKNRLTDVIEVNISNLAAVPSIVYGILGLAVFINFMEFNQSSPLVGGLVLTLMTLPTII 317

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT  +LR VP SIR AALGLGASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 318 IATRASLRAVPPSIRQAALGLGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPLL 377

Query: 356 FVGMVAFVTDYPVGVT----------DIATAFPVQIYLWAADAERPFVERTFGAILLLLI 405
            +GMVAFV +YP  V+          D ATA PVQ+Y W   ++  FVER  GAI++LL+
Sbjct: 378 LIGMVAFVREYPDLVSTHSNAFPLMGDGATALPVQVYSWTQRSDPAFVERASGAIIVLLL 437

Query: 406 FLAVINTAMLWLRNRFKKRW 425
           FL  +N   + LR RF++RW
Sbjct: 438 FLLAMNAIAILLRRRFERRW 457


>gi|254788384|ref|YP_003075813.1| phosphate ABC transporter permease PstA [Teredinibacter turnerae
           T7901]
 gi|237683888|gb|ACR11152.1| phosphate ABC transporter, permease protein PstA [Teredinibacter
           turnerae T7901]
          Length = 430

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 186/405 (45%), Positives = 262/405 (64%), Gaps = 4/405 (0%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +++L  R  SEW F+     +V V  + L++L + I+  GIGA  Q+ I + IEF    +
Sbjct: 17  ERSLAKRRASEWRFKQMGRASVAVGIIALLILFTQIIGNGIGAFRQSFIHMEIEFDPDTL 76

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
              +      A+   A+++ +VR  L R+L          R+   + S  A + LR  L 
Sbjct: 77  GMTEVNHEQLAL---ANFDGIVRNGL-RELFPEVKGRREKRELYSIASYGAGFKLRDMLA 132

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            DP L+G+ V V LL   ++D+ +K          R+S+ Q K   KL   GAL LDFN 
Sbjct: 133 ADPGLLGQRVSVKLLVDDDVDTYVKSLRAGDPYEDRISEAQRKRIDKLLESGALKLDFNT 192

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFF +  S+ PE AGI  A++GSL+ +L+   LSFP+G+A+AIYLEE++ +   + F++ 
Sbjct: 193 GFFTSADSAEPEQAGILGALLGSLFTLLVTGSLSFPIGVAAAIYLEEYAKRSRLTDFIEV 252

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPS+++G+LG A+ +NFF MPRS  LVGGL+L LMTLP+III++  A++ VP 
Sbjct: 253 NINNLAAVPSVIFGLLGLAIFLNFFNMPRSMPLVGGLVLTLMTLPTIIISSRAAIKAVPP 312

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALG+GASK+Q +  HVLPLAMP +LTG+ + +A+ALGETAPLL +GMVAF+ + P
Sbjct: 313 SIREAALGMGASKMQMILQHVLPLAMPGMLTGAIIGMAQALGETAPLLMIGMVAFIAEVP 372

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
            G+TD AT  PVQI+LWA   ER FVERT  AI++LL FL  +NT
Sbjct: 373 AGITDPATVLPVQIFLWADSPERAFVERTSAAIMVLLAFLITMNT 417


>gi|254427840|ref|ZP_05041547.1| phosphate ABC transporter, permease protein PstA [Alcanivorax sp.
           DG881]
 gi|196194009|gb|EDX88968.1| phosphate ABC transporter, permease protein PstA [Alcanivorax sp.
           DG881]
          Length = 422

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 184/418 (44%), Positives = 267/418 (63%), Gaps = 4/418 (0%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K L  RY +E  F+ + + ++ +  + L+LL + I+ KG  A  +  I LPI F   ++
Sbjct: 9   RKTLARRYRAEKRFKAFGIGSIGIGLMALVLLFTDIIGKGHSAFVEYEIQLPITFDAEVL 68

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D    R  D   L   +Y  ++R ALA +    +      R  +Q++ST A Y LR  L 
Sbjct: 69  DVSDPR--DEDELNYGNYQGVIRDALAERFPTVEGRQDT-RALNQLVSTGAGYALRDMLR 125

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            +P+L+G+T  + LLA  ++D  LK       +  R+++ Q  W  +L++ G   + FN 
Sbjct: 126 EEPTLLGETRTLWLLADDDVDLFLKANEEQRED-SRLNEKQQAWVAELETSGETRMVFNQ 184

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
             F  G S  PE AGI  A++GSL+ M++ + LSFP+G+A+A+YLEEF+ K  F+ F++ 
Sbjct: 185 SLFSYGDSREPEQAGILGAILGSLFTMIVTLVLSFPVGVAAAVYLEEFAPKNKFTDFIEV 244

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSI++G+LG AV+I  F +PRS  LVGG++L LMTLP++II++  A++ VP 
Sbjct: 245 NINNLAAVPSIIFGLLGLAVIIGLFGLPRSVPLVGGIVLTLMTLPTVIISSRAAIKAVPP 304

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AA+GLGASK+Q V HHVLPLA+P +LTG+ + +A+ALGETAPLL +GMVAF+ D P
Sbjct: 305 SIRQAAMGLGASKMQVVLHHVLPLALPGMLTGAIIGMAQALGETAPLLMIGMVAFIVDLP 364

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            G  D AT  PVQIYLWA   E+ F      AI++LL FL  +NT  + LR R ++RW
Sbjct: 365 AGPLDAATVLPVQIYLWADSPEQSFESLASAAIMVLLAFLITMNTLAVILRKRLERRW 422


>gi|295691210|ref|YP_003594903.1| phosphate ABC transporter inner membrane subunit PstA [Caulobacter
           segnis ATCC 21756]
 gi|295433113|gb|ADG12285.1| phosphate ABC transporter, inner membrane subunit PstA [Caulobacter
           segnis ATCC 21756]
          Length = 431

 Score =  355 bits (911), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 190/427 (44%), Positives = 279/427 (65%), Gaps = 13/427 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTH-ISLPIE 61
           +FS     LK R+ +E LF+   V A+++  VFL++L+  IV++G    ++TH +S+P+ 
Sbjct: 14  AFSAADDRLKKRHRAERLFKAQGVAAIIIAMVFLVVLVGRIVAQGY-TTFETHTLSVPV- 71

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQ-MLSTTARY 120
                ++P +   +D + L   +Y+ +V +A+ +KL + D +   +    Q ++S    +
Sbjct: 72  ----YLNPDR---IDTSDLSGVNYDYIVAEAVMKKLGVQDDDLGTVSTKVQDLVSRDFGF 124

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSD 178
            L   L  D SLIGKT++VS    A+ D   KG L   +     ++ + Q  W  +L   
Sbjct: 125 QLLNKLKADQSLIGKTIDVSGPLKADADLYFKGELKRSTAEGDRKLDNQQLDWLDQLQKA 184

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           GA+   FN+ FF N  S+ PE AG+  AVVGS  M++I   ++ P+G+ +A+YLEEF+ K
Sbjct: 185 GAIKSGFNFAFFTNSDSTEPEQAGVLGAVVGSAMMLIITALIAVPVGVMAAVYLEEFAPK 244

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NINNLA+VPSIVYG+LG A+ IN+  +PRS+ LVGGL+LALM LP++IIAT
Sbjct: 245 NRWTDVIEVNINNLAAVPSIVYGLLGLALFINWLNVPRSSPLVGGLVLALMALPTVIIAT 304

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR AALG+GASK QTVFHHVLPLAMP ++TG+ +SLA ALGETAPLL +G
Sbjct: 305 RSALKAVPPSIREAALGVGASKTQTVFHHVLPLAMPGVMTGAILSLAHALGETAPLLMIG 364

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MV+FV   P G T  AT  PVQ+++W   +ER F ERT  AI++LL+F+ ++N A + LR
Sbjct: 365 MVSFVPGVPEGFTGAATVLPVQVFIWENASERAFHERTAAAIIVLLVFMIIMNAAAVILR 424

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 425 RRFERRW 431


>gi|16124546|ref|NP_419110.1| phosphate ABC transporter permease [Caulobacter crescentus CB15]
 gi|221233232|ref|YP_002515668.1| phosphate transport system permease protein PstA [Caulobacter
           crescentus NA1000]
 gi|13421432|gb|AAK22278.1| phosphate ABC transporter, permease protein [Caulobacter crescentus
           CB15]
 gi|220962404|gb|ACL93760.1| phosphate transport system permease protein pstA [Caulobacter
           crescentus NA1000]
          Length = 431

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 189/428 (44%), Positives = 280/428 (65%), Gaps = 13/428 (3%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTH-ISLPI 60
           ++ S  +  LK R+ +E LF+   V A+++  +FL++L+  IV++G  + +QTH +S+ +
Sbjct: 13  QTLSAAEARLKKRHRAERLFKAQGVAAIIIAMIFLVVLVGRIVTQGY-STFQTHTLSVAV 71

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQ-MLSTTAR 119
                 ++P++   +D + L   +Y+ +V +A+ +KL + D +   +    Q ++S    
Sbjct: 72  -----YLNPER---IDTSDLSGVNYDYIVAEAVMKKLGVQDDDFGTISTKVQDLVSRDFG 123

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANV--HRMSDYQWKWFQKLDS 177
           + L   L  D +LIG+TV V+    A+ D   KG +    +    ++ + Q  W  KL  
Sbjct: 124 FQLLNKLKADQTLIGQTVTVTGPLKADADLYFKGQIERSTDEGDRKLDNQQLDWLDKLQK 183

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DGA+   FN GFF +  S+ PE AG+  AVVGS  M+LI   +S P+G+ +A+YLEEF+ 
Sbjct: 184 DGAITSGFNTGFFTHSDSTEPEQAGVLGAVVGSAMMLLITALISVPVGVLAAVYLEEFAP 243

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K  ++  ++ NINNLA+VPSIVYG+LG A+ IN+  +PR + LVGGL+LALM LP++IIA
Sbjct: 244 KNRWTDIIEVNINNLAAVPSIVYGLLGLALFINWLNVPRGSPLVGGLVLALMALPTVIIA 303

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  AL+ VP SIR AALG+GASK QTVFHHVLPLAMP ++TG+ +SLA ALGETAPLL +
Sbjct: 304 TRSALKAVPPSIREAALGVGASKTQTVFHHVLPLAMPGVMTGAILSLAHALGETAPLLMI 363

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMV+FV   P G T  AT  PVQ+++W   +ER F ERT  AI++LL+F+ V+N A + L
Sbjct: 364 GMVSFVPGVPEGFTSAATVLPVQVFIWENASERAFHERTAAAIIVLLVFMIVMNAAAVIL 423

Query: 418 RNRFKKRW 425
           R RF++RW
Sbjct: 424 RRRFERRW 431


>gi|110835544|ref|YP_694403.1| phosphate ABC transporter permease [Alcanivorax borkumensis SK2]
 gi|110648655|emb|CAL18131.1| phosphate ABC transporter permease protein [Alcanivorax borkumensis
           SK2]
          Length = 422

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 268/418 (64%), Gaps = 4/418 (0%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K L  RY +E  F+ Y + ++ +  + L+LL + I+ KG  A  +  I LPI F   ++
Sbjct: 9   RKTLARRYRAEKRFKAYGMASIGIGLMALLLLFTDIIGKGHSAFVEYEIQLPITFDAEVL 68

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D    R  D   L   +Y  ++R ALA +    +S   + R  +Q++ST A Y LR  L 
Sbjct: 69  DVSDPR--DAEQLNYGNYQGVIRDALAERFPGVESRLDV-RSLNQLVSTGAGYALRDMLR 125

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            +P+L+G+T  + LLA  ++D  LK       +  R++D Q  W  +L++ G   + FN 
Sbjct: 126 EEPALLGETRTLWLLADDDVDLFLKANEEQRED-SRLNDKQQAWVAELEASGETRMVFNR 184

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
             F  G S  PE AGI  A++GSL+ M++ + LSFP+G+A+A+YLEEF+ K  F+ F++ 
Sbjct: 185 SLFSYGDSREPEQAGILGAILGSLFTMIVTLLLSFPIGVAAAVYLEEFAPKNRFTDFIEV 244

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSI++G+LG AV+I  F +PRS  LVGG++L LMTLP++II++  A++ VP 
Sbjct: 245 NINNLAAVPSIIFGLLGLAVIIGLFGLPRSVPLVGGIVLTLMTLPTVIISSRAAIKAVPP 304

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AA+GLGASK+Q V HHVLPLA+P +LTG+ + +A+ALGETAPLL +GMVAF+ D P
Sbjct: 305 SIRQAAMGLGASKMQVVLHHVLPLALPGMLTGAIIGMAQALGETAPLLMIGMVAFIVDLP 364

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D AT  PVQIYLWA   E+ F      AI++LL FL  +NT  + LR R ++RW
Sbjct: 365 ADPLDAATVLPVQIYLWADSPEQSFEALASAAIMVLLAFLITMNTLAVILRKRLERRW 422


>gi|119387033|ref|YP_918088.1| phosphate ABC transporter, inner membrane subunit PstA [Paracoccus
           denitrificans PD1222]
 gi|119377628|gb|ABL72392.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Paracoccus denitrificans PD1222]
          Length = 447

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 190/438 (43%), Positives = 281/438 (64%), Gaps = 19/438 (4%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S  +     + R  +E  FR Y + A+++  + L++LL +IV+ G+GA  QT++ +P+  
Sbjct: 14  SLLVADPRTRKRNAAEARFRAYGLGAIVISMIMLVILLFTIVTGGVGAFRQTYLEIPVAL 73

Query: 63  SETIVDPQKKRFMDPAIL---LRADYNLLVRKALARKLSISDSNHALL----RQASQMLS 115
               +D    R  DPA +   L   Y  ++ ++L +  +I+D   A+     +  S ++S
Sbjct: 74  DAAQLDKNGNR--DPADIRKVLTLTYGKILEQSLQQ--AIADKGIAVAELSAKDVSNLIS 129

Query: 116 TTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQ 173
             A   LR  ++ DP LIG+TVE  +L +  +D   KG   + S A     S  Q +   
Sbjct: 130 KEASAQLRNRVLADPELIGQTVEARVLVNGRVDGYYKGRVSMESAARDANTSPAQLQLAD 189

Query: 174 KLDSDGALFLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
            L + G L  ++N+ F    + +  RPE AG+G+A++GSLYMML+V+ L+ P+G+A++IY
Sbjct: 190 ALKAQGMLATEWNWSFLTSPDASDQRPEAAGVGIAILGSLYMMLVVLALAVPIGVAASIY 249

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           LEEF+ K  ++  ++ NI+NLA+VPSIV+GILG A  INF  +P+S  +VGGL+L LMTL
Sbjct: 250 LEEFAPKNRWTDIIEVNISNLAAVPSIVFGILGLAAFINFAGLPQSAPIVGGLVLTLMTL 309

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P+IIIAT  AL+ VP SIR AALG+GASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGET
Sbjct: 310 PTIIIATRAALKAVPPSIRDAALGVGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGET 369

Query: 352 APLLFVGMVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFL 407
           APLL +GMVAFV ++P     G+ + A+A PVQ+Y W   A+  F+ER  GAI++LL FL
Sbjct: 370 APLLLIGMVAFVKNFPSAPPDGLFEPASALPVQVYNWTQRADPAFIERASGAIIVLLAFL 429

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N   + LR +F++RW
Sbjct: 430 LCMNLLAILLRRKFERRW 447


>gi|149202578|ref|ZP_01879550.1| ABC phosphate transporter, inner membrane subunit PstA [Roseovarius
           sp. TM1035]
 gi|149143860|gb|EDM31894.1| ABC phosphate transporter, inner membrane subunit PstA [Roseovarius
           sp. TM1035]
          Length = 450

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 195/425 (45%), Positives = 272/425 (64%), Gaps = 11/425 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R   E  FR   +VAV +  + L+ LL+SI++ G+ +  QT++ L +      +D   
Sbjct: 26  KQRNAKEARFRMMGLVAVTIGVLSLVGLLASILASGLSSFQQTYVELEVYLDPAKLDKNG 85

Query: 72  KRFMDP-AILLRADYNLLVRKALARKLSISD--SNHALLRQASQMLSTTARYHLRKTLMT 128
            R  D  A +    Y  L+  A+   +  +   S+ A  + A +++S  A   LR  ++ 
Sbjct: 86  NRNRDDIAKVSTFGYTPLIEAAMVAAIERTGVTSDVANAKAAGELISKEAPATLRDFVLA 145

Query: 129 DPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
           +P  IG+TV   LLA+  ID   KG   + S A    +S  Q +  Q+L   G L   FN
Sbjct: 146 NPDRIGETVPFDLLAAGRIDGFFKGRVTMESAALDRNVSPEQLQLAQQLKDAGILTTKFN 205

Query: 187 YGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           + FF   + + +RPE AG+GVA++GS YMMLIV+ LS PLG+A++IYLEEF+ K  ++  
Sbjct: 206 WAFFTAPDASDTRPEAAGLGVAIIGSAYMMLIVLVLSLPLGVAASIYLEEFAPKNRWTDL 265

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI+NLA+VPSIV+GILG A+ IN   +P+S  +VGGL+L LMTLP+IIIAT  AL++
Sbjct: 266 IEVNISNLAAVPSIVFGILGLAIFINMVGLPQSAPIVGGLVLTLMTLPTIIIATRAALKS 325

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AALG+GASK+Q +FHHVLPLAMP ILTG+ + LA+ALGETAPLL +GMVAFV 
Sbjct: 326 VPPSIRDAALGVGASKMQAIFHHVLPLAMPGILTGAIIGLAQALGETAPLLLIGMVAFVR 385

Query: 365 DYPVGVT----DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           +YP G      D A A PVQ+Y W    +  FVER  GAI++LL+FL ++N A + LR R
Sbjct: 386 EYPAGPPEGFFDPAAALPVQVYNWTQRGDPAFVERASGAIIVLLVFLVIMNIAAILLRRR 445

Query: 421 FKKRW 425
           F++RW
Sbjct: 446 FERRW 450


>gi|159044084|ref|YP_001532878.1| phosphate transport system permease [Dinoroseobacter shibae DFL 12]
 gi|157911844|gb|ABV93277.1| phosphate transport system permease protein [Dinoroseobacter shibae
           DFL 12]
          Length = 450

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 195/437 (44%), Positives = 280/437 (64%), Gaps = 17/437 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S  +       R  +E  F+ Y + AV+   + L+LLL+SI+S G+ A  QT+++L I  
Sbjct: 17  SLLVQDARTAKRNAAEARFKMYGLAAVITGILALVLLLASILSNGLSAFQQTYVTLEIAL 76

Query: 63  SETIVDPQKKRFMDPAILLRA----DYNLLVRKALARKLSIS--DSNHALLRQASQMLST 116
            E  +D    R ++   ++R      Y  L+  A+  KL+ +  +      + A  ++S 
Sbjct: 77  PEDKLDKSGTRDLE---VMRKVSTFGYAPLIATAMEAKLAEAGIEIEGLTAKDAGAIISK 133

Query: 117 TARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQK 174
            A   LR  ++ +P ++G T    LLA+  ID  LKG   + S +    +S  Q +    
Sbjct: 134 DAPAQLRDFVLANPQVVGTTQTFELLANGRIDGYLKGRVSMESASLDKNVSPAQLQLTDA 193

Query: 175 LDSDGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL 232
           L  +GAL   FN+GFF N  +S  RPE AG+GVA++GSLYMM+IV+ L+ P+G+A++IYL
Sbjct: 194 LLEEGALEKRFNWGFFTNPDASGQRPEAAGLGVAIMGSLYMMMIVLCLALPIGVAASIYL 253

Query: 233 EEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLP 292
           EEF+ K   +  ++ NI+NLA+VPSIV+GILG A+ INF  +P+S  +VGGL+L LMTLP
Sbjct: 254 EEFAPKNRLTDLIEVNISNLAAVPSIVFGILGLAIFINFAGLPQSAPIVGGLVLTLMTLP 313

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
           +III+T  +L++VP SIR AALG+GASK+Q VFH+VLPLA P ILTG+ + LA+ALGETA
Sbjct: 314 TIIISTRASLKSVPPSIRDAALGVGASKMQAVFHNVLPLAAPGILTGTIIGLAQALGETA 373

Query: 353 PLLFVGMVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           PLL +GMVAFV +YP     G  D A+A PVQIY W   ++  FVER  GAI++LL+FL 
Sbjct: 374 PLLLIGMVAFVREYPAAPPEGFFDPASALPVQIYNWTQRSDPAFVERASGAIIVLLVFLL 433

Query: 409 VINTAMLWLRNRFKKRW 425
           ++N   + LR RF++RW
Sbjct: 434 IMNAVAILLRRRFERRW 450


>gi|294679017|ref|YP_003579632.1| phosphate ABC transporter permease PstA [Rhodobacter capsulatus SB
           1003]
 gi|294477837|gb|ADE87225.1| phosphate ABC transporter, permease protein PstA [Rhodobacter
           capsulatus SB 1003]
          Length = 443

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 204/426 (47%), Positives = 280/426 (65%), Gaps = 14/426 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  FR Y + AV++  + L++LLSS++  G+GA  QT +SLPI      +DP+ 
Sbjct: 20  KARNAAEKRFRIYGITAVVIGLLALVVLLSSVLGSGLGAFRQTVLSLPITLDAKALDPKG 79

Query: 72  KRFMDPAILLRAD---YNLLVRKALARKLSISDSNHALLRQA-SQMLSTTARYHLRKTLM 127
            R  DPA + +A    Y  L+ KAL   ++  +    +  +A  +++S  A   LR  ++
Sbjct: 80  NR--DPAEMAKATTVTYGKLITKALEAVVTEKNLAPGMKTKAIGELISKEAPAGLRDLVL 137

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
            DP L+G T+   +LAS  +D   KG   + S A    ++  Q +  +KL   G L L F
Sbjct: 138 ADPELVGTTITYDVLASGRVDGFFKGRVTMESAALDSNITPEQLQLAEKLRDAGLLKLAF 197

Query: 186 NYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           N GF  N  +S  RPE AG+GVA++GS+YMM++V+ L+ P+G+A++IYLEEF+ K  F+ 
Sbjct: 198 NTGFLTNPDASELRPESAGLGVAILGSIYMMVLVLCLALPIGVAASIYLEEFAPKNRFTD 257

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ N+ NLA+VPSIVYGILG A  INF  MP+S+ LVG L+L LMTLP III T  AL 
Sbjct: 258 LIEVNVANLAAVPSIVYGILGLAAFINFAGMPQSSPLVGALVLTLMTLPRIIIPTRAALN 317

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP SIR AALG+GASK QT+FHHVLPLA+P ILTG+ + LA+ALGETAPLL +GMVAFV
Sbjct: 318 AVPPSIREAALGVGASKTQTIFHHVLPLAVPGILTGAIIGLAQALGETAPLLLIGMVAFV 377

Query: 364 TDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
            DYP     G+ D A+A PVQIY W   A+  FVER  GAI++LLIFL ++N+  + LR 
Sbjct: 378 KDYPAAPPEGILDPASAIPVQIYNWTQRADPAFVERASGAIIVLLIFLLMMNSLAVILRR 437

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 438 KFERRW 443


>gi|197103970|ref|YP_002129347.1| putative phosphate transport system permease ABC transporter
           protein [Phenylobacterium zucineum HLK1]
 gi|196477390|gb|ACG76918.1| putative phosphate transport system permease ABC transporter
           protein [Phenylobacterium zucineum HLK1]
          Length = 433

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 196/408 (48%), Positives = 264/408 (64%), Gaps = 15/408 (3%)

Query: 23  FYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLR 82
           +Y  +A++    FL +LL  IV++G  A     IS+P+      VDP +   +DPA  + 
Sbjct: 36  WYGRLAIIAALSFLAVLLGRIVTQGYTAFLDYRISVPV-----YVDPAR---VDPADPMG 87

Query: 83  ADYNLLVRKA-LARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSL 141
           A+Y+LLV  A LAR     D+   L  +A Q+LST   + L   +  DP ++G+TV V  
Sbjct: 88  ANYDLLVADAVLARLGEQDDARGTLSGKAMQLLSTDLGFQLLDKVRADPGVVGQTVTVE- 146

Query: 142 LASANIDSAL--KGYLYSP--ANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSR 197
             S   D+ L  KG + +       ++ D Q  W  +L   G +   FN GF     S+ 
Sbjct: 147 -GSVRADAGLYYKGAVDAELAQEDRKLDDQQIAWLDRLQDQGLVSSGFNTGFLTRSDSTE 205

Query: 198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPS 257
           PE AG+  AVVGS  M+L+   LS P+G+ +A+YLEEFS K  ++S ++ NINNLA+VPS
Sbjct: 206 PEQAGVLGAVVGSAMMLLVTALLSVPIGVLAAVYLEEFSPKNRWTSVIEVNINNLAAVPS 265

Query: 258 IVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLG 317
           IVYG+LG AV IN+  +PRS+ LVGGL+LALM+LP++IIAT  AL+ VP SIR AALG+G
Sbjct: 266 IVYGLLGLAVFINWLAVPRSSPLVGGLVLALMSLPTVIIATRSALKAVPPSIREAALGVG 325

Query: 318 ASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAF 377
           ASK QTVFHHVLPLAMP ++TGS +SLA ALGETAPLL VGMV+FV   P G TD AT  
Sbjct: 326 ASKTQTVFHHVLPLAMPGVMTGSILSLAHALGETAPLLMVGMVSFVPGVPAGFTDAATVL 385

Query: 378 PVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           PVQ+++W   +ER F ERT  AI++LL+F+ V+N   + LR RF++RW
Sbjct: 386 PVQVFIWENASERAFHERTAAAIIVLLVFMIVMNLVAIVLRRRFERRW 433


>gi|224367299|ref|YP_002601462.1| PstA1 [Desulfobacterium autotrophicum HRM2]
 gi|223690015|gb|ACN13298.1| PstA1 [Desulfobacterium autotrophicum HRM2]
          Length = 425

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 273/426 (64%), Gaps = 11/426 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++  I  + L+ RY +E  FR Y + A+++  + L +L  SIV+ G  A  QT+I++   
Sbjct: 9   RTMDIVNQGLEKRYGAEKRFRRYGLCAIILSLLCLGVLFVSIVANGYTAFQQTYINI--- 65

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
             +  +DP +   +D + L  ADY  +V+K+L R++          ++   M+S+ A Y 
Sbjct: 66  --DVFLDPGE---IDESNLATADYQGMVKKSL-REMFPQVKERREKKKLYSMVSSGASYD 119

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           L   +   P  IG T+ + + A  + D  +KG++    P    R++D Q  W   L    
Sbjct: 120 LLNYVRKHPEGIGGTISLWVPADDDTDMFMKGHIRRDVPEGDRRLNDAQITWIDTLVEKN 179

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN  FF  G S  PE+AGI  A  GS + +L+ + LSFP+G+ASA+YLEEF+   
Sbjct: 180 RIKKRFNKTFFTAGDSREPELAGIWGAACGSFFTLLVTLILSFPIGVASAVYLEEFAPTN 239

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++ F++ NINNLA+VPSIV+G+LG AV +NFF +PRS+ +VGG +L LMTLP+IIIA  
Sbjct: 240 RWTDFIEVNINNLAAVPSIVFGLLGLAVFLNFFGLPRSSPMVGGFVLTLMTLPTIIIAGR 299

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L++VP SIR AALG+GASK+Q V HHVLPLAMP +LTG+ + +A+ALGETAPLL +GM
Sbjct: 300 ASLKSVPPSIREAALGVGASKIQMVTHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGM 359

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P G +D +T  PVQI+LWA   ER F+ERT  AI++LL+FL  +N A + LR 
Sbjct: 360 VAFIVDIPGGFSDPSTVLPVQIFLWADSPERAFLERTSAAIMVLLLFLITMNAAAVILRK 419

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 420 KFERRW 425


>gi|209966523|ref|YP_002299438.1| phosphate ABC transporter, permease protein PstA, putative
           [Rhodospirillum centenum SW]
 gi|209959989|gb|ACJ00626.1| phosphate ABC transporter, permease protein PstA, putative
           [Rhodospirillum centenum SW]
          Length = 437

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 193/420 (45%), Positives = 276/420 (65%), Gaps = 5/420 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K L+ RY +E  F+ Y +VA+ V  + L++LL +I+  G+GA  QT I L +      +
Sbjct: 21  EKRLRRRYAAERRFKAYGIVAIAVACLMLVVLLYTILHNGVGAFTQTAIRLEVTLDAKTI 80

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP  K   +PA   RA +  LV+ AL R+     S     R    ++S  A   L + ++
Sbjct: 81  DP--KGTGNPADWDRAAFQDLVQDALYREFP-DVSGRVPKRALRGLISPVAGVFLYREVL 137

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
            DP+++G+T E  L AS +I+   KG +    P +   +SD Q  W  +L   G     F
Sbjct: 138 EDPAMVGQTREFWLPASDDINQIRKGRIDRTLPESSRPVSDEQLAWLDRLVEQGKATSVF 197

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  FF    S+ PE+AGI  AVVGSLY++++ + L+ P+G+A+A+Y+EEF+ K  F+  +
Sbjct: 198 NSTFFTASDSNYPELAGIRGAVVGSLYLLIVTVLLALPIGVATAVYMEEFAPKNSFTDLI 257

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+LG AV + FF +PRS  LVGG+++ALM+LP+IIIA   AL+ V
Sbjct: 258 EVNINNLAAVPSIVFGLLGLAVFLGFFGLPRSAPLVGGMVIALMSLPTIIIAARAALKAV 317

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AALG+GAS++QTV HHVLPLAMP ILTG+ ++LA+ALGETAPLL VGM AFVT+
Sbjct: 318 PPSIREAALGMGASRLQTVMHHVLPLAMPGILTGTIIALAQALGETAPLLMVGMNAFVTE 377

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P G+   ++  PVQ+Y+WA   ER FVE T  AI++LL FL ++N A ++LR +F++RW
Sbjct: 378 PPSGLLSSSSVLPVQVYIWADAPERGFVELTSAAIMVLLAFLIMMNGAAIYLRKKFERRW 437


>gi|226952526|ref|ZP_03822990.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. ATCC 27244]
 gi|294649821|ref|ZP_06727223.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Acinetobacter haemolyticus ATCC 19194]
 gi|226836753|gb|EEH69136.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. ATCC 27244]
 gi|292824304|gb|EFF83105.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 465

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 193/440 (43%), Positives = 277/440 (62%), Gaps = 28/440 (6%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FRF    AV++   F+ LL  SI+SKG+ A WQ  I++P+ F   I+
Sbjct: 32  QKSLAKRHRKEKTFRFLGFSAVMLGLAFVALLFVSILSKGLPAFWQNTITIPVYFDPAII 91

Query: 68  D----PQKKRFMDPAILLR-----------ADYNLLVRKALARKLSISDSNHALLRQASQ 112
           D    P+++    PA               AD++ L+  A+ +K      + A+  Q  +
Sbjct: 92  DAGAPPKRQAGETPARFQERYVEWQTQMGMADWDALITNAIVKK------DPAVAPQRDE 145

Query: 113 ML---STTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDY 167
           ++   +++  Y LR  +  +PSLIGKT ++ +LA ANID  L G +    P    ++S  
Sbjct: 146 LIGIYTSSESYRLRDMVFANPSLIGKTQDIKILADANIDVWLAGNIDRSLPDEQQQLSPE 205

Query: 168 QWKWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGI 226
             +   +L +DG +   FN  FF+N  S S P  +G+  A +GSL+MMLIVI +S P+G+
Sbjct: 206 LRQLADQLKADGVIKNTFNTDFFVNPDSRSSPATSGLAGAFMGSLFMMLIVILISIPIGV 265

Query: 227 ASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLIL 286
           ASA+YLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L
Sbjct: 266 ASAVYLEEFAPKNVMTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPISAPLVGGLVL 325

Query: 287 ALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR 346
           +LMTLP++II T  +L+ VP SIR AALGLGAS+VQTVFHHVLPLA+P ILTG+ + +A+
Sbjct: 326 SLMTLPTVIITTRASLKAVPPSIRQAALGLGASRVQTVFHHVLPLALPGILTGAIIGVAQ 385

Query: 347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLI 405
           ALGETAPLL +GM AFV   P    D +TA PVQI+LW  +  R F E RT  AI++LL 
Sbjct: 386 ALGETAPLLLIGMSAFVASVPASPLDQSTALPVQIFLWQGNELRNFFEGRTAAAIIVLLA 445

Query: 406 FLAVINTAMLWLRNRFKKRW 425
            +  +N+  +WLR +F+ RW
Sbjct: 446 LMIGLNSLAIWLRKKFEVRW 465


>gi|51245734|ref|YP_065618.1| phosphate ABC transporter, permease protein (PstA) [Desulfotalea
           psychrophila LSv54]
 gi|50876771|emb|CAG36611.1| probable phosphate ABC transporter, permease protein (PstA)
           [Desulfotalea psychrophila LSv54]
          Length = 420

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 184/422 (43%), Positives = 269/422 (63%), Gaps = 13/422 (3%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
           N   L+ RY  +  FR   V A+ V   F+  L S I + G  A  QT I L +E     
Sbjct: 9   NSAKLQSRYRKDRCFRLAGVSAIAVALCFIAFLFSDIFTHGYKAFEQTKIELEVELRPAD 68

Query: 67  VDPQKKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKT 125
              +  R  + PA++ R+ Y      AL  +++      +L R    ++S  A + ++  
Sbjct: 69  FVGENLRLANYPAMVKRSLY------ALFPEVTDRQDKKSLYR----LISPGASFEIQDK 118

Query: 126 LMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFL 183
           ++ DP++IG  ++  + A+ ++D  +KG +    P    R++D Q  W   L ++  + +
Sbjct: 119 VLADPAIIGSRLKFWVPANDDVDMLMKGEIDRSLPQANRRVNDQQLAWIDSLVANNKIEM 178

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
            FN  FF  G S  PE+AGI  A  GS Y +LI + LSFP+G+A+AIYLEEF+    ++ 
Sbjct: 179 VFNTTFFTAGDSREPELAGILGAACGSFYTLLITLCLSFPIGVATAIYLEEFAPSNRWTD 238

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NINNLA+VPSI++G+LG AV IN + +PRST LVGGL+L+LMTLP+IIIA+  +L+
Sbjct: 239 LIEVNINNLAAVPSIIFGLLGLAVFINIWGIPRSTPLVGGLVLSLMTLPTIIIASRASLK 298

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP SIR AALG+GASK+QT+ HHVLPLAMP +LTG+ + +A+ALGETAPLL +GM+AF+
Sbjct: 299 SVPPSIREAALGVGASKMQTITHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGMIAFI 358

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            D P G+TD +T  PVQIYLWA   ER F E+T  AI++LL+FL  +N A ++LR +F+ 
Sbjct: 359 VDIPGGITDPSTVLPVQIYLWADSPERAFSEKTSAAIMILLLFLISMNAAAVFLRKKFET 418

Query: 424 RW 425
           +W
Sbjct: 419 KW 420


>gi|90415569|ref|ZP_01223503.1| phosphate ABC transporter, permease protein [marine gamma
           proteobacterium HTCC2207]
 gi|90332892|gb|EAS48062.1| phosphate ABC transporter, permease protein [marine gamma
           proteobacterium HTCC2207]
          Length = 430

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 185/418 (44%), Positives = 274/418 (65%), Gaps = 3/418 (0%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R  SE LFR+Y  +A+ +    + +L + IVSKG GA    ++ L + + + ++
Sbjct: 16  RKSLSRRNRSERLFRWYGRLAIFIGLAAVTVLFTDIVSKGHGAFRIAYLQLEVGYDQDLI 75

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                   DP  L+  ++  + ++AL ++     +  +  R+   ++S  + + L+  L+
Sbjct: 76  GVDN--LTDPEQLILGNWQAVPKQALRQQFP-DVAGRSDKRKLYGLVSNGSGFDLKDRLL 132

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            +P L+G    V +LA  +ID+  K +L       R+SD Q KW  +L   G + L FN 
Sbjct: 133 ANPLLLGTRETVWVLADDDIDTYYKSWLDGEPYAARLSDKQVKWIGELHDQGKIRLQFNS 192

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
             F  G S  PE AGI  AV+GSL+ +L+ + LSFP+G+A+AIYLEEF+ K  ++ F++ 
Sbjct: 193 NLFTRGDSREPEQAGIRGAVMGSLFTLLLTLMLSFPVGVAAAIYLEEFAPKNGWTDFIEV 252

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSI++G+LG A+ INFF +PRS  +VGGL+L LMTLP+III +  A+++VP 
Sbjct: 253 NINNLAAVPSIIFGLLGLAIFINFFHVPRSVPIVGGLVLTLMTLPTIIITSRAAIKSVPP 312

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALG+GASK Q V HHVLPLA+P +LTG+ + +A+ALGE+APLL +GMVAF+ D P
Sbjct: 313 SIREAALGMGASKYQMVMHHVLPLALPGMLTGAIIGMAQALGESAPLLMIGMVAFIVDIP 372

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            G  D AT  PVQI+LWA   ER F+E+T  AI++LL FL V+NT+ +W+R R ++RW
Sbjct: 373 AGFNDPATVLPVQIFLWADSPERAFIEKTSAAIMVLLSFLIVMNTSAVWVRKRLERRW 430


>gi|84684962|ref|ZP_01012862.1| phosphate ABC transporter, permease protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667297|gb|EAQ13767.1| phosphate ABC transporter, permease protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 443

 Score =  348 bits (894), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 192/429 (44%), Positives = 280/429 (65%), Gaps = 18/429 (4%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  FR Y ++A+ +  VFL+ LLS+IV +GI A  QT ++LPI   E  +D   
Sbjct: 18  KKRNAAEKRFRIYGMIAIGLGLVFLVALLSTIVVRGIPAFQQTKLTLPIALPEETLDKSG 77

Query: 72  KRFMDPAILLRAD---YNLLVRKALARKLSISDSNHAL--LRQASQMLSTTARYHLRKTL 126
            R  D  ++ +     YN L+ +ALA  L  +   +     +    +LS++A   +R  +
Sbjct: 78  VR--DIEVMKKVSTFGYNPLIEQALADALDANGIENPFEDAKGLKPILSSSAAAVVRDEV 135

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDS---DGALFL 183
           + +P L+G T    +LA++ +D  LKG + +  +V R ++     F  +D+    G +  
Sbjct: 136 LANPELVGTTHTFEILAASRVDGYLKGRV-TRESVARDNNIDAAHFDVVDALRDAGIIAK 194

Query: 184 DFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            FN+ F    + + SRPE AGIGV+++GSL+MM +V+GLS P+G+A++IYLEEF+ +  F
Sbjct: 195 GFNFDFITGADASESRPEQAGIGVSMLGSLFMMFVVLGLSLPIGVAASIYLEEFATQNRF 254

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+T  +
Sbjct: 255 TDIIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIISTRAS 314

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+ VP SIR AALG+GASK+QTVFHHVLPLAMP ILTG+ + LA+ALGETAPLL +GMV 
Sbjct: 315 LKAVPPSIREAALGIGASKMQTVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMVG 374

Query: 362 FV-TDYPVGVT----DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           ++ ++YP GV     D  +A P QIY WA  A+  + ER +G I++LL+FL  +N   + 
Sbjct: 375 YIASNYPDGVASGFLDPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLMTMNILAVI 434

Query: 417 LRNRFKKRW 425
           LR RF++RW
Sbjct: 435 LRRRFERRW 443


>gi|260430661|ref|ZP_05784633.1| phosphate ABC transporter, permease protein PstA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418102|gb|EEX11360.1| phosphate ABC transporter, permease protein PstA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 434

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 187/421 (44%), Positives = 267/421 (63%), Gaps = 11/421 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           + +L  R   + L +   + A+   F+ L +L++S+VS G  A  QT I+L     E  V
Sbjct: 22  RASLTRRNRKQKLLQGLGLGAIGFAFLMLFILVASLVSSGYQAFTQTKITL-----EVYV 76

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQA-SQMLSTTARYHLRKTL 126
           DP++   + P  L R  +  +++ +L+  L   D++    R+A + +LS  A++ LR  +
Sbjct: 77  DPEE---IKPEKLPRGGFKDVLQASLSELLPEVDTSDRATRKALAGILSNGAQFDLRDRV 133

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLD 184
           + DPSLIG+T+ +++  S   D   KG +   +P    R+ D++  WF +L + G +   
Sbjct: 134 VADPSLIGQTITLTVPVSDPYDQLNKGTIDRDTPEQNRRLKDHEIAWFDQLKAKGVISKP 193

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N G   N  S  PE+AG+  A++GS + + +   +SFPLGI +AIYLEEF+ +   S F
Sbjct: 194 LNTGLITNADSRFPELAGLKGALIGSFWALFVCFAISFPLGIGAAIYLEEFAPRNKISDF 253

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPS+V+G+L  AV I +F +PRS   VGGL LALMT+P+IIIAT  AL+ 
Sbjct: 254 IEVNINNLAAVPSVVFGLLALAVFIGWFGLPRSAPFVGGLTLALMTMPTIIIATRAALKA 313

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AALG+GASK Q VF HVLPLAMP ILTG+ + LA+ALGETAPLL +GM AF+T
Sbjct: 314 VPPSIREAALGIGASKHQVVFGHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMNAFIT 373

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G  D ATA P QI++WA   ER FV RT  AIL+LL FL  +N   ++LRN+F++ 
Sbjct: 374 SAPDGPFDSATALPTQIFIWADSPERGFVSRTSAAILVLLGFLVTMNAIAIYLRNKFERS 433

Query: 425 W 425
           W
Sbjct: 434 W 434


>gi|167648504|ref|YP_001686167.1| phosphate ABC transporter inner membrane subunit PstA [Caulobacter
           sp. K31]
 gi|167350934|gb|ABZ73669.1| phosphate ABC transporter, inner membrane subunit PstA [Caulobacter
           sp. K31]
          Length = 433

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 274/428 (64%), Gaps = 15/428 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           + S  +  LK R+ SE  FR   + A+++  +FL++L+  IV++G        +++P+  
Sbjct: 16  ALSAREALLKKRHRSETWFRVQGIAAIVIAMIFLVMLVGRIVAQGYSTFETHTLTVPV-- 73

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR--- 119
               ++P++   +D   L   +Y+ +V +A+ +KL + D +  L   + +++  T+R   
Sbjct: 74  ---YLNPER---IDTTALEGVNYDYIVAEAMMKKLGVQDDD--LGTTSGKIMDLTSRDFG 125

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDS 177
             L + +  D SLIGKTV V+    A+ D   KG +   +     ++ + Q  W  KL +
Sbjct: 126 SQLLQMIKKDRSLIGKTVNVTGSVKADADLYYKGEIQRSTAEGDRKLDNQQLDWLDKLKN 185

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           +G +   FN  FF N  S+ PE AG+  AV+GS  M++I   ++ P+G+ +A+YLEEF+ 
Sbjct: 186 EGTVKTGFNIKFFTNSDSTEPEQAGVWGAVIGSAMMLIITATIAIPVGVMAAVYLEEFAP 245

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K  ++  ++ NINNLA+VPSIVYG+LG A+ IN+  +PR + LVGGL++ALM LP++IIA
Sbjct: 246 KNRWTDVIEVNINNLAAVPSIVYGLLGLALFINWLHVPRGSPLVGGLVMALMALPTVIIA 305

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  +L+ VP SIR AALG+GASK QTVFHHVLPLAMP ++TG+ +SLA ALGETAPLL +
Sbjct: 306 TRSSLKAVPPSIREAALGVGASKAQTVFHHVLPLAMPGVMTGAILSLAHALGETAPLLMI 365

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAFV   P   T  AT  PVQ+++W   +ER F ERT  AI++LL+F+ V+N A + L
Sbjct: 366 GMVAFVPGAPESFTSSATVLPVQVFIWENASERAFHERTAAAIIVLLVFMIVMNAAAVIL 425

Query: 418 RNRFKKRW 425
           R RF++RW
Sbjct: 426 RRRFERRW 433


>gi|260574721|ref|ZP_05842724.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sp. SW2]
 gi|259023138|gb|EEW26431.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sp. SW2]
          Length = 430

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 193/420 (45%), Positives = 267/420 (63%), Gaps = 12/420 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           + NL+ R+  E   +   + A+ + F+ L +L+ S+VS G  A  QTH++  I F    +
Sbjct: 21  RANLRRRHRRETGLKSLGMAAIAIAFLMLAILVGSLVSTGWQAFTQTHVT--ITFP---I 75

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP K +   P      +Y  LV+ A+   L   D   A  ++ ++++S +A++ LR  ++
Sbjct: 76  DPAKVKAEKPE---AGNYRALVQAAMVAALP--DVPAAQAKKLAEIVSNSAQFTLRDRVV 130

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
            D  LIG+++ +++ AS   D   KG +   +PA   R+SD Q   F  L +DG +   F
Sbjct: 131 ADTGLIGQSITLTVPASDPYDQLNKGLIDRATPAANRRLSDEQVAAFDALAADGRISKPF 190

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+  F N  S  PE+AG+  A+VGS Y +L    L+FPLGI SAIYLEEF+ K   S F+
Sbjct: 191 NWALFTNADSRFPELAGLTGALVGSFYALLTCFVLAFPLGIGSAIYLEEFAPKNRISDFI 250

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+L  AV +N F +PRS  +VGGL LALMTLP+IIIAT  AL+ V
Sbjct: 251 EININNLAAVPSIVFGLLALAVFLNGFGLPRSAPIVGGLTLALMTLPTIIIATRAALKAV 310

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AALG+GAS+ Q VFHHVLPLAMP +LTG+ + LARALGE APLL +GM AF+T 
Sbjct: 311 PPSIREAALGIGASRQQVVFHHVLPLAMPGVLTGTILGLARALGEAAPLLLIGMNAFITA 370

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P    D ATA P QI +WA   ER FV RT  A+L+LL FL ++N   ++LR RF+++W
Sbjct: 371 APGSPFDPATALPTQILIWADSTERGFVSRTSAAVLVLLGFLLIMNAVAIYLRARFERKW 430


>gi|85703114|ref|ZP_01034218.1| ABC phosphate transporter, inner membrane subunit PstA [Roseovarius
           sp. 217]
 gi|85672042|gb|EAQ26899.1| ABC phosphate transporter, inner membrane subunit PstA [Roseovarius
           sp. 217]
          Length = 449

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 192/429 (44%), Positives = 273/429 (63%), Gaps = 20/429 (4%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R   E  FR   +VAV +  + L+ LL+SI++ G+ +  QT+I L +      +D   
Sbjct: 26  KQRNAKEARFRMMGLVAVTIGLLSLVGLLTSILASGLSSFQQTYIELEVYLDPAKLDKTG 85

Query: 72  KRFMDPAILLRAD---YNLLVRKALA----RKLSISDSNHALLRQASQMLSTTARYHLRK 124
            R  +P  + +     Y  L+  A+     R  + +D N    + A +++S  A   LR 
Sbjct: 86  NR--NPEDIAKVSTFGYAPLIDAAMGAAIERVGAATDINA---KAAGELISKEAPASLRD 140

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALF 182
            ++ +   IG+TV+  LLA+  ID   KG   + + A    +S  Q +   +L   G L 
Sbjct: 141 FVLANIDRIGETVQFDLLAAGRIDGFFKGRVTMETAALDRNISPEQLQLADQLKEAGILT 200

Query: 183 LDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
             FN+ FF   + + +RPE AG+GVA++GS+YMMLIV+ L+ PLG+A++IYLEEF+ K  
Sbjct: 201 TKFNWAFFTAPDASDTRPEAAGLGVAIIGSIYMMLIVLVLALPLGVAASIYLEEFAPKNR 260

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           ++  ++ NI+NLA+VPSIV+GILG A+ IN   +P+S  +VGGL+L LMTLP+IIIAT  
Sbjct: 261 WTDLIEVNISNLAAVPSIVFGILGLAIFINMVGLPQSAPIVGGLVLTLMTLPTIIIATRA 320

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           AL++VP SIR AALG+GASK+Q +FHHVLPLAMP ILTG+ + LA+ALGETAPLL +GMV
Sbjct: 321 ALKSVPPSIRDAALGVGASKMQAIFHHVLPLAMPGILTGAIIGLAQALGETAPLLLIGMV 380

Query: 361 AFVTDYPVGVT----DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           AFV +YP G      D A A PVQ+Y W    +  FVER  GAI++LL+FL ++N A + 
Sbjct: 381 AFVREYPGGPPEGFFDPAAALPVQVYNWTQRGDPAFVERASGAIIVLLVFLVLMNIAAIL 440

Query: 417 LRNRFKKRW 425
           LR RF++RW
Sbjct: 441 LRRRFERRW 449


>gi|329890387|ref|ZP_08268730.1| phosphate ABC transporter, permease protein PstA [Brevundimonas
           diminuta ATCC 11568]
 gi|328845688|gb|EGF95252.1| phosphate ABC transporter, permease protein PstA [Brevundimonas
           diminuta ATCC 11568]
          Length = 431

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 182/428 (42%), Positives = 269/428 (62%), Gaps = 25/428 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           K  L+ RY  E  FR+Y   A+ V   FL++LL SIV++G  A +   ++LP+       
Sbjct: 19  KSRLRARYARETRFRWYGRAAIGVALAFLVILLGSIVTQGYTAFYAHTVTLPV------- 71

Query: 68  DPQKKRFMDPAILLR-----ADYNLLVRKALARKLSISDSNHALLRQASQM---LSTTAR 119
                 +MDPA + R     A++  +V +   R+L I D       +AS M   LS+  +
Sbjct: 72  ------YMDPARIDRSYPQGANFEQIVAEQQIRRLGIQDDAQGT--KASTMKALLSSELK 123

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDS 177
           +   K +   PSL+G+TV V+   S + +  LKG +    P +  R+++ Q  W  ++ +
Sbjct: 124 FQAAKMIARQPSLLGQTVPVAAPLSDDAEMYLKGKITRDQPEDQRRVTNEQMDWLDRMKA 183

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            GA+   FN   F  G S++PE+AG+  AVVGS  M+++   ++ P+G+ +A++LEE+S 
Sbjct: 184 SGAVRAHFNSALFTKGDSTQPELAGLLGAVVGSALMLMVTALIAIPVGVGAAVWLEEYSP 243

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           +   ++ ++ NINNLA+VPSIVYG+LG A+ INF  +PR++ LVGGL+LALM LP+IIIA
Sbjct: 244 RNRITAIIEVNINNLAAVPSIVYGLLGLALFINFMHLPRASPLVGGLVLALMALPTIIIA 303

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  +L+ VP SIR AAL +GAS+ QTVF HVLPLAMP ++TG+ +S+A ALGETAPLL +
Sbjct: 304 TRSSLKAVPPSIREAALAMGASRTQTVFGHVLPLAMPGVMTGAIISMAHALGETAPLLLI 363

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GM++FV   P  + +   A P  IY+W   +ER F ERT  AIL+LL F+ V+N A + L
Sbjct: 364 GMISFVPGVPHAIDEPVGALPSLIYIWENASERAFHERTAAAILVLLAFMIVMNAAAVLL 423

Query: 418 RNRFKKRW 425
           R RF++RW
Sbjct: 424 RRRFERRW 431


>gi|50084403|ref|YP_045913.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. ADP1]
 gi|49530379|emb|CAG68091.1| high-affinity phosphate transport protein (ABC superfamily,
           membrane) [Acinetobacter sp. ADP1]
          Length = 465

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 190/437 (43%), Positives = 275/437 (62%), Gaps = 22/437 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FR +   AV++   F+ LL  SI+ KG+ A WQT +++P+ F  TI+
Sbjct: 32  EKSLASRHRKEKTFRIFGFSAVVLGLFFVALLFGSILVKGLPAFWQTSLTVPVYFDPTII 91

Query: 68  D--PQ------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQASQ 112
           +  P+            ++R++D    +   D++ L+   + +K     S    L   S 
Sbjct: 92  NAGPKPTQAAGESPAHFQERYVDWQTKMGMVDWDSLIVNGMIKKDPALASKRDDL---SS 148

Query: 113 MLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWK 170
           + +++  Y LR  +  DPSL+GK  ++  LA AN+D  L G +    P +  ++S    K
Sbjct: 149 LYTSSEAYRLRDMVFKDPSLVGKREDIKFLADANVDVWLTGKIDRSLPDDQQQLSPEVRK 208

Query: 171 WFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
              +L++ G L   FN   F N  S S P  +G+  A +GSL+MMLIVI +S P+G+ASA
Sbjct: 209 LADQLEAKGMLTHSFNTNLFTNPDSRSSPATSGLAGAFMGSLFMMLIVIFISIPIGVASA 268

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM 289
           IYLEEF+ +   +  ++ NINNLA+VPSIV+G+LG+A+ IN+ ++P S  LVGGL+L+LM
Sbjct: 269 IYLEEFAKQNILTDVIEVNINNLAAVPSIVFGLLGAAIFINWMQLPLSAPLVGGLVLSLM 328

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P ILTG+ + +A+ALG
Sbjct: 329 TLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGILTGAIIGVAQALG 388

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLA 408
           ETAPLL +GM AFV   P    D +TA PVQI+LW  +  R F E RT  AI++LL  + 
Sbjct: 389 ETAPLLLIGMSAFVASIPTSPLDQSTALPVQIFLWQGNELRNFFEARTSAAIIVLLAMMI 448

Query: 409 VINTAMLWLRNRFKKRW 425
            +N+  +WLR +F+ RW
Sbjct: 449 GLNSLAIWLRKKFEVRW 465


>gi|83942437|ref|ZP_00954898.1| phosphate ABC transporter, permease protein [Sulfitobacter sp.
           EE-36]
 gi|83846530|gb|EAP84406.1| phosphate ABC transporter, permease protein [Sulfitobacter sp.
           EE-36]
          Length = 446

 Score =  342 bits (877), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 185/423 (43%), Positives = 269/423 (63%), Gaps = 11/423 (2%)

Query: 14  RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKR 73
           R  +E  F+ Y + A+ V  + L +LL++I+ +G+GA  QT ++L ++  E  +D    R
Sbjct: 24  RNRAEARFKSYGIAAIAVGLLMLAILLTTIIGRGVGAFQQTFLTLNVQLLEEKLDKNGNR 83

Query: 74  FMDPAILLRA-DYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARYHLRKTLMTDPS 131
            +D    +    Y  L+  AL  K++ +     L  +  + +LS  A   LR  ++ +P 
Sbjct: 84  NLDEIKKVSTFGYAPLMAAALEAKVAETGITTDLKPKDMAGILSKDAAAQLRDFVLDNPE 143

Query: 132 LIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNYGF 189
           LIG  VE   L ++ +D  +KG +   S AN   +S  Q      L +DGAL   FN  F
Sbjct: 144 LIGTAVEFKFLTNSRVDGYMKGRVTRDSIANDKSISAEQLDLVDALVADGALEKRFNIDF 203

Query: 190 FI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
               + + +RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 204 ITGADASDARPEAAGMGVSMLGSLFMMLVVLALALPIGVAASIYLEEFAPKNLLTDIIEV 263

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L++VP 
Sbjct: 264 NISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIIISTRASLKSVPP 323

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+   P
Sbjct: 324 SIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIASNP 383

Query: 368 -----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
                 G+ D  +A P QIY WA  A+  F ER +G I++LL+FL  +N   + LR RF+
Sbjct: 384 PDGIASGLMDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITMNAIAVMLRRRFE 443

Query: 423 KRW 425
           +RW
Sbjct: 444 RRW 446


>gi|83953657|ref|ZP_00962378.1| phosphate ABC transporter, permease protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83841602|gb|EAP80771.1| phosphate ABC transporter, permease protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 446

 Score =  342 bits (877), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 186/423 (43%), Positives = 270/423 (63%), Gaps = 11/423 (2%)

Query: 14  RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKR 73
           R  +E  F+ Y + A+ V  + L +LL++I+ +G GA  QT ++L ++  E  +D    R
Sbjct: 24  RNRAEARFKSYGIAAIAVGLLMLAILLTTIIGRGAGAFQQTFLTLNVQLLEQKLDKNGNR 83

Query: 74  FMDPAILLRA-DYNLLVRKALARKLSISDSNHALLRQA-SQMLSTTARYHLRKTLMTDPS 131
            +D    +    Y  L+  AL  K++ +     L  +A + +LS  A   LR  ++ +P 
Sbjct: 84  NLDEIKKVSTFGYAPLMAAALEAKVAEAGITTDLKPKAMAGILSKDAAAQLRDFVLDNPE 143

Query: 132 LIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNYGF 189
           LIG  VE   L ++ +D  +KG +   S AN   ++  Q      L +DGAL   FN  F
Sbjct: 144 LIGTAVEFEFLTNSRVDGYMKGRVTRDSIANDKSINAEQLDLVDALVADGALEKRFNIDF 203

Query: 190 FI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            I  + + +RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 204 IIGADASDARPEAAGMGVSMLGSLFMMLVVLALALPIGVAASIYLEEFAPKNLLTDIIEV 263

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L++VP 
Sbjct: 264 NISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIIISTRASLKSVPP 323

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+   P
Sbjct: 324 SIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIASNP 383

Query: 368 -----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
                 G+ D  +A P QIY WA  A+  F ER +G I++LL+FL  +N   + LR RF+
Sbjct: 384 PDGIASGLMDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITMNAIAVMLRRRFE 443

Query: 423 KRW 425
           +RW
Sbjct: 444 RRW 446


>gi|332558030|ref|ZP_08412352.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides WS8N]
 gi|332275742|gb|EGJ21057.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides WS8N]
          Length = 449

 Score =  342 bits (876), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 194/431 (45%), Positives = 267/431 (61%), Gaps = 23/431 (5%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + AV +  + L++LLSS++  G GA  QT I +P+     IVDP+ 
Sbjct: 25  RRRNAAERRFRAYGLTAVGLSILALVVLLSSVIGNGAGAFRQTFIEIPLTLDAKIVDPKG 84

Query: 72  KRFMDP---------AILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
            R +D             L A     V  A  +   ISD + A       +LS  A   L
Sbjct: 85  NRNIDEMKKVTTIGYGRQLEASMVAAVAAAGLKTEGISDKDIA------GLLSKEAAATL 138

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGA 180
           R  ++ D SL+G+T+    LA+  +D   KG   + S      ++  Q    Q++   G 
Sbjct: 139 RNRVLADTSLVGETITFRALANGRVDGFFKGRVTMESAKLDSNVTPEQLGLAQRMREAGL 198

Query: 181 LFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           + L FN  F +   +S  RPE AG+GVA++GS YMM+IV+ L+ P+G+A++IYLEEF+ K
Sbjct: 199 ITLAFNPDFLLGADASEVRPEAAGLGVAILGSAYMMIIVLVLALPIGVAASIYLEEFAPK 258

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI NLA+VPSIV+GILG A+ IN   +P+S  +VGGLIL LMTLP+IIIAT
Sbjct: 259 NRWTDLIEVNIANLAAVPSIVFGILGLAIFINMMGLPQSAPIVGGLILTLMTLPTIIIAT 318

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
            V+L  VP SIR AALG+GAS++Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL +G
Sbjct: 319 RVSLAAVPPSIRDAALGVGASRMQAVFHHVLPLALPGILTGTIIGMARALGETAPLLLIG 378

Query: 359 MVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           MVAFV +YP     G  D A+A PVQ+Y +   A+  FVER  GAI++LL FL  +N A 
Sbjct: 379 MVAFVREYPAAPPEGFFDPASALPVQVYNFTQRADPAFVERASGAIIVLLAFLICMNAAA 438

Query: 415 LWLRNRFKKRW 425
           + LR RF++RW
Sbjct: 439 IILRRRFERRW 449


>gi|262376069|ref|ZP_06069300.1| phosphate ABC transporter, permease PstA [Acinetobacter lwoffii
           SH145]
 gi|262309163|gb|EEY90295.1| phosphate ABC transporter, permease PstA [Acinetobacter lwoffii
           SH145]
          Length = 463

 Score =  342 bits (876), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 192/437 (43%), Positives = 273/437 (62%), Gaps = 22/437 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           + +L  R+  E  FR +   AVL    F++LL  SI+SKG+ A WQ+ +SLPI F   IV
Sbjct: 30  QSSLARRHRKEKTFRLFGFSAVLAGLFFVVLLFGSILSKGLPAFWQSSMSLPIHFDPAIV 89

Query: 68  D--PQKK--------RFMDPAILLRA-----DYNLLVRKALARKLSISDSNHALLRQASQ 112
           D  P+ K        +F D  I  +      D++ L+   +  K S  +S    L     
Sbjct: 90  DIGPKPKPAAGESPAQFEDRFIAWQTEVGMVDWDALIINGMIAKDSKLESQRDEL---GS 146

Query: 113 MLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWK 170
           + +++  Y LR  +M DPSL+G++ EV +LA AN+D  L G +    P    ++S    +
Sbjct: 147 LYTSSEAYRLRDMVMNDPSLVGQSKEVKILADANVDVWLAGNIDRDLPDEQQQLSPEVRQ 206

Query: 171 WFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
              ++ + G +   FN   F +  S S P  +G+  A +GSL+MM+IVI +S P+G+ASA
Sbjct: 207 VADEMKASGVIENSFNTNIFTSPDSRSSPATSGLAGAFMGSLFMMMIVIFISIPIGVASA 266

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM 289
           IYLEEF+ K + +  V+ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+LM
Sbjct: 267 IYLEEFAPKNWITDVVEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSLM 326

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP++II T  +L+ VP SIR AALGLGAS++QTVFHHVLPLA+P ILTG+ + +A+ALG
Sbjct: 327 TLPTVIITTRASLKAVPPSIRQAALGLGASRIQTVFHHVLPLALPGILTGAIIGVAQALG 386

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLA 408
           ETAPLL +GM AFV   P    D +TA PVQI+LW  +  R F E RT  AI++LL  + 
Sbjct: 387 ETAPLLLIGMSAFVASVPATPFDQSTALPVQIFLWQGNELRNFFEGRTAAAIIVLLAMMI 446

Query: 409 VINTAMLWLRNRFKKRW 425
            +N+  +WLR +F+ RW
Sbjct: 447 SLNSLAIWLRKKFEVRW 463


>gi|146277958|ref|YP_001168117.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145556199|gb|ABP70812.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 449

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 196/431 (45%), Positives = 273/431 (63%), Gaps = 23/431 (5%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + AV++  + L+LLL+S++  G GA  QT I++P+     IVDP+ 
Sbjct: 25  RRRNAAERRFRAYGLGAVILSILALVLLLTSVIGNGAGAFRQTFIAIPVTLDAAIVDPRG 84

Query: 72  KRFMDP---------AILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
            R ++             L A     V  A  +   ISD + A L      LS  A   L
Sbjct: 85  NRDIEEMKKVTTIGYGRQLEASMVAAVAAAGLQSEGISDKDIAGL------LSKEAAAGL 138

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGA 180
           R  ++ DP L+G+TVEV  LA+  +D   KG   + S A    ++  Q    Q+L   G 
Sbjct: 139 RNRVLADPELVGQTVEVRALANGRVDGFFKGRVTMESAALDSNITPEQLVLAQRLREAGL 198

Query: 181 LFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           + + FN  F     +S  RPE AG+GVA++GS YMM IV+ L+ P+G+A++IYLEEF+ K
Sbjct: 199 ITIAFNPQFLFGPDASELRPEAAGLGVAILGSAYMMFIVLVLALPIGVAASIYLEEFAPK 258

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI+NLA+VPSIV+GILG A+ INF  +P+S  +VGGL+L LMTLP+IIIAT
Sbjct: 259 NRWTDLIEVNISNLAAVPSIVFGILGLAIFINFMGLPQSAPIVGGLVLTLMTLPTIIIAT 318

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             +L+ VP SIR AALG+GASK+Q +FHHVLPLAMP ILTG+ + LA+ALGETAPLL +G
Sbjct: 319 RASLKAVPPSIRDAALGVGASKMQAIFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIG 378

Query: 359 MVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           MVAFV ++P     G  D A+A PVQ++ +   A+  FVER  GAI++LL+FL  +NT  
Sbjct: 379 MVAFVREFPAAPPEGFFDPASALPVQVFNFTQRADPAFVERASGAIIVLLVFLVAMNTVA 438

Query: 415 LWLRNRFKKRW 425
           + LR RF++RW
Sbjct: 439 IILRRRFERRW 449


>gi|77463156|ref|YP_352660.1| ABC phosphate transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides 2.4.1]
 gi|126462028|ref|YP_001043142.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides ATCC 17029]
 gi|77387574|gb|ABA78759.1| ABC phosphate transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103692|gb|ABN76370.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 449

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 193/431 (44%), Positives = 267/431 (61%), Gaps = 23/431 (5%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + AV +  + L++LLSS++  G GA  QT I +P+     IVDP+ 
Sbjct: 25  RRRNAAERRFRAYGLTAVGLSILALVVLLSSVIGNGAGAFRQTFIEIPLTLDAKIVDPKG 84

Query: 72  KRFMDP---------AILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
            R +D             L A     V  A  +   ISD + A       +LS  A   L
Sbjct: 85  NRNIDEMKKVTTIGYGRQLEASMVAAVAAAGLKTEGISDKDIA------GLLSKEAAATL 138

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGA 180
           R  ++ D +L+G+T+    LA+  +D   KG   + S      ++  Q    Q++   G 
Sbjct: 139 RNRVLADTALVGETITFRALANGRVDGFFKGRVTMESAKLDSNVTPEQLGLAQRMREAGL 198

Query: 181 LFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           + L FN  F +   +S  RPE AG+GVA++GS YMM+IV+ L+ P+G+A++IYLEEF+ K
Sbjct: 199 ITLAFNPDFLLGADASEVRPEAAGLGVAILGSAYMMIIVLVLALPIGVAASIYLEEFAPK 258

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI NLA+VPSIV+GILG A+ IN   +P+S  +VGGLIL LMTLP+IIIAT
Sbjct: 259 NRWTDLIEVNIANLAAVPSIVFGILGLAIFINMMGLPQSAPIVGGLILTLMTLPTIIIAT 318

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
            V+L  VP SIR AALG+GAS++Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL +G
Sbjct: 319 RVSLAAVPPSIRDAALGVGASRMQAVFHHVLPLALPGILTGTIIGMARALGETAPLLLIG 378

Query: 359 MVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           MVAFV +YP     G  D A+A PVQ+Y +   A+  FVER  GAI++LL FL  +N A 
Sbjct: 379 MVAFVREYPAAPPEGFFDPASALPVQVYNFTQRADPAFVERASGAIIVLLAFLICMNAAA 438

Query: 415 LWLRNRFKKRW 425
           + LR RF++RW
Sbjct: 439 IILRRRFERRW 449


>gi|221639013|ref|YP_002525275.1| phosphate ABC transporter inner membrane subunit PstA [Rhodobacter
           sphaeroides KD131]
 gi|221159794|gb|ACM00774.1| Phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides KD131]
          Length = 449

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 193/431 (44%), Positives = 267/431 (61%), Gaps = 23/431 (5%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + AV +  + L++LLSS++  G GA  QT I +P+     IVDP+ 
Sbjct: 25  RRRNAAERRFRAYGLTAVGLSILALVVLLSSVIGNGAGAFRQTFIEIPLTLDAKIVDPKG 84

Query: 72  KRFMDP---------AILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
            R +D             L A     V  A  +   ISD + A       +LS  A   L
Sbjct: 85  NRNIDEMKKVTTIGYGRQLEASMVAAVAAAGLKTEGISDKDIA------GLLSKEAAATL 138

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGA 180
           R  ++ D +L+G+T+    LA+  +D   KG   + S      ++  Q    Q++   G 
Sbjct: 139 RNRVLADTALVGETITFRALANGRVDGFFKGRVTMESAKLDSNVTPEQLGLAQRMREAGL 198

Query: 181 LFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           + L FN  F +   +S  RPE AG+GVA++GS YMM+IV+ L+ P+G+A++IYLEEF+ K
Sbjct: 199 ITLAFNPDFLLGSDASEVRPEAAGLGVAILGSAYMMIIVLVLALPIGVAASIYLEEFAPK 258

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI NLA+VPSIV+GILG A+ IN   +P+S  +VGGLIL LMTLP+IIIAT
Sbjct: 259 NRWTDLIEVNIANLAAVPSIVFGILGLAIFINMMGLPQSAPIVGGLILTLMTLPTIIIAT 318

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
            V+L  VP SIR AALG+GAS++Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL +G
Sbjct: 319 RVSLAAVPPSIRDAALGVGASRMQAVFHHVLPLALPGILTGTIIGMARALGETAPLLLIG 378

Query: 359 MVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           MVAFV +YP     G  D A+A PVQ+Y +   A+  FVER  GAI++LL FL  +N A 
Sbjct: 379 MVAFVREYPAAPPEGFFDPASALPVQVYNFTQRADPAFVERASGAIIVLLAFLICMNAAA 438

Query: 415 LWLRNRFKKRW 425
           + LR RF++RW
Sbjct: 439 IILRRRFERRW 449


>gi|126737845|ref|ZP_01753575.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           SK209-2-6]
 gi|126721238|gb|EBA17942.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           SK209-2-6]
          Length = 448

 Score =  340 bits (871), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 190/427 (44%), Positives = 273/427 (63%), Gaps = 15/427 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR + + A++V  + LILL+++IVSKG GA  QT I++ +E  E+ +D + 
Sbjct: 24  RKRNAAERRFRAFGIAAIMVGLLMLILLVTTIVSKGTGAFQQTFITVNVELLESKLDKKG 83

Query: 72  KRFMDPAILLRA-DYNLLVR---KALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
            R ++    +    Y  L++   K L   LSI  S  +  +  + +LS +A   LR  ++
Sbjct: 84  NRNIEEIKKVTTFGYAPLLKTAMKDLVADLSIETSLKS--KHLAALLSKSAVAELRAYVI 141

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P  IGKTVE   LA + +D  LKG +   S  N   +S  Q      L + G +   F
Sbjct: 142 ANPDQIGKTVEFRFLAQSRVDGYLKGRVTRESVVNDKNISAEQLDLVDALVAVGTIEKTF 201

Query: 186 NYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           N  F +  + +  RPE AGIGV++ GSL+MM++V+ L+ P+G+A++IYLEEF+ + + + 
Sbjct: 202 NLDFILGSDASDQRPEAAGIGVSMAGSLFMMMVVLALALPIGVAASIYLEEFAPRNWLTD 261

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  AL+
Sbjct: 262 IIEVNIANLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTIIISTRAALK 321

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+
Sbjct: 322 AVPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFI 381

Query: 364 -TDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
            ++ P     G+    +A P QIY WA  A+  F ER +G I++LL+FL  +NT  + LR
Sbjct: 382 ASNAPETIAEGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLVTMNTIAVILR 441

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 442 RRFERRW 448


>gi|254476625|ref|ZP_05090011.1| phosphate transport system permease protein 2 [Ruegeria sp. R11]
 gi|214030868|gb|EEB71703.1| phosphate transport system permease protein 2 [Ruegeria sp. R11]
          Length = 448

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 186/425 (43%), Positives = 274/425 (64%), Gaps = 11/425 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + A+ V  + L +L+++IV +G GA  QT ++L +E  E+ +D   
Sbjct: 24  RKRNAAERRFRAYGIAAISVGLLMLCVLVTTIVGRGTGAFQQTFVTLEVELLESKLDKSG 83

Query: 72  KRFMDPAILLRA-DYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARYHLRKTLMTD 129
            R +D    +    Y  ++R A+  K++    +  L  ++ + +LS  A   LR+ ++ +
Sbjct: 84  TRDIDAIKKVTTFGYAPIIRAAVEAKVAELGIDSPLKAKEMAGILSKDAAATLREFVIAN 143

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P  IG+TVE   LAS+ +D  +KG +   S AN   +S  Q      L S G +   FN 
Sbjct: 144 PDQIGETVEFRFLASSRVDGYMKGRVSRDSIANDKSISPEQLDLVDALVSAGVVEKTFNL 203

Query: 188 GFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            F    + + +RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+ K + +  +
Sbjct: 204 AFITGADASDARPEAAGMGVSMLGSLFMMLVVLALALPIGVAASIYLEEFAPKNWLTDII 263

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP++II+T  AL+ V
Sbjct: 264 EVNISNLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTVIISTRAALKAV 323

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV-T 364
           P SIR AALG+GAS++Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+ +
Sbjct: 324 PPSIRDAALGVGASRMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIAS 383

Query: 365 DYPVGVTD----IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           + P  + D      +A P QIY WA  A+  F ER +G I++LLIFL  +NT  + LR R
Sbjct: 384 NAPETIADGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMNTVAVILRRR 443

Query: 421 FKKRW 425
           F++RW
Sbjct: 444 FERRW 448


>gi|328544895|ref|YP_004305004.1| phosphate ABC transporter permease PstA [polymorphum gilvum
           SL003B-26A1]
 gi|326414637|gb|ADZ71700.1| Phosphate ABC transporter, permease protein PstA [Polymorphum
           gilvum SL003B-26A1]
          Length = 432

 Score =  339 bits (870), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 183/420 (43%), Positives = 266/420 (63%), Gaps = 12/420 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           K   K RY ++   +FY + A+ +   FL++L SS+V  G  A  QT +++ I      +
Sbjct: 23  KARRKSRYAADTRLKFYGLTAISMAIGFLLILFSSLVLTGYKAFVQTMVTVEIR-----L 77

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP++    D   +  A +  +V+ ALA      D   A  RQ  Q+ +  A++ +R  ++
Sbjct: 78  DPEQVNRDD---IFNAPWRTIVQSALADLEPGLD--QADRRQFLQIFTPNAQFLVRDRVI 132

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P +IG+TV  +   +  +D   KG +    P +  R++D Q  W+  L+  G +   F
Sbjct: 133 ANPDMIGRTVSFTFPLADPLDQLAKGEVDRSLPEDRRRVNDKQIGWYDGLNERGLISQPF 192

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N G F+N  S  PE+AG+  A+ GS + +L+   LSFP GIA+AIYLEEF+ K   +  +
Sbjct: 193 NTGLFLNADSRFPELAGLAGAISGSFWALLVCFLLSFPAGIAAAIYLEEFAPKNRITDLI 252

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPS+V+G+LG AV +  F +PRS  LVGG++LALMTLP+III T  +L++V
Sbjct: 253 EVNINNLAAVPSVVFGLLGLAVFLGLFGLPRSAPLVGGMVLALMTLPTIIIVTRASLKSV 312

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           PSSIR AALG+GASK +T+ HH+LPL+MP ILTG+ + LA+ALGETAPLL +GM AF+T 
Sbjct: 313 PSSIREAALGIGASKHETIIHHILPLSMPTILTGTIIGLAQALGETAPLLLIGMNAFITS 372

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              GV + +TA P QI++WA   ER FV RT  AIL+LL FL  +N   ++LR RF++RW
Sbjct: 373 PTTGVLEASTALPTQIFIWADSPERGFVARTSAAILVLLGFLLAMNAIAIFLRQRFERRW 432


>gi|119946058|ref|YP_943738.1| ABC phosphate transporter inner membrane protein, PstA-like protein
           [Psychromonas ingrahamii 37]
 gi|119864662|gb|ABM04139.1| ABC phosphate transporter inner membrane protein, PstA-like protein
           [Psychromonas ingrahamii 37]
          Length = 451

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 184/429 (42%), Positives = 277/429 (64%), Gaps = 22/429 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF----- 62
           K++LK R   E  FR +  +A+   F+ +++L + I +K   A +Q  I + IEF     
Sbjct: 31  KQSLKKRNSKEKRFRLWGRLAISFGFLMVVILFADIGTKAYPAFFQHWIKVDIEFNRQWL 90

Query: 63  ----SETIVDPQKKRFMDPAILLRADYNLLVRKALAR---KLSISDSNHALLRQASQMLS 115
               S++ V P  + F       +A+Y+  V+K+L +   +++       L+R    +LS
Sbjct: 91  NIEPSDSAVQPNMQAFK------QANYSTTVKKSLYQMFPQVTTRGDKRDLMR----LLS 140

Query: 116 TTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKL 175
            +A + +   +  +P L+G+TV + LLA  ++DS  K  +    +  R++D Q  W ++L
Sbjct: 141 YSAEFKIEDLVTANPDLLGQTVSLWLLADDDVDSYFKSGVTVGQSSGRINDKQAMWLKQL 200

Query: 176 DSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
              GA+   FN  FF N  S  PE+AGI  A+ G++  M+IV+ +SFP+G+++A+YLEEF
Sbjct: 201 FESGAVEKRFNTLFFTNSDSREPELAGIRGALSGTILTMIIVLLISFPIGVSAALYLEEF 260

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  ++  ++ NINNLA+VPSIV+G+LG AVLIN F +PRS +LVGG++L+LMTLP+II
Sbjct: 261 APKNRWTDIIEVNINNLAAVPSIVFGLLGLAVLINIFGLPRSASLVGGIVLSLMTLPTII 320

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IA+  +++ VP+SIR AA+GLGAS +Q    HVLP+AMP ILTG+ + LA+ALGETAPLL
Sbjct: 321 IASRASIKAVPNSIREAAIGLGASDMQVALGHVLPMAMPGILTGTIIGLAQALGETAPLL 380

Query: 356 FVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            +GMVAF+ D PV  TD AT  PVQIYLWA   E  F+ +T  AIL+LL FL ++N +  
Sbjct: 381 MIGMVAFIVDVPVNFTDAATVMPVQIYLWADSPESAFLAKTSAAILVLLAFLLIMNFSAT 440

Query: 416 WLRNRFKKR 424
            LR++F+K+
Sbjct: 441 LLRSKFEKK 449


>gi|254466624|ref|ZP_05080035.1| phosphate transport system permease protein 2 [Rhodobacterales
           bacterium Y4I]
 gi|206687532|gb|EDZ48014.1| phosphate transport system permease protein 2 [Rhodobacterales
           bacterium Y4I]
          Length = 452

 Score =  338 bits (868), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 188/427 (44%), Positives = 273/427 (63%), Gaps = 15/427 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + A+    V L++L+++IVSKG GA  QT ++L +E  E+ +D + 
Sbjct: 28  RKRNAAEARFRGYGIAAITAGLVMLLILVTTIVSKGTGAFQQTFVTLNVELLESKLDKKG 87

Query: 72  KRFM-DPAILLRADYNLLVRKALA---RKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +R + D   +    Y  +++ A+     +L I  S  A  +  + +LS      LR  ++
Sbjct: 88  ERNIEDIKKVTTFGYAPIIKGAMEATVEELGIDTSLKA--KDLAGVLSKDVAAQLRDYVI 145

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P  IG+TVE   LAS+ +D  LKG +   S  N   +S  Q      L + G L   F
Sbjct: 146 ANPDQIGQTVEFRFLASSRVDGYLKGRVTRDSIVNDKNISAEQLDLVDALAAAGVLEKTF 205

Query: 186 NYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           N  F    + + +RPE AGIGV+++GSL+MM +V+ L+ P+G+A++IYLEEF+ + + + 
Sbjct: 206 NLDFITGADASDARPEAAGIGVSMLGSLFMMFVVLALALPIGVAASIYLEEFAPQNWLTD 265

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L+
Sbjct: 266 MIEVNISNLAAVPSIVFGILGLAVFINYMHLPTSAPLVGGLVLTLMTLPTIIISTRASLK 325

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+
Sbjct: 326 SVPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFI 385

Query: 364 -TDYPVGVTD----IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
            ++ P  + D      +A P QIY WA  A+  F ER +G I++LLIFL  +NT  + LR
Sbjct: 386 ASNAPETIADGLLAPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMNTLAVILR 445

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 446 RRFERRW 452


>gi|310814682|ref|YP_003962646.1| phosphate ABC transporter, permease protein [Ketogulonicigenium
           vulgare Y25]
 gi|308753417|gb|ADO41346.1| phosphate ABC transporter, permease protein [Ketogulonicigenium
           vulgare Y25]
          Length = 444

 Score =  338 bits (867), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 197/431 (45%), Positives = 280/431 (64%), Gaps = 23/431 (5%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  FR Y + A+L+   FLI L+ SI   GIGA  QT + + +   E+++DP  
Sbjct: 20  KKRNAAEARFRAYGIGALLIAMGFLIALMWSIFGNGIGAFTQTFVKIQVPLEESVLDPNG 79

Query: 72  KRFMDPAILLRAD---YNLLVRKALARKLS----ISDSNHALLRQASQMLSTTARYHLRK 124
            R  +PA L RA    Y  L++ A+A  L      +D   A L   +Q+LS++A   +R 
Sbjct: 80  NR--EPADLARATTLRYGSLLQGAMASTLEREGITTDMEPAAL---AQILSSSAAAEVRN 134

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALF 182
            ++ +PSLIG+TVE+ +LAS+ +D  +KG +   S A    +S        ++   G + 
Sbjct: 135 RVLAEPSLIGQTVELEVLASSRVDGYMKGRVSRESLARDRNLSPAALNVVDQMRDAGVIE 194

Query: 183 LDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
             FN+ F    + +  RPE AGIGV+++GSL MML+V+ LS P+G+A++IYLEEF+ +  
Sbjct: 195 RRFNWNFIFGSDASDQRPEQAGIGVSMLGSLAMMLVVLALSLPIGVAASIYLEEFAPQNR 254

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           F+  ++ NI+NLA+VPSIV+GILG AV I    +P+S  +VGGL+L LMTLP+III+T  
Sbjct: 255 FTDLIEVNISNLAAVPSIVFGILGLAVFIQIMHLPQSAPVVGGLVLTLMTLPTIIISTRA 314

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           AL+ VP SIR AALG+GAS++Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +GMV
Sbjct: 315 ALKAVPPSIRDAALGIGASRMQAVFHHVLPLAMPGILTGTILGLAQALGETAPLLLIGMV 374

Query: 361 AFV-TDYPVGVTDIA-----TAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
            F+ ++YP G  D A     +A P QIY WA  A+  F ER +G I+LLL+FL ++N   
Sbjct: 375 GFIASNYP-GSVDAAFNAPNSAMPAQIYEWAKRADPAFYERAWGGIILLLVFLLLMNFLA 433

Query: 415 LWLRNRFKKRW 425
           + LR RF+++W
Sbjct: 434 VLLRRRFERKW 444


>gi|21388709|dbj|BAC00818.1| phosphate transport system permease ABC transporter protein
           [Rhodobacter sphaeroides f. sp. denitrificans]
          Length = 449

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 191/431 (44%), Positives = 266/431 (61%), Gaps = 23/431 (5%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + AV +  + L++LLSS++  G GA  QT + +P+     IVDP+ 
Sbjct: 25  RRRNAAERRFRAYGLTAVGLSILALVVLLSSVIGNGAGAFRQTFVEIPLTLDARIVDPKG 84

Query: 72  KRFMDP---------AILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
            R +D             L A     V  A  +   ISD + A       +LS  A   L
Sbjct: 85  NRNIDEMKKVTTIGYGRQLEASMVAAVAAAGLKTEGISDKDIA------GLLSKEAAATL 138

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGA 180
           R  ++ +P+L+G T+    LA+  +D   KG   + S      ++  Q    Q++   G 
Sbjct: 139 RNRVLANPALVGDTITFRALANGRVDGFFKGRVTMESAELDSNVTPEQLGLAQRMREAGL 198

Query: 181 LFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           + L FN  F +   +S  RPE AG+GVA++GS YMM+IV+ L+ P+G+A++IYL EF+ K
Sbjct: 199 ITLAFNPDFLLGSDASEVRPEAAGLGVAILGSAYMMIIVLVLALPIGVAASIYLXEFAPK 258

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI NLA+VPSIV+GILG A+ IN   +P+S  +VGGLIL LMTLP+IIIAT
Sbjct: 259 NRWTDLIEVNIANLAAVPSIVFGILGLAIFINMMGLPQSAPIVGGLILTLMTLPTIIIAT 318

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
            V+L  VP SIR AALG+GAS++Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL +G
Sbjct: 319 RVSLAAVPPSIRDAALGVGASRMQAVFHHVLPLALPGILTGTIIGMARALGETAPLLLIG 378

Query: 359 MVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           MVAFV +YP     G  D A+A PVQ+Y +   A+  FVER  GAI++LL FL  +N A 
Sbjct: 379 MVAFVREYPAAPPEGFFDPASALPVQVYNFTQRADPAFVERASGAIIVLLAFLICMNAAA 438

Query: 415 LWLRNRFKKRW 425
           + LR RF++RW
Sbjct: 439 IILRRRFERRW 449


>gi|163761274|ref|ZP_02168349.1| ABC phosphate transporter, inner membrane subunit PstA [Hoeflea
           phototrophica DFL-43]
 gi|162281431|gb|EDQ31727.1| ABC phosphate transporter, inner membrane subunit PstA [Hoeflea
           phototrophica DFL-43]
          Length = 432

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 188/431 (43%), Positives = 269/431 (62%), Gaps = 17/431 (3%)

Query: 9   KNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD 68
           +  + R  +E  FR   + AV+   + L+ L++SI+S G+ +  QT+ISL +      +D
Sbjct: 5   ERTRKRNAAEKRFRMMGLAAVIFGLLALVGLMASILSNGLSSFNQTYISLDVYLDPAKLD 64

Query: 69  PQKKRF-MDPAILLRADYNLLVRKAL-----ARKLSISDSNHALLRQASQMLSTTARYHL 122
               R   D   +       L++ A+      R  +    N    ++A+ ++S  A   L
Sbjct: 65  KNGNRAPEDLKKITTFTIQPLIKTAMQDMMQERGFAAEGVNA---KEAAALVSKEAPADL 121

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGA 180
           R+ ++ +P  IG+T+   LLAS  ID   KG   + S A    +S  Q     +L   G 
Sbjct: 122 RRFVLANPDQIGETISFDLLASGRIDGYFKGRVTMESAALDRNISPEQLVLADRLKDAGI 181

Query: 181 LFLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           + L FN+ FF   + + +RPE AG+GVA++GS YMMLIV+ LS P+G+A++IYLEEF+ K
Sbjct: 182 MDLRFNWSFFTAPDASDTRPEAAGLGVAILGSAYMMLIVLALSLPIGVAASIYLEEFAPK 241

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI NLA+VPSIV+GILG A+ INF  +P+S  +VG L+L LMTLP+IIIAT
Sbjct: 242 NRWTDLIEVNIANLAAVPSIVFGILGLALFINFIGLPQSAPVVGALVLTLMTLPTIIIAT 301

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR AALG+GASK+Q +FHHVLPLA P ILTG+ + LA+ALGETAPLL +G
Sbjct: 302 RAALKAVPPSIRDAALGIGASKMQAIFHHVLPLAAPGILTGAIIGLAQALGETAPLLLIG 361

Query: 359 MVAFVTDY----PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           MVAFV +Y    P G  D A+A PVQ+Y W    +  F+ER  GAI++LL+FL ++N   
Sbjct: 362 MVAFVREYPGAPPEGFFDPASALPVQVYNWTQRGDPAFIERASGAIIVLLVFLVIMNAVA 421

Query: 415 LWLRNRFKKRW 425
           + LR RF++RW
Sbjct: 422 ILLRRRFERRW 432


>gi|294084773|ref|YP_003551531.1| phosphate ABC transporter permease [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664346|gb|ADE39447.1| phosphate ABC transporter permease protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 434

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/420 (40%), Positives = 265/420 (63%), Gaps = 6/420 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           ++ +K R   E  FRFY  +A+ +  +FL+ L ++I+SKGI   +Q +++L +E     +
Sbjct: 19  QETIKRRNKQEKRFRFYGRIAIAIALIFLVTLFATILSKGIPGFFQYYVTLDVELDRERL 78

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP+    +    L   D   +VR AL    ++     +  R A +M+S+ +   +RK + 
Sbjct: 79  DPKGD--LSTGSLYSGDARGVVRDALF--AAVKPEGRSGKRAAGKMISSGSEERIRKFVQ 134

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P L G    +      +IDS L+G++   +P    R++D    +   L++ G +  + 
Sbjct: 135 ENPDLFGTIQPMRFALDDDIDSFLRGFIKRETPEADRRINDRVIGYVDDLNARGRISYNV 194

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           +   F   AS   E+AGI  A VGSL  + + + LSFP+G+A+A+YLEE + K   + F+
Sbjct: 195 SDYLFFGSASRDAEMAGIKGAFVGSLMTLAVCLVLSFPIGVATAVYLEEIAKKNRITEFI 254

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPS+V+GILG A+ I  F +PRS  L+GG++LALMTLP+III++  A+R V
Sbjct: 255 EININNLAAVPSVVFGILGLAIFIGIFGLPRSIPLIGGVVLALMTLPTIIISSRAAIRAV 314

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S+R AA G+GAS++QT+FHHV+PLA+P +LTG+ + +A+ALGETAPLL +GMVAF+ D
Sbjct: 315 PPSVRDAAYGVGASRMQTIFHHVIPLALPGMLTGTIIGMAQALGETAPLLMIGMVAFIVD 374

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P  V D  T  PVQI++WA  AER F+++T  AI++LL FL  +N   + LR R ++RW
Sbjct: 375 IPNSVMDPGTVLPVQIFMWADFAERMFIQKTSAAIIVLLAFLVGMNAFAIVLRKRLERRW 434


>gi|56696823|ref|YP_167185.1| phosphate ABC transporter, permease protein [Ruegeria pomeroyi
           DSS-3]
 gi|56678560|gb|AAV95226.1| phosphate ABC transporter, permease protein [Ruegeria pomeroyi
           DSS-3]
          Length = 450

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 186/425 (43%), Positives = 271/425 (63%), Gaps = 11/425 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + A+L+  + L +L+ +IVS+G GA  QT ++L +E  E+ +D + 
Sbjct: 26  RRRNRAEARFRAYGMGAILIGLMMLAVLVFTIVSRGTGAYTQTFVTLDVELLESKLDKKG 85

Query: 72  KRFMDPAILLRA-DYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARYHLRKTLMTD 129
            R ++    +    Y  L+  A    +  +    AL  +  + +LS  A   LR  ++ D
Sbjct: 86  TRDIEAIKKVSTFGYAPLINAAFETAMDKAGIETALKPKDQAAILSKRAAAQLRDYVIAD 145

Query: 130 PSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P  IG+TV    LA++ +D  LKG +   S AN   +S  Q  +  +L + G +   FN 
Sbjct: 146 PERIGQTVSFRFLANSRVDGYLKGRVTRESIANDKSISTEQLDFVDQLIAAGMIRKTFNL 205

Query: 188 GFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            F +  + +  RPE AG+GV++VGSL+MML+V+ L+ P+G+A++IYLEEF+ K + +  +
Sbjct: 206 DFILGSDASDQRPEAAGMGVSMVGSLFMMLVVLVLALPIGVAASIYLEEFAPKNWLTDVI 265

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L++V
Sbjct: 266 EVNISNLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTIIISTRASLKSV 325

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+  
Sbjct: 326 PPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIAS 385

Query: 366 YP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            P      G+    +A P QIY WA  A+  F ER +G I++LL+FL  +NT  + LR R
Sbjct: 386 NPPDGIAAGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLVTMNTLAVILRRR 445

Query: 421 FKKRW 425
           F++RW
Sbjct: 446 FERRW 450


>gi|260772583|ref|ZP_05881499.1| phosphate transport system permease protein PstA [Vibrio
           metschnikovii CIP 69.14]
 gi|260611722|gb|EEX36925.1| phosphate transport system permease protein PstA [Vibrio
           metschnikovii CIP 69.14]
          Length = 456

 Score =  335 bits (859), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 188/437 (43%), Positives = 274/437 (62%), Gaps = 24/437 (5%)

Query: 9   KNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD 68
           K+LK R+ SE  F+ + + AV +   F+++L  S+ SKGI A WQ  +SL + F   +++
Sbjct: 24  KSLKKRHASERRFKAFGMGAVGLALSFVLILFVSVFSKGIPAFWQATVSLNVYFDPEVIN 83

Query: 69  PQKK----------RFMDPAILLRA-----DYNLLVRKALARKLSISDSNHALLRQASQM 113
            + K           F    +  +      ++N ++  +LA+++  +       R A ++
Sbjct: 84  IEPKPVQLSGESAGEFQQRMLAWQGQVGMVNFNRIIVNSLAKEIPEAPRYQ---RDALRL 140

Query: 114 LSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKW 171
           +++  R+ LR  L+ DPSLIGKT+ + LLA AN+D  LKG +    P +  ++S     W
Sbjct: 141 ITSGERFALRDMLVNDPSLIGKTLRLDLLADANVDVWLKGNIDRDLPDSRQQLSARTRAW 200

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVA--VVGSLYMMLIVIGLSFPLGIASA 229
             +L   G +   F+   F+N   SR  +A  G+A   +GS++MMLIV+ LS P+G+ASA
Sbjct: 201 ADELADRGVIQNKFSTALFMN-VDSRSSLASAGLAGAFMGSVFMMLIVMVLSVPIGVASA 259

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM 289
           IYLEEF+ K   + F++ NINNLA+VPSIV+G+LG++V I +FK+P S   VGGL+L LM
Sbjct: 260 IYLEEFAPKNKLTDFIEVNINNLAAVPSIVFGLLGASVFILWFKLPLSAPFVGGLVLTLM 319

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP++IIAT   L+ +P SIR AALG+GASK Q VFHHVLPLA+P ILTG+ + +A+ALG
Sbjct: 320 TLPTVIIATRSTLKAIPPSIRQAALGIGASKTQAVFHHVLPLALPGILTGAILGIAQALG 379

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLA 408
           ETAPLL +GM +FV   P    D +TA PVQI+LW  +  R F E RT  AI++LL  + 
Sbjct: 380 ETAPLLLIGMNSFVASIPSTPMDQSTALPVQIFLWQGNELRNFFEARTSAAIIVLLALMI 439

Query: 409 VINTAMLWLRNRFKKRW 425
            +N   +WLR RF+ RW
Sbjct: 440 SLNALAIWLRRRFETRW 456


>gi|255318361|ref|ZP_05359594.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           radioresistens SK82]
 gi|262378591|ref|ZP_06071748.1| phosphate ABC transporter, permease PstA [Acinetobacter
           radioresistens SH164]
 gi|255304353|gb|EET83537.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           radioresistens SK82]
 gi|262299876|gb|EEY87788.1| phosphate ABC transporter, permease PstA [Acinetobacter
           radioresistens SH164]
          Length = 465

 Score =  335 bits (859), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 185/437 (42%), Positives = 272/437 (62%), Gaps = 24/437 (5%)

Query: 9   KNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD 68
           K+L  R+  E +FR     AV+    F+ LL  SI+ KG+ A WQ  +S+P+ F   I+D
Sbjct: 33  KSLSKRHRKEKIFRIAGFSAVMAGLFFVALLFGSILIKGLPAFWQAGMSVPVYFDPNIID 92

Query: 69  ----PQKKRFMDPAI-----------LLRADYN-LLVRKALARKLSISDSNHALLRQASQ 112
               P +K    PA            +   D++ L+V   +++  +++     L     +
Sbjct: 93  AGPRPVQKAGESPAQFQGRYIAWQTKMGMVDWDALIVNGIISKAPALAPQRDEL----GE 148

Query: 113 MLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWK 170
           + +++  Y LR  +  +P+LIGKT ++ +LA AN+D  ++G +    P    ++S    K
Sbjct: 149 IYTSSESYRLRDMVFENPALIGKTQDIKILADANVDVWVRGQIDRDLPDEQQQLSPEVRK 208

Query: 171 WFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
              ++++ G L   FN   F N  S S P  +G+  A +GSL+MMLIVI +S P+G+ASA
Sbjct: 209 LADEMEAQGVLTTSFNTQIFTNPDSRSSPATSGLAGAFMGSLFMMLIVIFISIPIGVASA 268

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM 289
           IYLEEF+ K + +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+LM
Sbjct: 269 IYLEEFAPKNYITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSLM 328

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP++II T  +L+ VP SIR AALGLGAS+VQT+FHHVLPLA+P ILTG+ + +A+ALG
Sbjct: 329 TLPTVIITTRASLKAVPPSIRQAALGLGASRVQTIFHHVLPLALPGILTGAIIGVAQALG 388

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLA 408
           ETAPLL +GM AFV   P    D +TA PVQI+LW  +  R F E RT  AI++LL  + 
Sbjct: 389 ETAPLLLIGMSAFVASVPTSPLDQSTALPVQIFLWQGNELRNFFEGRTAAAIIVLLALMI 448

Query: 409 VINTAMLWLRNRFKKRW 425
            +N+  +WLR +F+ RW
Sbjct: 449 GLNSLAIWLRKKFEVRW 465


>gi|262372060|ref|ZP_06065339.1| phosphate ABC transporter, permease PstA [Acinetobacter junii
           SH205]
 gi|262312085|gb|EEY93170.1| phosphate ABC transporter, permease PstA [Acinetobacter junii
           SH205]
          Length = 464

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 183/437 (41%), Positives = 269/437 (61%), Gaps = 22/437 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           + +L  R+  E +FR     AV++   F+ LL  SI+++G+ A WQ+ +++P+ F  TI+
Sbjct: 31  QSSLAKRHRKEKMFRLGGFSAVVIGLAFVALLFGSILARGLPAFWQSSMTVPVYFDPTII 90

Query: 68  D----PQKKRFMDPAILLR-----------ADYNLLVRKALARKLSISDSNHALLRQASQ 112
           +    P+      PA                D++ L+   +  K    +S    L   + 
Sbjct: 91  NAGPKPKPTAGESPAHFEERFVAWQTEMGMVDWDALIVNGIVAKDPALESQRDYL---TG 147

Query: 113 MLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWK 170
           M +++  Y LR  ++ +P+LIG   E+  LA AN+D  L G +    P +  ++     +
Sbjct: 148 MYTSSEAYRLRDMVLANPALIGTKQELKFLADANVDVWLSGNIDRSLPDDQQQLDPEVRQ 207

Query: 171 WFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
              +L++ G +   FN   F++  S S P ++G+  A +GSL+MMLIVI +S P+G+ASA
Sbjct: 208 LADQLEAKGIIESTFNTNLFVSPDSRSSPAISGLAGAFMGSLFMMLIVIVISIPIGVASA 267

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM 289
           IYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I + ++P S  LVGGL+L+LM
Sbjct: 268 IYLEEFAPKNMMTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMQLPLSAPLVGGLVLSLM 327

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TGS + +A ALG
Sbjct: 328 TLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGSIIGVAHALG 387

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLA 408
           ETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  + 
Sbjct: 388 ETAPLLLIGMSAFVASVPTSPLDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALMI 447

Query: 409 VINTAMLWLRNRFKKRW 425
            +N+  +WLR +F+ RW
Sbjct: 448 GLNSLAIWLRKKFEVRW 464


>gi|118589314|ref|ZP_01546720.1| phosphate ABC transporter, permease protein [Stappia aggregata IAM
           12614]
 gi|118438014|gb|EAV44649.1| phosphate ABC transporter, permease protein [Stappia aggregata IAM
           12614]
          Length = 450

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 177/424 (41%), Positives = 271/424 (63%), Gaps = 15/424 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  F+ Y ++A+ +   FL+ LL +I+S G+GA  QT + + +  ++  +D  +
Sbjct: 32  KKRNAAEARFKLYGIIAIGIGLFFLVALLWAILSNGLGAFSQTFVKVDVPLNQQQIDDAE 91

Query: 72  KRFMDPAILLRADYNLLVRKALARKLSISD-SNHALLRQASQMLSTTARYHLRKTLMTDP 130
           K     +++  + Y  ++  A A++L+ ++ +     +   ++ S+ A   +R   + +P
Sbjct: 92  K-----SVVKTSKYRAIIDDAFAKELAGANITTEMSAKDLQKLFSSGAAATVRDYALANP 146

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
             +G TV   L+AS+ +D  LKG +     A    +         ++ S G L   FN+ 
Sbjct: 147 DKVGTTVTFELIASSRVDGYLKGRVKREDLAEDKNLDAAHLDLVDQMKSAGLLEKRFNWS 206

Query: 189 FFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           F    + + SRPE AGIG +++GSL+MML+V+ LS P+G+A++IYLEEF+ +  F+  ++
Sbjct: 207 FITGTDASDSRPEQAGIGASMIGSLFMMLVVLFLSLPIGVAASIYLEEFAPQNKFTDLIE 266

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
            NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+T  +L+ VP
Sbjct: 267 VNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIISTRASLKAVP 326

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV-TD 365
            SIR AALG+GASK+Q++FHHVLPLAMP ILTG+ + LA+ALGETAPLL +GMV F+ ++
Sbjct: 327 PSIRDAALGIGASKMQSIFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMVGFIASN 386

Query: 366 YPVGVT----DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           +P GV        +A P QIY WA  A+  F ER +G I++LL+FL  +N   + LR RF
Sbjct: 387 FPDGVAAGFFSPNSAMPAQIYEWAKRADPAFYERAWGGIIVLLVFLMTMNIIAIILRRRF 446

Query: 422 KKRW 425
           ++RW
Sbjct: 447 ERRW 450


>gi|163746357|ref|ZP_02153715.1| Phosphate transport system permease protein 2 [Oceanibulbus
           indolifex HEL-45]
 gi|161380242|gb|EDQ04653.1| Phosphate transport system permease protein 2 [Oceanibulbus
           indolifex HEL-45]
          Length = 451

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 187/434 (43%), Positives = 269/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S  +     K R  +E  F+ Y +VA+ +  + L+ LL +IVS+G GA  QT ++L +  
Sbjct: 18  SLLVQDGRTKRRNAAEGRFKLYGIVAITIGLLMLLTLLFTIVSRGTGAFQQTFVTLSVPL 77

Query: 63  SETIVDPQKKRFMDPAILLRA-DYNLLVRKALARKLSISDSNHALLRQA-SQMLSTTARY 120
            E  +D    R ++    +    Y  L++ A   K+  +     L  +A + +LS  A  
Sbjct: 78  LEDKLDKNGNRDLEEIKKVSTFGYAPLLKAAFETKVEDTGIETELKSKAMADILSKDAAA 137

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSD 178
            LR  ++ +P LIG  VE   L ++ +D  LKG +   S AN   +S  Q      L +D
Sbjct: 138 QLRDHVLANPELIGSVVEFEFLTNSRVDGYLKGRVTRESIANDKNISAEQLDLVDALVAD 197

Query: 179 GALFLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G+L   FN  F    + + +RPE AG+GVA++GS  MML+V+ L+ P+G+A++IYLEEF+
Sbjct: 198 GSLAKRFNLDFITGADASDARPEAAGMGVAMIGSFAMMLVVLVLALPIGVAASIYLEEFA 257

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III
Sbjct: 258 PKNWITDIIEVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIII 317

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  +L++VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 318 STRASLKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 377

Query: 357 VGMVAFVTDYP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+   P      G+    +A P QIY WA  A+  F ER +G I++LL+FL  +N
Sbjct: 378 IGMVGFIASNPPESIAEGLMSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLISMN 437

Query: 412 TAMLWLRNRFKKRW 425
              + LR RF++RW
Sbjct: 438 AIAVLLRRRFERRW 451


>gi|83952001|ref|ZP_00960733.1| phosphate ABC transporter, permease protein [Roseovarius
           nubinhibens ISM]
 gi|83837007|gb|EAP76304.1| phosphate ABC transporter, permease protein [Roseovarius
           nubinhibens ISM]
          Length = 449

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 182/426 (42%), Positives = 269/426 (63%), Gaps = 12/426 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + A+L    FL++L+SSI+  G+GA  Q+ +++P+      +D   
Sbjct: 24  QKRNRAERRFRAYGMAAILTGLFFLVVLVSSILYNGVGAFQQSFVNVPVYLDPAKLDKNG 83

Query: 72  KRFMDPAILLRA-DYNLLVRKALARKLSISDSNHALLRQAS--QMLSTTARYHLRKTLMT 128
              ++    +    Y  L++  L  ++  S     L +      +LS +A   +R  ++ 
Sbjct: 84  TGDIEEIKKVSTFGYAPLIQDGLLSEVQKSGIETPLTKSKDMKNLLSASAAAEVRDYVVA 143

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDGALFLDFN 186
           +P  IG+TVE  LLAS+ +D  LKG +     A+   +S  Q     +L   G +   FN
Sbjct: 144 NPEQIGETVEFRLLASSRVDGYLKGRVKREDVADDKNISVEQLDLTDQLRDAGIVSKGFN 203

Query: 187 YGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
             F    + + SRPE AGIGV+++GS +MML+V+ LS P+G+A++IYLEEF+ +  F+  
Sbjct: 204 LSFITGADASESRPEQAGIGVSMLGSFFMMLVVLVLSLPIGVAASIYLEEFAPQNRFTDL 263

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+T  +L+ 
Sbjct: 264 IEVNISNLAAVPSIVFGILGLAVFIQFAHLPQSAPLVGGLVLTLMTLPTIIISTRASLKA 323

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV- 363
           VP SIR AALG+GASK+Q++FHHVLPLAMP ILTG+ + LA+ALGETAPLL +GMV ++ 
Sbjct: 324 VPPSIRDAALGVGASKMQSIFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMVGYIA 383

Query: 364 TDYPVGVT----DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           ++YP G      D  +A P QIY WA  A+  + ER +G I++LL+FL  +N   + LR 
Sbjct: 384 SNYPDGFASGFLDPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLLTMNAIAIILRR 443

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 444 RFERRW 449


>gi|86138912|ref|ZP_01057484.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           MED193]
 gi|85824559|gb|EAQ44762.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           MED193]
          Length = 450

 Score =  330 bits (845), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 189/433 (43%), Positives = 278/433 (64%), Gaps = 12/433 (2%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
            +++K+ ++ R  +E  F+ Y + A+ V  V L++L+++IV +G GA  QT I++ +E  
Sbjct: 19  LTLSKRTIQ-RNAAEKRFKAYGIAAIAVGLVMLLVLVTTIVGRGTGAFQQTFITVNVELL 77

Query: 64  ETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARYH 121
           E+ +D   +R + D   +    Y  L++ A+   ++      +L  +  + +LS  A   
Sbjct: 78  ESKLDKNGERNIEDIKRVTTFGYAPLIKTAMQNTVADLGIETSLKTKHMAGLLSKNAVAQ 137

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDG 179
           LR  ++ +P  IG+TVE   LA + +D  LKG +   S AN   +S  Q      L + G
Sbjct: 138 LRAFVLENPEKIGETVEFRFLAQSRVDGYLKGRVSRDSIANDKNISAEQLDLVDALVAAG 197

Query: 180 ALFLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            +   FN  F +  + +  RPE AG+GV+++GSL+MML+V+ LS P+G+A++IYLEEF+ 
Sbjct: 198 VIEKTFNLDFILGSDASDQRPEAAGMGVSMMGSLFMMLVVLALSLPIGVAASIYLEEFAP 257

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K + +  ++ NI NLA+VPSIVYGILG AV IN+  +P S  LVGGL+L LMTLP+III+
Sbjct: 258 KNWITDVIEVNIANLAAVPSIVYGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTIIIS 317

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  AL+ VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +
Sbjct: 318 TRAALKAVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLI 377

Query: 358 GMVAFV-TDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           GMV F+ ++ P     G+    +A P QIY WA  A+  F ER +G I++LLIFL  +NT
Sbjct: 378 GMVGFIASNAPETIGEGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMNT 437

Query: 413 AMLWLRNRFKKRW 425
             + LR RF++RW
Sbjct: 438 VAVILRRRFERRW 450


>gi|163736448|ref|ZP_02143867.1| Phosphate transport system permease protein 2 [Phaeobacter
           gallaeciensis BS107]
 gi|161390318|gb|EDQ14668.1| Phosphate transport system permease protein 2 [Phaeobacter
           gallaeciensis BS107]
          Length = 456

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 185/430 (43%), Positives = 271/430 (63%), Gaps = 11/430 (2%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
             +  + R  +E  FR Y + A+ V  + L +L+ +IVS+G GA  QT I+L +E  E+ 
Sbjct: 27  QSERTRKRNAAERRFRGYGISAITVGLLMLAVLVFTIVSRGTGAFQQTFITLDVELLESK 86

Query: 67  VDPQKKRFMDPAILLRA-DYNLLVRKALARKLSISDSNHALLRQA-SQMLSTTARYHLRK 124
           +D    R +D    +    Y  L++ A+  K++    +  L  +A + +LS  A   LR 
Sbjct: 87  LDKSGTRDLDAIKKVTTFGYAPLIKNAVQAKVAELGIDTDLKAKAMAGILSKNAAAQLRA 146

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALF 182
            ++ +P  IG+TV    LAS+ +D  LKG +   S  N   +S  Q      L +     
Sbjct: 147 YVVENPDQIGQTVTFRFLASSRVDGYLKGRVSRDSIVNDKSISPAQLDLVDALVAAEVAA 206

Query: 183 LDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
             FN  F    + + +RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+ K +
Sbjct: 207 KTFNLDFITGADASDARPEAAGMGVSMMGSLFMMLVVLALALPIGVAASIYLEEFAPKNW 266

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP++II+T  
Sbjct: 267 ITDVIEVNISNLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTVIISTRA 326

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           +L++VP SIR AALG+GAS++Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV
Sbjct: 327 SLKSVPPSIRDAALGVGASRMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMV 386

Query: 361 AFV-TDYPVGVTD----IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            F+ ++ P  + D      +A P QIY WA  A+  F ER +G I++LLIFL  +NT  +
Sbjct: 387 GFIASNAPETIADGLLAPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMNTVAV 446

Query: 416 WLRNRFKKRW 425
            LR RF++RW
Sbjct: 447 ILRRRFERRW 456


>gi|260549705|ref|ZP_05823922.1| phosphate ABC transporter [Acinetobacter sp. RUH2624]
 gi|260407222|gb|EEX00698.1| phosphate ABC transporter [Acinetobacter sp. RUH2624]
          Length = 465

 Score =  328 bits (841), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 190/437 (43%), Positives = 268/437 (61%), Gaps = 22/437 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FR   + AV++   F+ LL  SI++KG+ A WQT +++P+ F   ++
Sbjct: 32  EKSLAKRHRKEKAFRIAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPKVI 91

Query: 68  DPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQASQ 112
           D                ++R++D    +   D++ L+   +  K    +S    LR    
Sbjct: 92  DAGPLPVRAQGETPAHYQERYVDWQTKMGMVDWDSLIVNGIVAKDPSLESQRDSLRS--- 148

Query: 113 MLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWK 170
           + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++     K
Sbjct: 149 LYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEIRK 208

Query: 171 WFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
               L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI +S P+G+ASA
Sbjct: 209 LADDLKAKGILENTFNTNLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVASA 268

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM 289
           IYLEEF+ K F +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+LM
Sbjct: 269 IYLEEFASKNFITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLSLM 328

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLAMP I+TGS + +A ALG
Sbjct: 329 TLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLAMPGIMTGSIIGVAHALG 388

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLA 408
           ETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  + 
Sbjct: 389 ETAPLLLIGMSAFVASIPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALMI 448

Query: 409 VINTAMLWLRNRFKKRW 425
            +N+  +WLR +F+ RW
Sbjct: 449 GLNSLAIWLRKKFEVRW 465


>gi|163743306|ref|ZP_02150687.1| phosphate ABC transporter, permease protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161383494|gb|EDQ07882.1| phosphate ABC transporter, permease protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 451

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 184/425 (43%), Positives = 269/425 (63%), Gaps = 11/425 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + A+ V  + L +L+ +IVS+G G   QT I+L +E  E+ +D   
Sbjct: 27  RKRNAAERRFRGYGIAAITVGLLMLAVLVFTIVSRGTGGFQQTFITLDVELLESKLDKSG 86

Query: 72  KRFMDPAILLRA-DYNLLVRKALARKLSISDSNHALLRQA-SQMLSTTARYHLRKTLMTD 129
            R +D    +    Y  L++ A+  K++    +  L  +A + +LS  A   LR  ++ +
Sbjct: 87  TRDLDAIKKVTTFGYAPLIKNAVQAKVAELGIDTDLKAKAMAGILSKNAAAQLRAYVVEN 146

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P  IG+TV    LAS+ +D  LKG +   S  N   +S  Q      L +       FN 
Sbjct: 147 PDQIGQTVTFRFLASSRVDGYLKGRVSRDSIVNDKSISPAQLDLVDALVAAEVAAKTFNL 206

Query: 188 GFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            F    + + +RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+ K + +  +
Sbjct: 207 DFITGADASDARPEAAGMGVSMMGSLFMMLVVLALALPIGVAASIYLEEFAPKNWITDVI 266

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP++II+T  +L++V
Sbjct: 267 EVNISNLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTVIISTRASLKSV 326

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV-T 364
           P SIR AALG+GAS++Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+ +
Sbjct: 327 PPSIRDAALGVGASRMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIAS 386

Query: 365 DYPVGVTD----IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           + P  + D      +A P QIY WA  A+  F ER +G I++LLIFL  +NT  + LR R
Sbjct: 387 NAPETIADGLLAPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMNTVAVILRRR 446

Query: 421 FKKRW 425
           F++RW
Sbjct: 447 FERRW 451


>gi|254486512|ref|ZP_05099717.1| phosphate ABC transporter, permease protein PstA [Roseobacter sp.
           GAI101]
 gi|214043381|gb|EEB84019.1| phosphate ABC transporter, permease protein PstA [Roseobacter sp.
           GAI101]
          Length = 443

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 184/423 (43%), Positives = 272/423 (64%), Gaps = 11/423 (2%)

Query: 14  RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKR 73
           R  +E  F+ Y + A+ V  + L++LL++I+ +G GA  QT ++L ++  E  +D +  R
Sbjct: 21  RNRAETRFKAYGIAAIAVGLLMLLILLTTIIGRGTGAFQQTFLTLDVQLLEAKLDKKGNR 80

Query: 74  FMDPAILLRA-DYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARYHLRKTLMTDPS 131
            ++    +    Y  L+  AL +K++ +     L  +  + +LS  A   LR  ++ +  
Sbjct: 81  DLEDIKKVSTFGYAPLMAAALEKKVADTGIETGLKPKDMAAILSKDAAAQLRDFVLENTD 140

Query: 132 LIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGF 189
           LIG +VE   L ++ +D  LKG +   S AN   +S  Q      L +DGAL   FN  F
Sbjct: 141 LIGSSVEFRFLTNSRVDGYLKGRVTRESIANDKNISTAQLDLVDALIADGALEKRFNLAF 200

Query: 190 FI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
               + + +RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+ K + +  ++ 
Sbjct: 201 ITGADASDARPEAAGMGVSMLGSLFMMLVVLALALPIGVAASIYLEEFAPKNWITDIIEV 260

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L++VP 
Sbjct: 261 NISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIIISTRASLKSVPP 320

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+   P
Sbjct: 321 SIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIASNP 380

Query: 368 -----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
                 G+ D  +A P QIY WA  A+  F ER +G I++LL+FL  +N   + LR RF+
Sbjct: 381 PDGIASGLLDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLVTMNAIAVMLRRRFE 440

Query: 423 KRW 425
           +RW
Sbjct: 441 RRW 443


>gi|320352742|ref|YP_004194081.1| PhoT family phosphate ABC transporter membrane protein 2
           [Desulfobulbus propionicus DSM 2032]
 gi|320121244|gb|ADW16790.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Desulfobulbus propionicus DSM 2032]
          Length = 422

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 253/385 (65%), Gaps = 11/385 (2%)

Query: 43  IVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDS 102
           I +KG  A  Q+ I L I F   ++D           L  A+Y  LVR+A+       +S
Sbjct: 47  IGAKGYTAFRQSEILLDIHFDPAVLDVDN--------LATANYAALVREAVLALFPEVES 98

Query: 103 NHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PAN 160
                R  ++++S+ A + L+  +M  P LIG T  V + A   +D  +KG++    P +
Sbjct: 99  RQDK-RTVAKLVSSGAAHALQAMVMAKPELIGTTRAVWVTADDEVDMFVKGHIPRDVPES 157

Query: 161 VHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGL 220
             R+SD Q  W  +L   G L   FN  FF  G S  PE+AGI  A +GSL+ + + + L
Sbjct: 158 ERRISDQQAAWIDRLIEAGRLEQRFNAAFFQAGDSREPELAGIRGATMGSLFTLAVTLVL 217

Query: 221 SFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTAL 280
           SFP+G+A+A+YLEEF+ K  ++  ++ NINNLA++PSIV+G+LG AV +NF  +PRS++L
Sbjct: 218 SFPVGVAAAVYLEEFAPKNRWTDLIEVNINNLAAIPSIVFGLLGLAVFLNFLGLPRSSSL 277

Query: 281 VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGS 340
           VGGL+L LMTLP+IIIA+  +L++VP SIR AALG+GASK+QT+ HHVLPLA+P ++TG+
Sbjct: 278 VGGLVLTLMTLPTIIIASRASLKSVPPSIREAALGVGASKMQTIAHHVLPLALPGMMTGA 337

Query: 341 TVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAI 400
            + +ARALGETAPLL +GMVAF+ D P G  D AT  PVQIYLWA   ER FVERT  AI
Sbjct: 338 IIGMARALGETAPLLMIGMVAFIVDVPQGFHDPATVLPVQIYLWADSPERAFVERTSAAI 397

Query: 401 LLLLIFLAVINTAMLWLRNRFKKRW 425
           ++LL+ L  +N A + LRN+F++RW
Sbjct: 398 MVLLVLLLAMNAAAVLLRNKFERRW 422


>gi|99081101|ref|YP_613255.1| phosphate ABC transporter permease [Ruegeria sp. TM1040]
 gi|99037381|gb|ABF63993.1| Phosphate transport system permease protein 2 [Ruegeria sp. TM1040]
          Length = 455

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 185/425 (43%), Positives = 271/425 (63%), Gaps = 11/425 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  F+ Y + A+ V  + L++L+++IVSKG GA  QT I+LP+E  E+ +D   
Sbjct: 31  KRRNAAETRFKAYGIAAIAVGLLMLVVLVTTIVSKGTGAFQQTFITLPVELLESKLDKNG 90

Query: 72  KR-FMDPAILLRADYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARYHLRKTLMTD 129
            R   D   +    Y  ++R A+  K++      +L  +  + +LS  A   LR+ ++ +
Sbjct: 91  NRDIEDIKKVTTFGYAPIIRNAVEAKVTDLGVETSLKAKDMAGLLSKNAAATLREFVIAN 150

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P  IG TVE   LA + +D  LKG +   S  N   +S  Q      L +   +   FN 
Sbjct: 151 PDQIGTTVEFRFLAQSRVDGYLKGRVSRDSIENDKNISVEQLDLVDALVAANVIEKTFNL 210

Query: 188 GFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            F +  + + +RPE AG+GV+++GSL+MM +V+ L+ P+G+A++IYLEEF+ + + +  +
Sbjct: 211 DFILGSDASDARPEAAGMGVSMLGSLFMMFVVLALALPIGVAASIYLEEFAPQNWITDII 270

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L+ V
Sbjct: 271 EVNISNLAAVPSIVFGILGLAVFINYMHLPTSAPLVGGLVLTLMTLPTIIISTRASLKAV 330

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV-T 364
           P SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+ +
Sbjct: 331 PPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIAS 390

Query: 365 DYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           + P     G+    +A P QIY WA  A+  F ER +G I++LL+FL  +NT  + LR R
Sbjct: 391 NAPDSIASGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITMNTLAVILRRR 450

Query: 421 FKKRW 425
           F++RW
Sbjct: 451 FERRW 455


>gi|114765351|ref|ZP_01444468.1| phosphate ABC transporter, permease protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114542331|gb|EAU45360.1| phosphate ABC transporter, permease protein [Roseovarius sp.
           HTCC2601]
          Length = 452

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 271/428 (63%), Gaps = 16/428 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  SE  FR Y + A+     FL++LL+SI+S G  A  QT I +P+      +DP  
Sbjct: 27  KKRNASEKRFRAYGLAAIGTGLFFLVVLLTSIISNGSTAFMQTFIEVPVYLDPEALDPNG 86

Query: 72  KRFMDPAILLRAD---YNLLVRKALARKLSISD--SNHALLRQASQMLSTTARYHLRKTL 126
            R  DPA + +     YN L++ A+  ++      +++        ++S +A   LR  +
Sbjct: 87  NR--DPADISKVSTFGYNPLIQNAVFEQVQDKGIATDYEDAGDMKALISASAAAQLRDRV 144

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLD 184
           + +P LIG+TV+  +LAS+ +D  LKG +   S      +          L  DG +   
Sbjct: 145 IANPDLIGETVDFQILASSRVDGYLKGRVGRDSITQDRNIDAGHLDIVDALREDGTVHKS 204

Query: 185 FNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
           FN+ F    + + SRPE AG+GV+++GS +MML+V+ L+ P+G+A++IYLEEF+ +  F+
Sbjct: 205 FNFAFITGADASESRPEQAGLGVSMLGSFFMMLVVLFLALPIGVAASIYLEEFAPQNKFT 264

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ NI+NLA+VPSIV+GILG A  I F  +P+S  LVGGL L LMTLP+I+I+T  +L
Sbjct: 265 DFIEVNISNLAAVPSIVFGILGLAAFIQFAHLPQSAPLVGGLTLTLMTLPTIVISTRASL 324

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP SIR AALG+GASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +GMV +
Sbjct: 325 KAVPPSIRDAALGVGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMVGY 384

Query: 363 V-TDYPVGV----TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           + T+YP GV        +A P QIY WA  A+  + ER +G I++LL+FL V+N   + L
Sbjct: 385 IATNYPEGVISGFMSPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLLVMNVIAIVL 444

Query: 418 RNRFKKRW 425
           R +F++RW
Sbjct: 445 RRKFERRW 452


>gi|254420029|ref|ZP_05033753.1| phosphate ABC transporter, permease protein PstA [Brevundimonas sp.
           BAL3]
 gi|196186206|gb|EDX81182.1| phosphate ABC transporter, permease protein PstA [Brevundimonas sp.
           BAL3]
          Length = 434

 Score =  325 bits (833), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 169/426 (39%), Positives = 263/426 (61%), Gaps = 21/426 (4%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +  LK R+  E  F++Y  +A+    +FL +L+  IV++G  A +   +++P+       
Sbjct: 22  RAGLKRRHAKETRFKWYGRLAIAAAMIFLAILMVRIVAQGHTAFYTHTVTVPV------- 74

Query: 68  DPQKKRFMDPAILLRA-----DYNLLVRKALARKLSISDSNHA-LLRQASQMLSTTARYH 121
                 +MDPA + RA     ++  +  +   ++  I D       RQ   + S+  ++ 
Sbjct: 75  ------YMDPARVDRAYPQGSNFEQMAAEQQLKRWGIQDDAAGDASRQMKALFSSELKFV 128

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDG 179
               +     +IG+TV +++  S   D  LKG +   +P +  R++D Q  W  ++ ++G
Sbjct: 129 AADLVAKRSDVIGETVPLAVPLSDEADLYLKGEISKETPEDQRRLTDQQLAWLDRMQAEG 188

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN   F NG S++PE+AG+  AVVGS  M+++   ++ PLG+ +A++LEEF+ K 
Sbjct: 189 VVGSHFNTALFTNGDSTQPELAGVLGAVVGSALMLMVTALIAIPLGVGAAVWLEEFAPKN 248

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
             +  ++ NINNLA+VPSIVYG+LG A+ IN+  +PR++ +VGGL+LALM LP+++IAT 
Sbjct: 249 KLTDIIEVNINNLAAVPSIVYGLLGLALFINWMHLPRASPIVGGLVLALMALPTLVIATR 308

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL+ VP SIR AAL +GASK QTVF HVLPLAMP ++TG+ +S+A ALGETAPLL +GM
Sbjct: 309 SALKAVPPSIREAALAMGASKTQTVFSHVLPLAMPGVMTGAIISMAHALGETAPLLLIGM 368

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           V+FV   P  +     A P  IY+W   +ER F ERT  AI++LL+F+ ++NTA + LR 
Sbjct: 369 VSFVPGVPHAIDQPVGALPSLIYIWENASERAFHERTAAAIIVLLVFMIIMNTAAIILRR 428

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 429 RFERRW 434


>gi|169795177|ref|YP_001712970.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii AYE]
 gi|184158972|ref|YP_001847311.1| phosphate ABC transporter permease [Acinetobacter baumannii ACICU]
 gi|213158159|ref|YP_002320210.1| phosphate ABC transporter, permease protein [Acinetobacter
           baumannii AB0057]
 gi|239501140|ref|ZP_04660450.1| phosphate ABC transporter, permease protein [Acinetobacter
           baumannii AB900]
 gi|260556657|ref|ZP_05828875.1| phosphate ABC transporter, permease PstA [Acinetobacter baumannii
           ATCC 19606]
 gi|301345428|ref|ZP_07226169.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii AB056]
 gi|301511733|ref|ZP_07236970.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii AB058]
 gi|301596642|ref|ZP_07241650.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii AB059]
 gi|332857058|ref|ZP_08436364.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6013150]
 gi|169148104|emb|CAM85967.1| high-affinity phosphate transport protein (ABC superfamily,
           membrane) [Acinetobacter baumannii AYE]
 gi|183210566|gb|ACC57964.1| ABC-type phosphate transport system, permease component
           [Acinetobacter baumannii ACICU]
 gi|193077951|gb|ABO12864.2| high-affinity phosphate transport protein [Acinetobacter baumannii
           ATCC 17978]
 gi|213057319|gb|ACJ42221.1| phosphate ABC transporter, permease protein [Acinetobacter
           baumannii AB0057]
 gi|260409916|gb|EEX03216.1| phosphate ABC transporter, permease PstA [Acinetobacter baumannii
           ATCC 19606]
 gi|332726873|gb|EGJ58387.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6013150]
          Length = 465

 Score =  325 bits (833), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 189/438 (43%), Positives = 271/438 (61%), Gaps = 24/438 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FRF  + AV++   F+ LL  SI++KG+ A WQT +++P+ F   ++
Sbjct: 32  EKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPKVI 91

Query: 68  DPQ--------------KKRFMD-PAILLRADYN-LLVRKALARKLSISDSNHALLRQAS 111
           D                ++R++D    +   D++ L+V   +A+  S++     L    S
Sbjct: 92  DAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDSLIVNGMIAKDPSLASQRDYL----S 147

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++     
Sbjct: 148 SLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEIR 207

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K    L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI +S P+G+AS
Sbjct: 208 KLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVAS 267

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+L
Sbjct: 268 AIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLSL 327

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A AL
Sbjct: 328 MTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHAL 387

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 388 GETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 447

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 448 IGLNSLAIWLRKKFEVRW 465


>gi|169632870|ref|YP_001706606.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii SDF]
 gi|169151662|emb|CAP00452.1| high-affinity phosphate transport protein (ABC superfamily,
           membrane) [Acinetobacter baumannii]
          Length = 465

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 189/438 (43%), Positives = 272/438 (62%), Gaps = 24/438 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FRF  + AV++   F+ LL  SI++KG+ A WQT +++P+ F   ++
Sbjct: 32  EKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPKVI 91

Query: 68  DPQ--------------KKRFMDPAILL-RADYN-LLVRKALARKLSISDSNHALLRQAS 111
           D                ++R++D  + +   D++ L+V   +A+  S++     L    S
Sbjct: 92  DAGPVPVRTQGETPAHYRERYVDWQMKMGMVDWDSLIVNGMIAKDPSLASQRDYL----S 147

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++     
Sbjct: 148 SLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEIR 207

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K    L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI +S P+G+AS
Sbjct: 208 KLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVAS 267

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+L
Sbjct: 268 AIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMLLPLSAPFVGGLVLSL 327

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A AL
Sbjct: 328 MTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHAL 387

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 388 GETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 447

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 448 IGLNSLAIWLRKKFEVRW 465


>gi|215482725|ref|YP_002324923.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii AB307-0294]
 gi|332874753|ref|ZP_08442623.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6014059]
 gi|213987888|gb|ACJ58187.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii AB307-0294]
 gi|322508954|gb|ADX04408.1| pstA [Acinetobacter baumannii 1656-2]
 gi|323518940|gb|ADX93321.1| ABC-type phosphate transport system, permease component
           [Acinetobacter baumannii TCDC-AB0715]
 gi|332737014|gb|EGJ67971.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6014059]
          Length = 456

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 189/438 (43%), Positives = 271/438 (61%), Gaps = 24/438 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FRF  + AV++   F+ LL  SI++KG+ A WQT +++P+ F   ++
Sbjct: 23  EKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPKVI 82

Query: 68  DPQ--------------KKRFMD-PAILLRADYN-LLVRKALARKLSISDSNHALLRQAS 111
           D                ++R++D    +   D++ L+V   +A+  S++     L    S
Sbjct: 83  DAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDSLIVNGMIAKDPSLASQRDYL----S 138

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++     
Sbjct: 139 SLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEIR 198

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K    L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI +S P+G+AS
Sbjct: 199 KLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVAS 258

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+L
Sbjct: 259 AIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLSL 318

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A AL
Sbjct: 319 MTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHAL 378

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 379 GETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 438

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 439 IGLNSLAIWLRKKFEVRW 456


>gi|126731221|ref|ZP_01747028.1| phosphate ABC transporter, permease protein [Sagittula stellata
           E-37]
 gi|126708132|gb|EBA07191.1| phosphate ABC transporter, permease protein [Sagittula stellata
           E-37]
          Length = 451

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 175/435 (40%), Positives = 270/435 (62%), Gaps = 12/435 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S +      K+R  +E  F+ Y + A+     FL++LL +I++ G+ A  QT I +P+  
Sbjct: 17  SLTAADARTKHRNAAEKRFQMYGLAAIGTGIFFLVVLLWAILANGLTAFQQTFIEVPVYL 76

Query: 63  SETIVDPQKKRFMDPAILLRA-DYNLLVRKALARKLSIS--DSNHALLRQASQMLSTTAR 119
            E  +D    R ++    +    Y  L+++A+  ++     D+     +    ++S +A 
Sbjct: 77  DEAKLDKNGNRDIEDIKKVSTFGYQPLIQQAILAQVQDEGFDTPLEDAKDMKALISASAA 136

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             LR  ++ +P  IG+T++  +LAS+ +D   KG +     A    +         ++  
Sbjct: 137 AQLRDYVIANPDRIGQTIDFRILASSRVDGYFKGRVKRDDLARDKNIDAEHLDLVDQMRR 196

Query: 178 DGALFLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G +   FN  F    + + SRPE AG+GV+++GS +MML+V+ LS P+G+A++IYLEEF
Sbjct: 197 AGLIQKSFNTEFIFGADASESRPEQAGLGVSMLGSFFMMLVVLALSLPIGVAASIYLEEF 256

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + +  ++  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+II
Sbjct: 257 APQNRWTDLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTII 316

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L++VP SIR AALG+GASK+Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 317 ISTRASLKSVPPSIRDAALGVGASKMQAVFHHVLPLAMPGILTGTIIGLAQALGETAPLL 376

Query: 356 FVGMVAFV-TDYPVGVTD----IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV ++ T+YP G+ +      +A P QIY WA  A+  + ER +G I++LL+FL  +
Sbjct: 377 LIGMVGYIATNYPDGIAEGFMSPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLLTM 436

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR RF++RW
Sbjct: 437 NIIAIILRRRFERRW 451


>gi|311696278|gb|ADP99151.1| phosphate ABC transporter, permease protein PstA [marine bacterium
           HP15]
          Length = 424

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 178/424 (41%), Positives = 264/424 (62%), Gaps = 11/424 (2%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
            I +++LK RY  E  FR Y ++A+ +    L++L + I+ KG     +T I++ ++   
Sbjct: 9   EIVRQSLKRRYRKERRFRAYGILAIAIALGALLILFTDIIGKGYTGFVKTTITMDVQLDG 68

Query: 65  TIV---DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
            ++   DP  +R +       AD+   + +AL +++  +  +    +Q  ++++  A   
Sbjct: 69  EMMYLDDPTDERQIK-----MADFVEPLVQALIKEIPGATEDDR--KQVRELINPYASVT 121

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           LR  L  +P  +G T  ++ L   ++D  +K +    A   +++D Q  W   L   G +
Sbjct: 122 LRDALKANPEWLGTTQTMTFLTHTDVDVYVK-HAGDDAYSIKLNDQQKAWVDDLLERGII 180

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
              FN  FF  G S  P  AGI  A+VGSL  M + + LSFP+G+A+AIYLEEF+ +  F
Sbjct: 181 ETSFNDVFFSGGDSRDPSKAGILGAIVGSLLTMFVTLILSFPIGVAAAIYLEEFAPQNKF 240

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F++ NINNLA+VPSI++G+LG AV IN F MPRS  +VGGL+L LMTLP+III++  A
Sbjct: 241 TDFIEVNINNLAAVPSIIFGLLGLAVFINLFGMPRSVPVVGGLVLTLMTLPTIIISSRAA 300

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +++VP SIR AA G+GASK+Q V HHVLPLAMP +LTGS + +A+ALGETAPLL +GMVA
Sbjct: 301 IKSVPPSIREAAEGIGASKMQVVLHHVLPLAMPGMLTGSIIGMAQALGETAPLLLIGMVA 360

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D P G  D AT  PVQ++LWA   E  F+ER   AI++LL FL  +N   +W+R R 
Sbjct: 361 FIVDVPDGFFDSATVLPVQVFLWAGSPELAFIERASAAIMVLLAFLISMNALAIWMRKRL 420

Query: 422 KKRW 425
           ++RW
Sbjct: 421 ERRW 424


>gi|332869996|ref|ZP_08438972.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6013113]
 gi|332732496|gb|EGJ63747.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6013113]
          Length = 465

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 188/438 (42%), Positives = 271/438 (61%), Gaps = 24/438 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FRF  + AV++   F+ LL  SI++KG+ A WQT +++P+ F   ++
Sbjct: 32  EKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPKVI 91

Query: 68  DPQ--------------KKRFMD-PAILLRADYN-LLVRKALARKLSISDSNHALLRQAS 111
           D                ++R++D    +   D++ L+V   +A+  S++     L    S
Sbjct: 92  DAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDSLIVNGMIAKDPSLASQRDYL----S 147

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPS+IGK   ++ L  AN+D  LKG +    P +  ++     
Sbjct: 148 SLYASSEAYRLRDMVFADPSIIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEIR 207

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K    L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI +S P+G+AS
Sbjct: 208 KLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVAS 267

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+L
Sbjct: 268 AIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLSL 327

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A AL
Sbjct: 328 MTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHAL 387

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 388 GETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 447

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 448 IGLNSLAIWLRKKFEVRW 465


>gi|254453463|ref|ZP_05066900.1| phosphate ABC transporter, permease protein PstA [Octadecabacter
           antarcticus 238]
 gi|198267869|gb|EDY92139.1| phosphate ABC transporter, permease protein PstA [Octadecabacter
           antarcticus 238]
          Length = 437

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 183/426 (42%), Positives = 274/426 (64%), Gaps = 17/426 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  FR Y + A+ +  + L++LL SI+  G  +  QT++S P+      ++  +
Sbjct: 17  KKRNAAEKRFRMYGLSAIGIALIALVILLVSIIGNGASSFRQTYLSFPV-----TINAAE 71

Query: 72  KRFMDPAILLRADYNLLVRKALARKLSISDSNHALLR-QASQMLSTTARYHLRKTLMTDP 130
               + A+L  A YN +++ +L   L+ +D    +    A  M+S  A    R+ ++ DP
Sbjct: 72  IEAAESALLKTAAYNKIIQTSLLTYLTENDLLQDIPEADAFGMISDEAGATFRRFILADP 131

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANV--HRMSDYQWKWFQKLDSDGALFLDFNYG 188
              G T +++LLA+  ID   KG + +   +    ++  Q     +L   GAL   FN+ 
Sbjct: 132 EAAGTTFQLNLLANGRIDGYFKGRVTAQTALLDQNVTPAQLVLADRLADQGALVKRFNWA 191

Query: 189 FFIN--GASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           FF N   +  RPE AG+GVA++GSLYMM +V+ L+ P+G+A++IYLEEF+ K + +  ++
Sbjct: 192 FFTNPDASDQRPEAAGLGVAILGSLYMMAVVLCLALPIGVAASIYLEEFARKSWITDVIE 251

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
            NI NLA+VPSIVYGILG A+ INF ++ +S+ LVGGL+L LMTLP+III+T  +L+++P
Sbjct: 252 VNIANLAAVPSIVYGILGLAIFINFAELNQSSPLVGGLVLTLMTLPTIIISTRASLKSIP 311

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMVAFV +Y
Sbjct: 312 PSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVKEY 371

Query: 367 PVGVT-------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           P   +       + +TA PVQ++ W   ++  FVER  GAI+ LLIFL ++N   ++LR 
Sbjct: 372 PAAWSPDAGLFGEASTALPVQVFNWTQRSDPAFVERASGAIITLLIFLLIMNALAIFLRK 431

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 432 KFERRW 437


>gi|254440483|ref|ZP_05053977.1| phosphate ABC transporter, permease protein PstA [Octadecabacter
           antarcticus 307]
 gi|198255929|gb|EDY80243.1| phosphate ABC transporter, permease protein PstA [Octadecabacter
           antarcticus 307]
          Length = 437

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 181/426 (42%), Positives = 271/426 (63%), Gaps = 17/426 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  FR Y + A+ +  V L++LL SI+  G  +  QT++S P+  + T ++  +
Sbjct: 17  KKRNAAEKRFRMYGLSAIGIAIVALVILLVSIIGNGASSFRQTYLSFPVTINATEIEAAE 76

Query: 72  KRFMDPAILLRADYNLLVRKALARKLSISDS-NHALLRQASQMLSTTARYHLRKTLMTDP 130
                 A+L    YN +++ +L   L+ +D         A  M+S  A    R+ ++ +P
Sbjct: 77  S-----ALLKTGAYNKIIQISLLAYLTNNDQLQDTPEADAFGMISDEAGATFRRFILANP 131

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANV--HRMSDYQWKWFQKLDSDGALFLDFNYG 188
              G T +++LL +  ID   KG + +   +    ++  Q     +L   G L   FN+ 
Sbjct: 132 DAAGTTFQMNLLTNGRIDGYFKGRVTAQTALLDKNVTPAQLILADRLADQGTLVQRFNWA 191

Query: 189 FFIN--GASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           FF N   +  RPE AG+GVA++GSLYMM +V+ L+ P+G+A++IYLEEF+ K + +  ++
Sbjct: 192 FFTNPDASDQRPEAAGLGVAILGSLYMMAVVLCLALPIGVAASIYLEEFARKSWITDVIE 251

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
            NI NLA+VPSIVYGILG A+ INF ++ +S+ LVGGL+L LMTLP+III+T  +L+++P
Sbjct: 252 VNIANLAAVPSIVYGILGLAIFINFAELNQSSPLVGGLVLTLMTLPTIIISTRASLKSIP 311

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMVAFV +Y
Sbjct: 312 PSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVKEY 371

Query: 367 PVGVT-------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           P   +       + +TA PVQ++ W   ++  FVER  GAI+ LLIFL ++N   ++LR 
Sbjct: 372 PAAWSPDAGLFGEASTALPVQVFNWTQRSDPAFVERASGAIITLLIFLLIMNALAIFLRK 431

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 432 KFERRW 437


>gi|89069579|ref|ZP_01156923.1| phosphate ABC transporter, permease protein [Oceanicola granulosus
           HTCC2516]
 gi|89044914|gb|EAR51004.1| phosphate ABC transporter, permease protein [Oceanicola granulosus
           HTCC2516]
          Length = 442

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 187/436 (42%), Positives = 270/436 (61%), Gaps = 21/436 (4%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        + R  +E  F+ Y + A+ +   FL  LL +IVS G  A  QT + +PI  
Sbjct: 15  SLHATDARTRRRNAAEKRFKAYGLTAIGIGLAFLAALLFAIVSNGSAAFTQTFVEVPI-- 72

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSI----SDSNHALLRQASQMLSTTA 118
               +D ++    + +I+  + Y  ++  AL  +L+     +D + A L    ++LS++ 
Sbjct: 73  ---TLDAEEIAAAESSIVKTSKYREIIHGALLEQLADAGIETDMDAAEL---GKILSSSE 126

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPA--NVHRMSDYQWKWFQKLD 176
              +R   + +P  +G+TV    LAS+ +D  LKG +   A      +         +L 
Sbjct: 127 AAEMRDFALANPERMGETVRFDFLASSRVDGYLKGRVTRDALARDQNLDAAHLDLVDRLA 186

Query: 177 SDGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
             G +   FN+ F +   +S  RPE AGIGVA++GS +MML+V+ L+ P+G+A++IYLEE
Sbjct: 187 EQGIVVKRFNWDFILGADASDQRPEQAGIGVAMLGSFFMMLVVLALALPIGVAASIYLEE 246

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           F+ K   + F++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+I
Sbjct: 247 FAPKNRITDFIEVNISNLAAVPSIVFGILGLAVFIQFAGLPQSAPLVGGLVLTLMTLPTI 306

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           II+T  AL  VP SIR+AALG+GASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPL
Sbjct: 307 IISTRAALAAVPPSIRAAALGVGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPL 366

Query: 355 LFVGMVAFV-TDYPVGV----TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           L +GMV F+ ++YP GV    TD  +A P QIY WA  A+  F ER +G I++LL+FL  
Sbjct: 367 LLIGMVGFIASNYPDGVVSGFTDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLLFLMT 426

Query: 410 INTAMLWLRNRFKKRW 425
           +N   + LR RF++RW
Sbjct: 427 MNFIAILLRRRFERRW 442


>gi|149914853|ref|ZP_01903382.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           AzwK-3b]
 gi|149811041|gb|EDM70878.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           AzwK-3b]
          Length = 452

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 183/437 (41%), Positives = 277/437 (63%), Gaps = 14/437 (3%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +S +      + R  +E  FR Y + AV    +FL++LL SI+  G+GA  QT I +P+ 
Sbjct: 17  RSLNTVDARTRQRNRAEARFRAYGIAAVATGLLFLVILLGSILFNGVGAFQQTFIKVPVY 76

Query: 62  FSETIVDPQKKRFMDPAILLRA-DYNLLVRKALARKLSISDSNHALLRQAS--QMLSTTA 118
                +D   +R ++    +    Y  L+++ L   +  +D    L +     QM+S +A
Sbjct: 77  LDPAKLDKSGERDIEAIKKVSTFGYTPLIQQGLFDVVQAADIETPLAKPGDMKQMISPSA 136

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLD-- 176
              +R T++ +P LIG+TV+  +LAS+ +D  LK  ++   +V R  +   +    +D  
Sbjct: 137 AAQVRDTVIDNPDLIGQTVDFRILASSRVDGYLKDRVFR-EDVVRDKNIDVEHLDIVDGL 195

Query: 177 -SDGALFLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
            + G +  +FN  F    + + SRPE AG+GV+++GS +MML+V+ LS P+G+A++IYLE
Sbjct: 196 VASGIVAKEFNLSFITGADASESRPEQAGLGVSILGSFFMMLVVLALSLPIGVAASIYLE 255

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           EF+ +  F+  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL L LMTLP+
Sbjct: 256 EFAPQNRFTDLIEVNISNLAAVPSIVFGILGLAVFIQFAHLPQSAPLVGGLTLTLMTLPT 315

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           I+I+T  +L++VP SIR AALG+GASK+Q VFHHVLP+AMP ILTG+ + LA+ALGETAP
Sbjct: 316 IVISTRASLKSVPPSIRDAALGVGASKMQAVFHHVLPMAMPGILTGTIIGLAQALGETAP 375

Query: 354 LLFVGMVAFV-TDYPVGVT----DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           LL +GMV ++ T+YP G      D  +A P QI+ WA  A+  + ER +G I++LL+FL 
Sbjct: 376 LLLIGMVGYIATNYPDGFASGFMDPNSAMPAQIFEWAKRADPAYYERAWGGIIILLVFLM 435

Query: 409 VINTAMLWLRNRFKKRW 425
            +N   + LR RF++RW
Sbjct: 436 TMNIIAIILRRRFERRW 452


>gi|332703031|ref|ZP_08423119.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio africanus str. Walvis Bay]
 gi|332553180|gb|EGJ50224.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio africanus str. Walvis Bay]
          Length = 388

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 168/418 (40%), Positives = 255/418 (61%), Gaps = 38/418 (9%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK L  R  +E  F+ Y  +A+LV   FLI  L  ++  G  A  Q  + + + +SE  +
Sbjct: 9   KKRLGSRRRAEKRFKLYSRLAILVAISFLIFFLYDMIRTGYPAFTQAELLVEVSYSEESM 68

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +       + +  +   LV +   R + +                          + 
Sbjct: 69  EIGQ-------LAVDEEMERLVSRGFLRIIPMR-------------------------MQ 96

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            DP+L+G T +  +LA A +D  LKG        +R+ + + +  Q+   +G + + FN 
Sbjct: 97  ADPALLGVTRDEWVLAVAEVDQYLKG------KPNRLREDERETVQRFQDEGRVKMAFNT 150

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFF+NG S  PE+AG+  A+VGS Y++L+ +  SFP+G+ +A+YLEEF+     +  V+ 
Sbjct: 151 GFFVNGDSKLPEMAGVWAALVGSAYVLLLTLAFSFPVGVLTAVYLEEFAPDNRLTQIVEV 210

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA++PSI+YG+LG A+ INFF +PRS+ALVGGL LALMT+P III+T  ALR+VP 
Sbjct: 211 NINNLAAIPSILYGLLGLAIFINFFHVPRSSALVGGLTLALMTMPVIIISTRAALRSVPG 270

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AA G+GA+  Q V+HH LPLA+P +LTG+ + LARA+GE+APLL +GM+A++ D P
Sbjct: 271 SIREAAYGIGATPWQVVWHHTLPLALPGVLTGTIIGLARAIGESAPLLIIGMMAYIPDAP 330

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
             VT+ ATA P QIY W+ D++R F ERT  AI++LL  L  +N   +++RN+++++W
Sbjct: 331 HSVTEAATALPAQIYTWSTDSQRAFTERTAAAIVVLLAVLLSMNALAIYMRNKYERKW 388


>gi|259416460|ref|ZP_05740380.1| phosphate ABC transporter, permease protein PstA [Silicibacter sp.
           TrichCH4B]
 gi|259347899|gb|EEW59676.1| phosphate ABC transporter, permease protein PstA [Silicibacter sp.
           TrichCH4B]
          Length = 441

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 182/425 (42%), Positives = 269/425 (63%), Gaps = 11/425 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  F+ Y + A+ V  + L++L+++I SKG+GA  QT I+L +E  E  +D   
Sbjct: 17  KRRNAAETRFKAYGIAAIAVGLLMLVVLVTTIFSKGLGAFQQTFITLQVELLEEKLDKNG 76

Query: 72  KRFMDPAILLRA-DYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARYHLRKTLMTD 129
            R +D    +    Y  ++R A+  +++       L  +  + +LS  A   LR+ ++ +
Sbjct: 77  NRDLDDIKKVTTFGYAPIIRNAVESRVTELGVETPLKAKDMAGLLSKDAAATLREFVIAN 136

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P  IGKTVE   LA + +D  LKG +   S  N   +S  Q        +   +   FN 
Sbjct: 137 PDEIGKTVEFRFLAQSRVDGYLKGRVSRDSIENDKNISAEQLDLVDAFVAADVIEKTFNL 196

Query: 188 GFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            F +  + + +RPE AG+GV+++GSL+MM +V+ L+ P+G+A++IYLEEF+ + + +  +
Sbjct: 197 DFILGADASDARPEAAGMGVSMLGSLFMMFVVLALALPIGVAASIYLEEFAPQNWLTDII 256

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L+ V
Sbjct: 257 EVNISNLAAVPSIVFGILGLAVFINYMHLPTSAPLVGGLVLTLMTLPTIIISTRASLKAV 316

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV-T 364
           P SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+ +
Sbjct: 317 PPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIAS 376

Query: 365 DYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           + P     G+    +A P QIY WA  A+  F ER +G I++LL+FL  +NT  + LR R
Sbjct: 377 NAPDSIASGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITMNTLAVILRRR 436

Query: 421 FKKRW 425
           F++RW
Sbjct: 437 FERRW 441


>gi|262368529|ref|ZP_06061858.1| phosphate ABC transporter, permease PstA [Acinetobacter johnsonii
           SH046]
 gi|262316207|gb|EEY97245.1| phosphate ABC transporter, permease PstA [Acinetobacter johnsonii
           SH046]
          Length = 462

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 185/437 (42%), Positives = 271/437 (62%), Gaps = 24/437 (5%)

Query: 9   KNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV- 67
            +L  R+  E  FRF+   AV+    F+ LL  SI+SKG+ A WQ+ +SLP+ F   I+ 
Sbjct: 30  NSLAKRHRKEKTFRFFGFSAVIAGLFFVALLFGSILSKGLPAFWQSSMSLPVYFDPAIIT 89

Query: 68  ---DPQKKRFMDPAILLR-----------ADYN-LLVRKALARKLSISDSNHALLRQASQ 112
               P ++    PA                D++ L+V   +A+  +++     L    + 
Sbjct: 90  TGAKPVQRSGESPAQFEERFIAWQTEMGMVDWDALIVNAMIAKDPALASKRDDL----AS 145

Query: 113 MLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWK 170
           + +++  Y LR  +M DPSL+GK  ++ +LA AN+D  L G +    P    ++S    +
Sbjct: 146 LYTSSEAYRLRDMVMKDPSLVGKKEDIKVLADANVDVWLAGNIDRSLPDEQQQLSPEVRQ 205

Query: 171 WFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
              ++ + G +   FN   F++  S S P  +G+  A +GSL+MMLIVI +S P+G+ASA
Sbjct: 206 LADEMKASGVMENTFNTNIFVSPDSRSSPATSGLAGAFMGSLFMMLIVIIISIPIGVASA 265

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM 289
           IYLEEF+ K + +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+LM
Sbjct: 266 IYLEEFAPKNWITDVIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSLM 325

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP++II T  +L+ VP SIR AALGLGAS+VQTVFHHVLPLA+P ILTG+ + +A+ALG
Sbjct: 326 TLPTVIITTRASLKAVPPSIRQAALGLGASRVQTVFHHVLPLALPGILTGAIIGVAQALG 385

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLA 408
           ETAPLL +GM AFV   P    D ++A PVQI+LW  +  R F E RT  AI++LL  + 
Sbjct: 386 ETAPLLLIGMSAFVASVPTTPFDQSSALPVQIFLWQGNELRNFFEGRTAAAIIVLLAMMI 445

Query: 409 VINTAMLWLRNRFKKRW 425
            +N+  +WLR +F+ RW
Sbjct: 446 GLNSIAIWLRKKFEVRW 462


>gi|110635448|ref|YP_675656.1| phosphate ABC transporter, inner membrane subunit PstA
           [Mesorhizobium sp. BNC1]
 gi|110286432|gb|ABG64491.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chelativorans sp. BNC1]
          Length = 456

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 180/420 (42%), Positives = 262/420 (62%), Gaps = 22/420 (5%)

Query: 24  YCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD----PQKKRFMDPAI 79
           Y + A+      +++L S I++KGI A  Q  ++L + F   +++    P+ +    PA 
Sbjct: 39  YGIAAICAALGAVLILFSMILAKGIPAFTQASLTLDVFFDPAVIEVDPRPEPQPGQSPAD 98

Query: 80  LLRA-----------DYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
             +A           ++N ++  A+ +     + +    RQA  ++ T+ R+ LR   + 
Sbjct: 99  YQKARLDWERQVTLVNWNRILEAAIRQAAPDMEVDT---RQALSIVETSERFVLRDRFVE 155

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFN 186
           +P+L+G+TV+V LLASAN+D+ LKG +    P +  ++S        +L  +G +   F 
Sbjct: 156 NPALLGQTVKVDLLASANVDNWLKGNIDRSLPDSQQQLSAPARALADRLLENGTIRFAFA 215

Query: 187 YGFFIN-GASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
              F N  + S P  AG+  A +GSLYMML+VI L+ PLG+ SA+YLEEF+ K  F+  +
Sbjct: 216 TQIFTNVDSRSAPASAGLAGAFMGSLYMMLVVIVLAVPLGVGSAVYLEEFAPKNRFTDLI 275

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+LG+AV IN+F++P S  LVGGL+L LMTLP+IIIAT  ALR V
Sbjct: 276 EVNINNLAAVPSIVFGLLGAAVFINYFRLPLSAPLVGGLVLTLMTLPTIIIATRSALRAV 335

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S+R AALGLGAS++QTVFHHVLP+  P ILT + + +A+ALGETAPLL +GM AFV  
Sbjct: 336 PPSLRQAALGLGASRMQTVFHHVLPVTYPGILTATIIGVAQALGETAPLLLIGMNAFVAA 395

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            P    D +TA PVQIYLW  +  R F E RT  AI++LL  +  +N   ++LR R ++R
Sbjct: 396 VPATPLDQSTALPVQIYLWQGNENRNFFEARTSAAIIVLLGLMITLNALAIYLRTRLERR 455


>gi|110679871|ref|YP_682878.1| phosphate ABC transporter, permease protein [Roseobacter
           denitrificans OCh 114]
 gi|109455987|gb|ABG32192.1| phosphate ABC transporter, permease protein [Roseobacter
           denitrificans OCh 114]
          Length = 454

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 186/425 (43%), Positives = 263/425 (61%), Gaps = 11/425 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  F+ Y ++A+ +  + LI L+ +IVS+G GA  QT ++L +      +D   
Sbjct: 30  KKRNAAETRFKAYGLIAISIGLLMLITLIFNIVSRGTGAFQQTFVTLEVSLPADKLDKAG 89

Query: 72  KRFMDPAILLRA-DYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARYHLRKTLMTD 129
            R  D    +    Y  L+R A    ++       L  ++ + +LS  A+  LR  ++ D
Sbjct: 90  NRNPDEMRKVSTFGYAPLLRTAFEEHVAEQGYETDLSPKEMAGILSGGAQAQLRNFVLAD 149

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS++G+ V    LAS  +D  LKG +   S  N   +S  Q     +L   G +   FN 
Sbjct: 150 PSVVGQRVAFEFLASGRVDGYLKGRVSRDSIENDKNISPAQLDLVDQLVEAGTIEKRFNL 209

Query: 188 GFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            F     SS  RPE AGIGV+++GSL MML+V+ L+ P+G+A++IYLEEF+ K + +  +
Sbjct: 210 AFITGADSSGARPEAAGIGVSMIGSLVMMLVVLVLALPIGVAASIYLEEFAPKNWITDVI 269

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L+ V
Sbjct: 270 EVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIIISTRASLKAV 329

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+  
Sbjct: 330 PPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIAS 389

Query: 366 YP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            P      G+ D  +A P QIY WA  ++  F ER +G I++LL FL  +NT  + LR R
Sbjct: 390 NPPDSIAAGLMDPNSAMPAQIYEWAKRSDPAFYERAWGGIIILLGFLVSMNTLAVILRRR 449

Query: 421 FKKRW 425
           F++RW
Sbjct: 450 FERRW 454


>gi|299769228|ref|YP_003731254.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. DR1]
 gi|298699316|gb|ADI89881.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. DR1]
          Length = 465

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 187/438 (42%), Positives = 273/438 (62%), Gaps = 24/438 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FRF  + AV++   F+ LL SSI++KG+ A WQT +++PI F   ++
Sbjct: 32  EKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFSSILAKGLPAFWQTSMNVPIYFDPKVI 91

Query: 68  DPQ--------------KKRFMD-PAILLRADYN-LLVRKALARKLSISDSNHALLRQAS 111
           D                ++R++D    +   D++ ++V   +A+  +++     L    S
Sbjct: 92  DAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDGIIVNGMIAKDPALASERDYL----S 147

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++     
Sbjct: 148 SLYASSEAYRLRDMVFADPSLIGKKENINFLGDANVDVWLKGNIDRSLPDDQQQLEPEVR 207

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K   +L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI ++ P+G+AS
Sbjct: 208 KLADELKAKGVLENTFNLNLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIIAIPIGVAS 267

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+L
Sbjct: 268 AIYLEEFAPKNIVTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSL 327

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASK QT+FHHVLPLA+P I+TGS + +A AL
Sbjct: 328 MTLPTVIITTRASLKAVPPSIRQAALGLGASKFQTIFHHVLPLALPGIMTGSIIGVAHAL 387

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D +TA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 388 GETAPLLLIGMSAFVASIPATPFDQSTALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 447

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 448 IGLNSLAIWLRKKFEVRW 465


>gi|262277657|ref|ZP_06055450.1| phosphate ABC transporter, permease protein PstA [alpha
           proteobacterium HIMB114]
 gi|262224760|gb|EEY75219.1| phosphate ABC transporter, permease protein PstA [alpha
           proteobacterium HIMB114]
          Length = 420

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 178/419 (42%), Positives = 258/419 (61%), Gaps = 12/419 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET---IVD 68
           K RY +E  F+ Y ++A+ +   F+ LL+  + S G  A  +T I L + F      I +
Sbjct: 8   KKRYQAEKRFQLYGIIAISLALFFVGLLVFKVFSDGTSAFSRTMIKLDVTFDANKLGITN 67

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
              K  +D      ADY  L+ +   +  S   SN    +Q  ++LS    +  +   + 
Sbjct: 68  VNDKDEVD-----NADYYTLIYEEFIK--SYPFSNREEEKQIIKLLSPDYEFEAKNYFLK 120

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFN 186
           +   + KTV + L AS + D   KG      P +  R+S+YQ K + +   DG +   FN
Sbjct: 121 NKDQLNKTVTLLLTASDDFDQLHKGNFPRDIPEDRRRLSNYQLKIYDQFLKDGKVEKIFN 180

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
              F  G S  PE+AG G A++GSL+ +LI + +SFP+ +A+A+YLEEF+ K   +  ++
Sbjct: 181 NYLFSKGDSRDPELAGFGGAILGSLFTILICLLISFPIALAAAVYLEEFAPKNKLTDLIE 240

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
            NINNLA+VPSIV+G+LG  +L+N F++PRST LVGG+ L+LMTLP III    +L+ VP
Sbjct: 241 ININNLAAVPSIVFGLLGLGILLNVFELPRSTPLVGGIALSLMTLPRIIIPARASLKAVP 300

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            SIR  AL +GASKVQTVFHHV+PLAMP  L+G+ + LA+ALGETAPLL +GMVAFV + 
Sbjct: 301 PSIREGALAMGASKVQTVFHHVVPLAMPGTLSGTIIGLAQALGETAPLLLIGMVAFVVEL 360

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           P    D + + PVQ+YLW+  AER FVE+T   I++LL FL V+N+  ++ R +F+K+W
Sbjct: 361 PGSPMDPSASLPVQVYLWSESAERGFVEKTSATIMMLLGFLIVMNSLAVYARQKFEKKW 419


>gi|126664595|ref|ZP_01735579.1| phosphate ABC transporter, permease protein [Marinobacter sp.
           ELB17]
 gi|126630921|gb|EBA01535.1| phosphate ABC transporter, permease protein [Marinobacter sp.
           ELB17]
          Length = 425

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 180/424 (42%), Positives = 263/424 (62%), Gaps = 10/424 (2%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
            I +K+LK RY +E  FR Y ++A+ +    L +L + I+SKG     +T I+L     +
Sbjct: 9   EIVRKSLKRRYRTERRFRLYGILAIFIALASLFILFADIISKGHTGFVKTTITL-----D 63

Query: 65  TIVDPQKKRFMDPAILLR---ADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
             +D       DP  L +   AD+   +  AL  ++  + ++ A  R+  + L T A   
Sbjct: 64  VTLDSGMMYLDDPTDLDQWSSADFKAPIIAALQAQVPQA-ASAAEKRELGRFLGTFADSE 122

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           +R  L  +P L+  T  +       +   +K +  +P    ++S+ Q  W  +L   G +
Sbjct: 123 IRDLLTKNPELLNTTQTIEFPTHDRVSVYVK-HADNPQYSIKLSEQQQLWVDELLQKGII 181

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
              FN   F  G S  P  AG+  A+VGSL  ML+ + +SFP+GIA+A+YLEEF+ +   
Sbjct: 182 DTSFNDVLFSRGDSREPANAGVLGAIVGSLLTMLVTLAISFPVGIAAAVYLEEFAPQNKL 241

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F++ NINNLA+VPSI++G+LG AV IN F MPRS  +VGGL+LALMTLP+III++  A
Sbjct: 242 TDFIEVNINNLAAVPSIIFGLLGLAVFINLFGMPRSVPVVGGLVLALMTLPTIIISSRAA 301

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +++VP SIR AA G+GASK+Q V HHV+PLAMP +LTGS + +A+ALGETAPLL +GMVA
Sbjct: 302 IKSVPPSIREAAEGVGASKMQVVLHHVVPLAMPGMLTGSIIGMAQALGETAPLLLIGMVA 361

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D P G+   AT  PVQIYLWA+ +E+ FVE    AI++LL F+ ++N   +WLR R 
Sbjct: 362 FIVDVPDGLFSSATVLPVQIYLWASSSEQGFVELASAAIMVLLTFMIIMNALAIWLRKRL 421

Query: 422 KKRW 425
           ++RW
Sbjct: 422 ERRW 425


>gi|221134923|ref|ZP_03561226.1| ABC phosphate transporter inner membrane protein, PstA-like protein
           [Glaciecola sp. HTCC2999]
          Length = 429

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 174/417 (41%), Positives = 262/417 (62%), Gaps = 6/417 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           K  LK R+ SE +F+   + AVL+ F+ + +LL  I SK + A  Q  + L +++S + +
Sbjct: 19  KLGLKKRHRSEMMFKTTGLAAVLLGFMLVFVLLFDITSKALPAFHQHWVQLEVDYSASNL 78

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                R+ +   L    Y   +RKA+A +     S     RQ + + S+ A + ++  L+
Sbjct: 79  -----RYSEGDSLENLRYRSTLRKAIANQFPDVKSRRDK-RQLNGLYSSNAEFAIKDFLI 132

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            +P  +     V +    ++D  LK        + R+ + + +W + L   G +   FN 
Sbjct: 133 ANPQALNTVQNVWVRVDDDVDIYLKETTSLGEPLIRIDEKEAQWIKSLVEAGQIDKRFNI 192

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF +  S  PE+AG+  A+ G++  ML+ + LSFPLG+A+A+YLEEF+ K  ++  ++ 
Sbjct: 193 QFFTSSDSREPELAGVRGALTGTMLTMLVTLVLSFPLGVAAALYLEEFAPKNKWTDMIEV 252

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSI++G+LG AV+IN F +PRS  LVGG++L LMTLP+IIIA+  +++ VP 
Sbjct: 253 NINNLAAVPSIIFGLLGLAVIINLFGLPRSAPLVGGIVLTLMTLPTIIIASRASIKAVPP 312

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AA GLGASK+QT F HVLP+AMP ILTG+ + +A+ALGETAPLL +GMVAF+ D P
Sbjct: 313 SIREAATGLGASKIQTTFSHVLPMAMPGILTGTIIGMAQALGETAPLLMIGMVAFIVDVP 372

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             +TD +T  PVQI+LWA   ER F+ +T  AIL+LL FL ++N +  +LR RF+ +
Sbjct: 373 ASITDASTVMPVQIFLWADSPERGFLAKTSAAILVLLGFLFLMNASAAYLRRRFESK 429


>gi|163731858|ref|ZP_02139305.1| phosphate ABC transporter, permease protein [Roseobacter litoralis
           Och 149]
 gi|161395312|gb|EDQ19634.1| phosphate ABC transporter, permease protein [Roseobacter litoralis
           Och 149]
          Length = 454

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 185/425 (43%), Positives = 264/425 (62%), Gaps = 11/425 (2%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  F+ Y ++A+ +  + LI L+ +IVS+G GA  QT ++L +      +D   
Sbjct: 30  KKRNAAETRFKAYGMIAISIGLLMLITLVFNIVSRGTGAFQQTFVTLEVSLPADKLDKTG 89

Query: 72  KRFMDPAILLRA-DYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARYHLRKTLMTD 129
            R  D    +    Y  L+R A    ++       L  ++ + +LS  A+  LR  ++ D
Sbjct: 90  NRNPDEMRKVSTFGYAPLLRTAFEEHIAEKGYETDLSPKEMAGILSGGAQAQLRNFVLAD 149

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS++G+ V+   LAS  +D  +KG +   S  N   +S  Q      L  +G +   FN 
Sbjct: 150 PSVVGERVDFEFLASGRVDGYIKGRVSRDSIENDKNISPAQLDLVDLLIEEGTVEKRFNL 209

Query: 188 GFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            F     SS  RPE AG+GV++VGSL MML+V+ L+ P+G+A++IYLEEF+ K + +  +
Sbjct: 210 SFITGADSSGARPEAAGMGVSMVGSLVMMLVVLVLALPIGVAASIYLEEFAPKNWITDVI 269

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L+ V
Sbjct: 270 EVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIIISTRASLKAV 329

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+  
Sbjct: 330 PPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIAS 389

Query: 366 YP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            P      G+ D  +A P QIY WA  ++  F ER +G I++LL FL  +NT  + LR R
Sbjct: 390 NPPDSIAAGLMDPNSAMPAQIYEWAKRSDPAFYERAWGGIIILLGFLVTMNTLAVILRRR 449

Query: 421 FKKRW 425
           F++RW
Sbjct: 450 FERRW 454


>gi|288956867|ref|YP_003447208.1| phosphate transport system permease protein [Azospirillum sp. B510]
 gi|288909175|dbj|BAI70664.1| phosphate transport system permease protein [Azospirillum sp. B510]
          Length = 434

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 243/387 (62%), Gaps = 16/387 (4%)

Query: 41  SSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSIS 100
            SIV+KG GA  +  I L +              +DPA +   ++   +R+AL  +    
Sbjct: 62  GSIVAKGAGAFLEARIRLEVT-------------LDPAEIADRNFTAPLRRALHAQFP-Q 107

Query: 101 DSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--P 158
            ++ A  R  +++LS+ A Y L   +  +P+L G T  V + A   ID  +KG      P
Sbjct: 108 VTDRAGRRVLNELLSSGAPYELEAMVAKNPALAGTTRTVWVRADDQIDQLVKGGYRRDLP 167

Query: 159 ANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVI 218
                +SD +      L + GAL   FN   F  G S  PE AGIG A+VGSL  +L+ +
Sbjct: 168 EGERGLSDAKVAAADALLASGALAQGFNTTLFTAGDSREPEQAGIGGALVGSLLTLLVTM 227

Query: 219 GLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST 278
            LS P+G+A+A+YLEEF+ K  ++  ++  INNLA+VPS+++G+LG AV + FF MPRS 
Sbjct: 228 ALSVPVGVAAAVYLEEFAAKNRWTGLIEVTINNLAAVPSVIFGLLGLAVFLGFFGMPRSA 287

Query: 279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILT 338
            LVGGL++ALMTLP III+  VALR VP SIR AAL +GAS +QTV HHVLPLAMPAILT
Sbjct: 288 PLVGGLVMALMTLPVIIISARVALRAVPPSIRDAALAIGASPLQTVLHHVLPLAMPAILT 347

Query: 339 GSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFG 398
           G+ + +ARALGETAPLL +GMVAF+ D P G+TD AT  PVQIY+WA   ER F ERT  
Sbjct: 348 GTIIGMARALGETAPLLMIGMVAFIVDIPHGLTDSATVLPVQIYMWADSPERAFTERTSA 407

Query: 399 AILLLLIFLAVINTAMLWLRNRFKKRW 425
           AIL+LL  L ++N A + LR  F++RW
Sbjct: 408 AILVLLGVLILLNGAAVILRKIFERRW 434


>gi|260426144|ref|ZP_05780123.1| phosphate ABC transporter, permease protein PstA [Citreicella sp.
           SE45]
 gi|260420636|gb|EEX13887.1| phosphate ABC transporter, permease protein PstA [Citreicella sp.
           SE45]
          Length = 450

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 187/438 (42%), Positives = 269/438 (61%), Gaps = 18/438 (4%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S + +    K R  SE  FR Y + A+     FL++LLS+I+S GIGA  QT I +P+  
Sbjct: 16  SLTASDARTKRRNASEKRFRIYGLAAIGAGLFFLVVLLSAIISNGIGAFQQTFIQVPVYL 75

Query: 63  SETIVDPQKKRFMDPAILLRAD---YNLLVRKAL---ARKLSISDSNHALLRQASQMLST 116
               +D    R  DPA L +     Y  L++  L    R   I ++++        ++S 
Sbjct: 76  DPATLDKNGNR--DPADLAKVSTFGYTPLIQTGLYQLVRDAGI-ETDYEDAGDMKALISA 132

Query: 117 TARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQK 174
           +A   +R   +  P  IG TV+  +LAS+ +D  LKG +   S A    +          
Sbjct: 133 SAAAKVRDWTLAHPDRIGDTVDFEILASSRVDGYLKGRVTRESIAEDRNIDAGHLDLTDA 192

Query: 175 LDSDGALFLDFNYGFFI--NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL 232
           L   GAL   FN  F    + + SR E AG+GV+++GS +MML+V+ L+ P+G+A++IYL
Sbjct: 193 LRESGALHKSFNAEFIFGSDASESRAEQAGLGVSMLGSFFMMLVVLFLALPIGVAASIYL 252

Query: 233 EEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLP 292
           EEF+ +  F+ F++ NI+NLA+VPSIV+GILG A  I F  +P+S  +VGGL+L LMTLP
Sbjct: 253 EEFASQNKFTDFIEVNISNLAAVPSIVFGILGLAAFIQFAHLPQSAPIVGGLVLTLMTLP 312

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
           +III+T  +L+ VP SIR AALG+GASK+Q VFHHVLPLAMP ILTG+ + LA+ALGETA
Sbjct: 313 TIIISTRASLKAVPPSIRDAALGVGASKMQAVFHHVLPLAMPGILTGTIIGLAQALGETA 372

Query: 353 PLLFVGMVAFV-TDYPVGVT----DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFL 407
           PLL +GMV ++ T+YP G+        +A P QIY WA  A+  + ER +G I++LL+FL
Sbjct: 373 PLLLIGMVGYIATNYPDGLVSGFMSPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFL 432

Query: 408 AVINTAMLWLRNRFKKRW 425
            ++N   + LR +F++RW
Sbjct: 433 LIMNVIAIVLRRKFERRW 450


>gi|262278268|ref|ZP_06056053.1| high-affinity phosphate transporter [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258619|gb|EEY77352.1| high-affinity phosphate transporter [Acinetobacter calcoaceticus
           RUH2202]
          Length = 465

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 187/438 (42%), Positives = 271/438 (61%), Gaps = 24/438 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K L  R+  E  FR+    AV++   F+ LL SSI++KG+ A WQT +++PI F   ++
Sbjct: 32  EKTLATRHRKEKAFRYAGFSAVIIGLAFVALLFSSILAKGLPAFWQTSMNVPIYFDPKLI 91

Query: 68  DPQ--------------KKRFMD-PAILLRADYN-LLVRKALARKLSISDSNHALLRQAS 111
           D                ++R++D    +   D++ ++V   +A+  +++     L    S
Sbjct: 92  DAGPVPVRGQGETPAHYQERYIDWQTKMGMVDWDGIIVNGMIAKDPALAGQRDYL----S 147

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P    ++     
Sbjct: 148 SLYASSEAYRLRDMVFADPSLIGKKENLNFLGDANVDVWLKGNIDRSLPDEQQQLDPEVR 207

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K   +L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI ++ P+G+AS
Sbjct: 208 KLADELKAKGVLESTFNMSLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIIAIPIGVAS 267

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K F +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+L
Sbjct: 268 AIYLEEFAPKNFITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSL 327

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASK QT+FHHVLPLA+P I+TG+ + +A AL
Sbjct: 328 MTLPTVIITTRASLKAVPPSIRQAALGLGASKFQTIFHHVLPLALPGIMTGAIIGVAHAL 387

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 388 GETAPLLLIGMSAFVASIPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 447

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 448 IGLNSLAIWLRKKFEVRW 465


>gi|254463115|ref|ZP_05076531.1| phosphate ABC transporter, permease protein PstA [Rhodobacterales
           bacterium HTCC2083]
 gi|206679704|gb|EDZ44191.1| phosphate ABC transporter, permease protein PstA [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 432

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 185/426 (43%), Positives = 269/426 (63%), Gaps = 13/426 (3%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  +E  FR Y + A+      LILLL +I  KG+GA  QT ++L +   E  +D   
Sbjct: 8   KKRNAAETRFRAYGIAAIGAGLAMLILLLVTIFGKGLGAFQQTFVTLNVPLLEEKLDKNG 67

Query: 72  KRFMDPAILLRA-DYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARYHLRKTLMTD 129
            R ++    +    Y  L++KA+   L+       L  ++ + +LS +A   LR  ++ +
Sbjct: 68  TRDLEKIKKVSTFGYAPLLKKAMEETLTEYGIETNLKSKKQAALLSKSAAAQLRNYVLAN 127

Query: 130 PSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
             +IG+TVE + LA+A +D  LK  +   S AN   ++  Q      L +   +   FN 
Sbjct: 128 TDMIGETVEFTFLANARVDGYLKDRVTRESIANDKSINAAQLDMVDALLAAEVIEKRFNL 187

Query: 188 GFFINGASS---RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            F I GA +   RPE AG+GV+++GS +MML+V+ L+ P+G+A++IYLEEF+ K + +  
Sbjct: 188 SF-ITGADASDQRPEAAGMGVSMLGSFFMMLVVLALALPIGVAASIYLEEFAPKNWITDI 246

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI+NLA+VPSIV+GILG AV IN   +P+S  LVGGL+L LMTLP+III+T  +L++
Sbjct: 247 IEVNISNLAAVPSIVFGILGLAVFINSVHLPQSAPLVGGLVLTLMTLPTIIISTRASLKS 306

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV- 363
           VP SIR AALG+GASK+Q+VFHHVLPLA P I TG+ + LA+ALGETAPLL +GM+ F+ 
Sbjct: 307 VPPSIRDAALGVGASKMQSVFHHVLPLAAPGIFTGTIIGLAQALGETAPLLLIGMIGFIA 366

Query: 364 TDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           ++ P     G  D  +A P QIY WA  A+  F ER +G I++LL+FL  +NT  + LR 
Sbjct: 367 SNAPDSVASGFLDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITMNTIAVILRR 426

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 427 RFERRW 432


>gi|293609756|ref|ZP_06692058.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828208|gb|EFF86571.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 465

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 186/438 (42%), Positives = 271/438 (61%), Gaps = 24/438 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FRF    AV++   F+ LL  SI++KG+ A WQT +++PI F   ++
Sbjct: 32  EKSLAKRHRKEKAFRFAGFSAVIIGLAFVALLFGSILAKGLPAFWQTSMNVPIYFDPEVI 91

Query: 68  DPQ--------------KKRFMD-PAILLRADYN-LLVRKALARKLSISDSNHALLRQAS 111
           D                ++R++D    +   D++ ++V   +A+  +++     L    S
Sbjct: 92  DAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDGIIVNGMIAKDPALASQRDYL----S 147

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++     
Sbjct: 148 SLYASSEAYRLRDMVFADPSLIGKKENITFLGDANVDVWLKGNIDRSLPDDQQQLDPEVR 207

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K   +L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI ++ P+G+AS
Sbjct: 208 KLADELKAKGVLESTFNLNLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIIAIPIGVAS 267

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+L
Sbjct: 268 AIYLEEFAPKNVLTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSL 327

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASK QT+FHHVLPLA+P I+TG+ + +A AL
Sbjct: 328 MTLPTVIITTRASLKAVPPSIRQAALGLGASKFQTIFHHVLPLALPGIMTGAIIGVAHAL 387

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 388 GETAPLLLIGMSAFVASIPATPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 447

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 448 IGLNSLAIWLRKKFEVRW 465


>gi|325122978|gb|ADY82501.1| high-affinity phosphate transport protein (ABC superfamily,
           membrane) [Acinetobacter calcoaceticus PHEA-2]
          Length = 456

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 186/438 (42%), Positives = 270/438 (61%), Gaps = 24/438 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K+L  R+  E  FRF    AV++   F+ LL  SI++KG+ A WQT +++PI F   ++
Sbjct: 23  EKSLAKRHRKEKAFRFAGFSAVIIGLAFVALLFGSILAKGLPAFWQTSMNVPIYFDPKVI 82

Query: 68  DPQ--------------KKRFMD-PAILLRADYN-LLVRKALARKLSISDSNHALLRQAS 111
           D                ++R++D    +   D++ ++V   +A+  +++     L    S
Sbjct: 83  DAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDGIIVNGMIAKDPALASQRDYL----S 138

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++     
Sbjct: 139 SLYASSEAYRLRDMVFADPSLIGKKENITFLGDANVDVWLKGNIDRSLPDDQQQLDPEVR 198

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K    L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI ++ P+G+AS
Sbjct: 199 KLADDLKAKGVLESTFNLNLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIIAIPIGVAS 258

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+L
Sbjct: 259 AIYLEEFAPKNVLTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSL 318

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASK QT+FHHVLPLA+P I+TG+ + +A AL
Sbjct: 319 MTLPTVIITTRASLKAVPPSIRQAALGLGASKFQTIFHHVLPLALPGIMTGAIIGVAHAL 378

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 379 GETAPLLLIGMSAFVASIPATPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 438

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 439 IGLNSLAIWLRKKFEVRW 456


>gi|258404599|ref|YP_003197341.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfohalobium retbaense DSM 5692]
 gi|257796826|gb|ACV67763.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfohalobium retbaense DSM 5692]
          Length = 390

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 171/414 (41%), Positives = 242/414 (58%), Gaps = 38/414 (9%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K RY +E  FRFY + AV++   FL+     I+S+G  A  Q  I   I ++E   +   
Sbjct: 15  KRRYRAEKRFRFYALSAVVLACAFLVFFFFDIISQGYTAFVQARIKAEIHYTEQSAEL-- 72

Query: 72  KRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPS 131
                P   +  D    V +   R + +    H                         P 
Sbjct: 73  -----PLAAVDEDIRYFVSRGRLRTIPLEIEKH-------------------------PE 102

Query: 132 LIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFI 191
           L+G T    ++A A +D  LKG        +R+   Q ++   L ++  + L FN GFF 
Sbjct: 103 LMGTTQTEWVIADAEVDQYLKG------KSNRLKPKQKRFIDSLKANDRVKLAFNTGFFT 156

Query: 192 NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINN 251
            G S  PE+AGI  AVVGS+Y++ + +  S P+G+ +AIYLEEF+    F+  ++ NINN
Sbjct: 157 RGDSKLPEIAGIFAAVVGSIYVLSLTLLFSVPIGVMTAIYLEEFAPDNRFTQAIEVNINN 216

Query: 252 LASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRS 311
           LA++PSI++G+LG A+ INFF +PRS+A+ GGL L LMTLP III+T  ALR VP SIR 
Sbjct: 217 LAAIPSILFGLLGLAIFINFFGVPRSSAMAGGLTLGLMTLPIIIISTRAALRAVPDSIRE 276

Query: 312 AALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVT 371
            A G+GAS  Q V+HHVLPL++P ILTG+ + LA+A+GETAPLL VGM+A++ + P GVT
Sbjct: 277 GAYGVGASPWQVVWHHVLPLSLPGILTGTIIGLAQAMGETAPLLIVGMMAYIPEAPSGVT 336

Query: 372 DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           D AT  P QIY W+A + R + ERT  AI++LL  L  +N A ++LR R+++RW
Sbjct: 337 DAATVLPAQIYTWSAASLRAYAERTAAAIIVLLAVLLTLNAAAVFLRKRYERRW 390


>gi|149376560|ref|ZP_01894321.1| phosphate ABC transporter, permease protein [Marinobacter algicola
           DG893]
 gi|149359227|gb|EDM47690.1| phosphate ABC transporter, permease protein [Marinobacter algicola
           DG893]
          Length = 424

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 182/426 (42%), Positives = 267/426 (62%), Gaps = 15/426 (3%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
            I +++LK RY  E  FR Y ++A+ +    L++L   I+ KG     +T I++ +E   
Sbjct: 9   EIVRQSLKRRYRKERRFRAYGILAIAIALSALVVLFVDIIGKGYTGFTKTTITMEVELDG 68

Query: 65  TIVDPQKKRFMDPAI----LLRADYNLLVRKALARKL-SISDSNHALLRQASQMLSTTAR 119
            ++      ++D A     +  AD+   + +AL +++   ++ N   +R    +L+  A 
Sbjct: 69  EMM------YLDDATDKKQIKMADFVEPLLQALIKQVPGATEENRDAVRD---LLNPYAS 119

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDG 179
             LR  L  +P  +G T  +++LA  ++D  +K +    A   ++SD Q +W  +L    
Sbjct: 120 NELRDMLEQNPEWLGTTQTLTVLAHTDVDVYVK-HAGDDAYSIKLSDRQQRWVDQLVEKE 178

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN  FF +G S  P  AGI  A+VGSL  ML+ + LSFP+G+A+AIYLEEF+ + 
Sbjct: 179 VVQTSFNDVFFSSGDSRDPSRAGILGAIVGSLLTMLVTLVLSFPIGVAAAIYLEEFAPQN 238

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
             + F++ NINNLA+VPSI++G+LG AV IN F MPRS  +VGGL+L LMTLP+III++ 
Sbjct: 239 KLTDFIEVNINNLAAVPSIIFGLLGLAVFINLFGMPRSVPVVGGLVLTLMTLPTIIISSR 298

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+++VP SIR AA G+GASK+Q V HHVLPLAMP +LTGS + +A+ALGETAPLL +GM
Sbjct: 299 AAIKSVPPSIREAAEGIGASKMQVVLHHVLPLAMPGMLTGSIIGMAQALGETAPLLLIGM 358

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P G  D AT  PVQ++LWA   E  F+ER   AI++LL FL  +N   +WLR 
Sbjct: 359 VAFIVDVPDGFFDSATVLPVQVFLWAGSPELAFIERASAAIMVLLAFLVSMNALAIWLRK 418

Query: 420 RFKKRW 425
           R ++RW
Sbjct: 419 RLERRW 424


>gi|307294610|ref|ZP_07574452.1| phosphate ABC transporter, inner membrane subunit PstA [Sphingobium
           chlorophenolicum L-1]
 gi|306879084|gb|EFN10302.1| phosphate ABC transporter, inner membrane subunit PstA [Sphingobium
           chlorophenolicum L-1]
          Length = 414

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 180/423 (42%), Positives = 261/423 (61%), Gaps = 29/423 (6%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF--SET 65
           +K +  RY SE  F+   ++AV +   FL  LL S++  G+    +T I++ ++F  S  
Sbjct: 16  RKRIARRYASERRFKIAGLLAVALSAAFLAFLLFSMMGNGLRGFTRTEIAVKVDFPASPL 75

Query: 66  IVDPQKKRFMDPAILLRADYNL-LVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
           ++DP      D A+   A+ NL +V   + +K        AL   A + +S TA   LR 
Sbjct: 76  LLDPNA--ITDQAL---ANANLPMVTGEVVKK--------ALGANAEEWVSPTAWTVLRD 122

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALK--GYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
            +  DP ++ +TV + L A+  ID A K  G   + A V R           L   G L 
Sbjct: 123 AIKADPKILAQTVTIKLPAATAIDLAAKSDGSPEAEAAVAR-----------LKKAGLLT 171

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+GF      + P   GI  A  GSL  ML+ + LSFP+G+A+A+YLEE++ K + +
Sbjct: 172 TGVNWGFLTASDGTDPTQVGIWGAFKGSLLTMLVTLALSFPVGVATAVYLEEYARKNWLT 231

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ +INNLA+VPSI++G+LG ++ +NF  +PRS ALVGG+ LALMT+P I+IA   A+
Sbjct: 232 DIIEVSINNLAAVPSIIFGLLGLSIFLNFLALPRSAALVGGMTLALMTMPVIVIAGRNAI 291

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           ++VP SIR AALG+GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AF
Sbjct: 292 KSVPPSIRDAALGIGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAF 351

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P G+TD AT  PVQI+LW+ +  + FVE+T  AI++LL+FL  +N   ++LRN+F+
Sbjct: 352 IATPPGGITDPATVLPVQIFLWSDEVSKGFVEKTSAAIIVLLVFLLAMNGLAIYLRNKFE 411

Query: 423 KRW 425
           +RW
Sbjct: 412 RRW 414


>gi|120556532|ref|YP_960883.1| phosphate ABC transporter, inner membrane subunit PstA
           [Marinobacter aquaeolei VT8]
 gi|120326381|gb|ABM20696.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Marinobacter aquaeolei VT8]
          Length = 424

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 167/393 (42%), Positives = 245/393 (62%), Gaps = 11/393 (2%)

Query: 36  LILLLSSIVSKGIGALWQTHISLPIEFSETIV---DPQKKRFMDPAILLRADYNLLVRKA 92
           L++L + I+ KG  A  +T ++L ++     +   D   +R M       AD+   + +A
Sbjct: 40  LVILFADIIGKGHTAFIKTTVTLEVDIDGEAMYLDDASDERQMK-----MADFVEPLIRA 94

Query: 93  LARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALK 152
           L ++  I ++  +       +++  A   LR  L  +P L+  T  ++ L+  ++D  +K
Sbjct: 95  LMKE--IPEAGESDRDDVRDLINPYASNQLRDALRENPELLNTTQTMTFLSHTDVDVYVK 152

Query: 153 GYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLY 212
                  ++ ++++ Q  W   L   G +   FN  FF  G S  P  AGI  A+VGSL 
Sbjct: 153 HAGDENYSI-KLNEKQQAWVDTLYERGVVDTGFNDVFFSRGDSRDPSRAGILGAIVGSLL 211

Query: 213 MMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFF 272
            M++ + LSFP+G+A+AIYLEEF+ +   + F++ NINNLA+VPSI++G+LG AV IN F
Sbjct: 212 TMVVTLALSFPIGVAAAIYLEEFAPQNKLTDFIEVNINNLAAVPSIIFGLLGLAVFINLF 271

Query: 273 KMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLA 332
            MPRS  +VGGL+L LMTLP+III++  A+++VP SIR AA G+GASK+Q V HHVLPLA
Sbjct: 272 GMPRSVPVVGGLVLTLMTLPTIIISSRAAIKSVPPSIREAAEGIGASKMQVVLHHVLPLA 331

Query: 333 MPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPF 392
           MP +LTGS + +A+ALGETAPLL +GMVAF+ D P G  D AT  PVQ++LWA   E  F
Sbjct: 332 MPGMLTGSIIGMAQALGETAPLLLIGMVAFIVDVPDGFFDSATVLPVQVFLWAGSPELAF 391

Query: 393 VERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           +ER   AI++LL FL  +N   +WLR R ++RW
Sbjct: 392 IERASAAIMVLLTFLIGMNALAIWLRKRLERRW 424


>gi|256830446|ref|YP_003159174.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfomicrobium baculatum DSM 4028]
 gi|256579622|gb|ACU90758.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfomicrobium baculatum DSM 4028]
          Length = 386

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 174/423 (41%), Positives = 255/423 (60%), Gaps = 38/423 (8%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S  I+ ++L+ R   E  F+    +A+ V  +FL++  + I+ +G  A  QT I   + F
Sbjct: 2   SMPIDPRSLRKRKNKESQFKALSYMAIAVAGIFLVVFFADIIRQGYTAFMQTEIRTNVTF 61

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           S++I D       DP            R AL RK         L+   S+ ++      L
Sbjct: 62  SQSIFD-------DP------------RSALDRK---------LIPLVSRGVTRILPMQL 93

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
           R+    +P L+G T EV +LA+A +D  +KG        +R+   +     +L ++G++ 
Sbjct: 94  RE----NPQLLGTTSEVWVLANAEVDQYIKG------KPNRLKPKEIAQVDELVAEGSIK 143

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
             FN GFF NG S   E+AGI  A VG+LY++ I    SFP G+ +AIYLEEF+      
Sbjct: 144 KAFNVGFFTNGDSKLAEMAGILSAAVGTLYLLGITFIFSFPAGVMAAIYLEEFAPDNRLM 203

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             V+ NINNLA++PSI++G+LG A+ INF  +PRS+ALVGGL LALMTLP III+T  A+
Sbjct: 204 HIVEVNINNLAAIPSILFGLLGLAIFINFMGLPRSSALVGGLTLALMTLPVIIISTRAAI 263

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P SIR  AL LGA+  Q V+ H+LPL++P ILTG+ + LARA+GETAPLL +GMVA+
Sbjct: 264 RAIPDSIREGALALGATHWQVVWDHILPLSLPGILTGTIIGLARAIGETAPLLIIGMVAY 323

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           + D P G+T  AT  P QIY+W++++ R F ERT   I++LL+ L  +N   + LRN+++
Sbjct: 324 IQDMPRGLTSAATVLPAQIYVWSSESIRAFTERTSAGIIVLLVVLLSMNALAILLRNKYE 383

Query: 423 KRW 425
           ++W
Sbjct: 384 RKW 386


>gi|331006820|ref|ZP_08330080.1| Phosphate transport system permease protein PstA [gamma
           proteobacterium IMCC1989]
 gi|330419372|gb|EGG93778.1| Phosphate transport system permease protein PstA [gamma
           proteobacterium IMCC1989]
          Length = 429

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 171/429 (39%), Positives = 256/429 (59%), Gaps = 9/429 (2%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           +K+     + L  RY +E  FR Y ++++    + ++ L ++I+ KG+      ++ + +
Sbjct: 6   IKTIDKVNRTLGKRYRAEKRFRLYGMLSIGFGLLCVLFLFTNIIGKGLSGFTYHYLQISV 65

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR- 119
           E   T ++       D   +L  +Y+ +V++       +S         A ++LS     
Sbjct: 66  EMDATTLEISDTS--DLNQILAGNYSAVVKRGAYEYFDVSSRRDK--SAARKLLSVDGTG 121

Query: 120 YHLRKTLMTD-PSLIGKTVEVSLLASANIDSALK--GYLYSPANVHRMSDYQWKWFQKLD 176
           Y L+     D   +I     V  L    +D  LK  G    P   H  S+ Q +W     
Sbjct: 122 YLLQDRFKVDAKEIINTKSMVWALVDDKVDFYLKRLGEPGEPGK-HEFSEKQLQWIHAAV 180

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
             G L   FN+ FF NG S+  E AGI  AV+GS Y++L+ + LSFP+GIA+AIYLEE++
Sbjct: 181 ESGDLQKRFNWAFFNNGDSAHSEEAGIRGAVMGSFYLLLVTLALSFPIGIATAIYLEEYA 240

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K  ++  ++ NINNLA+VPSI++G+LG A+ + FF  PRST LVGG +L LMTLP+III
Sbjct: 241 PKNKWTDLIEVNINNLAAVPSIIFGLLGLAIFLAFFGFPRSTPLVGGFVLTLMTLPTIII 300

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           ++  +++ VP SIR AA GLG+SK+Q   HHVLPLAMP +LTG+ + LA+ALGE+APLL 
Sbjct: 301 SSRASIKAVPPSIREAAYGLGSSKMQVTLHHVLPLAMPGMLTGTIIGLAQALGESAPLLM 360

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           +GM AF+ + P GV+D ATA P+QI+ W  +A+  F E+   AIL+LL+FL V+NT  +W
Sbjct: 361 IGMAAFIPEVPTGVSDPATALPMQIFQWFRNADAGFSEKASAAILVLLMFLIVMNTLAVW 420

Query: 417 LRNRFKKRW 425
            R R ++RW
Sbjct: 421 ARRRLERRW 429


>gi|71083867|ref|YP_266587.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062980|gb|AAZ21983.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
          Length = 419

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 175/421 (41%), Positives = 260/421 (61%), Gaps = 8/421 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           ++ LK R+ +E  F+ Y + ++L+   F+I LL++I SKG GA  +T I + + F    +
Sbjct: 4   EQRLKKRHNAEKRFKLYGLTSILLAIFFVIFLLNAIFSKGSGAFLKTTIDVEVNFDADTL 63

Query: 68  DPQKKRFMDPAILLRADY-NLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTL 126
           +  +   ++   L   DY  L +   L  K     +   LL     + S    Y +R  L
Sbjct: 64  ELSESPPLED--LENTDYYELAIDSILKVKKVNGLTEEKLL---INLFSPDYEYEIRNFL 118

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLD 184
           + +P  + +T  + L AS + D   KG      P    R++++Q   + +L ++G +   
Sbjct: 119 LDNPKALNQTTVLKLTASDDFDQLHKGNYPRELPEERRRINNFQLNLYDELVNEGKVNKI 178

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN   F  G S  PE+AGIG A+VGS + ++I + LSFP+ IA+++YLEEF+ K   + F
Sbjct: 179 FNSYLFTKGDSRNPELAGIGGALVGSFFTIVITLLLSFPIAIAASVYLEEFAPKNKITDF 238

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPSIV+G+LG  +L+  F +PRST LV G+ LALMTLP III    +L+ 
Sbjct: 239 IEININNLAAVPSIVFGLLGLGILLGTFHLPRSTPLVAGITLALMTLPRIIIPCRASLKA 298

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR  AL +GASKVQ+V HHVLPLA+P  L+G+ + LA+ALGETAPL+ +GMVAFV 
Sbjct: 299 VPPSIREGALAIGASKVQSVTHHVLPLAIPGTLSGTIIGLAQALGETAPLILIGMVAFVV 358

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P   TD + + PVQ+YLW+  AER FVE+T   I++LL FL  +N   ++LR +F+++
Sbjct: 359 DIPSIPTDPSASLPVQVYLWSEQAERGFVEKTSATIMVLLSFLITLNFIAVYLRQKFERK 418

Query: 425 W 425
           W
Sbjct: 419 W 419


>gi|254455835|ref|ZP_05069264.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082837|gb|EDZ60263.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 423

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 176/425 (41%), Positives = 261/425 (61%), Gaps = 9/425 (2%)

Query: 6   INKKN-LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
           IN++  L  RY SE  F+FY   A+++  +FL + L  I S G  A  +T I++PI +  
Sbjct: 2   INREEFLNKRYKSEKRFQFYGKSAIVLALLFLAIFLFKIFSTGYTAFQKTWITIPINYDP 61

Query: 65  TIV--DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
             +  D  +K    P+I    D         +      ++N   +    +M +      +
Sbjct: 62  EFMYLDADQK----PSIQDLEDSEYFDVGIESFAALDQNANEDQITDIKRMFAFIFEEEI 117

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGA 180
           +  ++++P   GK VEV L AS ++D   KG      P    R++DYQ K F KL ++G 
Sbjct: 118 KYHILSNPDDFGKIVEVKLTASDDLDQVFKGNYPRELPEERRRVTDYQLKIFDKLSAEGK 177

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           +  +FN+ FF N  S   E+AGI  + +GSL+ +L+ + +SFP+ + +AIYLEEF+ K  
Sbjct: 178 VKSNFNFSFFTNADSREAELAGIASSFMGSLFSILVCLAVSFPVALLAAIYLEEFAPKNR 237

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            + F++ NINNLA+VPSIV+G+LG  VL+  F +PRST LVGG+ L+LMTLP+IIIA   
Sbjct: 238 LTDFIEVNINNLAAVPSIVFGLLGLGVLLAVFGLPRSTPLVGGITLSLMTLPTIIIAARA 297

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           +L+ VP SIR AAL +GAS++QT  HH +PL++P  L+G+ + LA+ALGETAPL+ +GMV
Sbjct: 298 SLKAVPPSIREAALAMGASRMQTTLHHTVPLSLPGTLSGTIIGLAQALGETAPLILIGMV 357

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AFV   P    D A + PVQIY+WA  AER FVE+    I++LLIFL ++N     +R++
Sbjct: 358 AFVNTIPGSPMDPAASLPVQIYIWAESAERGFVEKVSACIMVLLIFLVLMNLVAQMVRHK 417

Query: 421 FKKRW 425
           F+K+W
Sbjct: 418 FEKKW 422


>gi|291287536|ref|YP_003504352.1| phosphate ABC transporter, inner membrane subunit PstA
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290884696|gb|ADD68396.1| phosphate ABC transporter, inner membrane subunit PstA
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 387

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 250/409 (61%), Gaps = 38/409 (9%)

Query: 17  SEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMD 76
            E LFRF  + A+++   FL+  L+ I   G  A  QT I + + +     + +  +F  
Sbjct: 17  QEKLFRFLAMFAIILATSFLVFFLADITRTGYSAFQQTEIQVDVTY-----NAETSKFTH 71

Query: 77  PAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKT 136
            A+    DY  L+ +   R + +                          +  +P L+  T
Sbjct: 72  LAV--PKDYQRLISRGFLRLIPLE-------------------------IKANPELMNTT 104

Query: 137 VEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASS 196
           V+  ++A+A +D  +K        V+R+   Q  + + L ++G + + FN GFF NG S 
Sbjct: 105 VKRWIIATAEVDQYMKD------KVNRLKPDQKAFVESLKANGDVRMSFNTGFFTNGDSK 158

Query: 197 RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVP 256
            PE+AGI  AV+GS+Y++L+ +  S P+G+ +AIYLEEF+   +F+  ++ NINNLA++P
Sbjct: 159 LPEIAGIFSAVIGSVYVLLLTMLFSVPVGVMTAIYLEEFAPDNWFTRTIEVNINNLAAIP 218

Query: 257 SIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
           SI++G+LG A+ INFF +PRS+AL GGL LALMTLP III+T  ALR+VP +IR  A G+
Sbjct: 219 SIIFGLLGLAIFINFFGVPRSSALAGGLTLALMTLPVIIISTRAALRSVPDNIRQGAQGV 278

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATA 376
           GAS  Q V+HHVLPL++P ILTGS + LA+A+GETAPLL +GM+A++ + P G+T+ AT 
Sbjct: 279 GASGWQVVWHHVLPLSLPGILTGSIIGLAQAMGETAPLLIIGMLAYIPEAPGGITEAATV 338

Query: 377 FPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P QIY W+  + R + ERT   I++LL  L V+N   +W+RNRF+++W
Sbjct: 339 LPAQIYTWSGTSLRAYTERTALGIMVLLSVLLVLNACAVWIRNRFERKW 387


>gi|330813173|ref|YP_004357412.1| phosphate transport system permease protein PstA [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486268|gb|AEA80673.1| phosphate transport system permease protein PstA [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 420

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/426 (39%), Positives = 268/426 (62%), Gaps = 16/426 (3%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
            ++ LK RY +E  F+ Y +++V    +F+ +L+  + S+G GA  +T I L ++ S+  
Sbjct: 3   KEQRLKKRYSAEKRFKAYGIISVCAALLFVGILVFKVFSEGSGAFVKTAIQLELDLSKEK 62

Query: 67  VD----PQKKRFMDPAILLRADYNLL-VRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           ++    P K+ F +      A  ++L +  A+  K           ++   + S+   Y 
Sbjct: 63  LNLPEKPSKEDFENIDFYDFAQQHILKIYPAITTKEK---------KELLTLFSSDFEYE 113

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           ++  ++++ +LIG+ V   + A++++D   KG      P    ++S++Q   +  L  + 
Sbjct: 114 VKDFILSNKNLIGQKVFFKITAASDLDQMHKGNYTRDIPEERRKVSNFQLTIYDFLLKEN 173

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN   F NG S  PE+AGIG A++GS + +++ + +SFP+ + +A+YLEEF+ K 
Sbjct: 174 KISKIFNNYLFSNGDSRNPEIAGIGGAMLGSFFSIIVCLIISFPIALLAAVYLEEFAPKN 233

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            F+ F++ NINNLA+VPSIV+G+LG  +L+N F++PRST+LVGG+ LALMTLP III   
Sbjct: 234 AFTDFIEININNLAAVPSIVFGLLGLGILLNVFELPRSTSLVGGITLALMTLPRIIIPCR 293

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L+ VP SIR  AL +GASKVQ+V HHV+PLAMP  L+G+ + LA+ALGETAPLL +GM
Sbjct: 294 ASLKAVPPSIREGALAVGASKVQSVMHHVVPLAMPGTLSGTIIGLAQALGETAPLLLIGM 353

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAFV   P    D +++ PVQ+YLW+  AER FVE+T   I++LL FL  +N+  ++ R 
Sbjct: 354 VAFVVQVPGTPMDPSSSLPVQVYLWSESAERGFVEKTSATIMMLLGFLIAMNSIAVYARQ 413

Query: 420 RFKKRW 425
           +F+K+W
Sbjct: 414 KFEKKW 419


>gi|294012874|ref|YP_003546334.1| phosphate transport system permease protein [Sphingobium japonicum
           UT26S]
 gi|292676204|dbj|BAI97722.1| phosphate transport system permease protein [Sphingobium japonicum
           UT26S]
          Length = 414

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 173/404 (42%), Positives = 246/404 (60%), Gaps = 31/404 (7%)

Query: 28  AVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNL 87
           AVL+   FL  LL ++V  G+     T I++ ++F      P     +DP        N 
Sbjct: 36  AVLLSAAFLAFLLFTMVGNGLRGFTGTEIAVKVDF------PASPLLLDP--------NA 81

Query: 88  LVRKALARK----LSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLA 143
           +  +ALA      ++      AL   A Q ++ TA   LR  +  DP ++ +TV + L A
Sbjct: 82  ITDQALANANLPMVTGEVVKKALGADAEQWVAPTAWTALRDAIKADPKILAQTVTIRLPA 141

Query: 144 SANIDSALK--GYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVA 201
           +  ID A K  G   + A V R           LD  G L    N+GF      + P   
Sbjct: 142 ATAIDLAAKSDGSPEAEAAVAR-----------LDKAGLLTTGINWGFLTASDGTDPTQV 190

Query: 202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYG 261
           GI  A  GSL  ML+ + LSFP+G+A+A+YLEE++ K + +  ++ +INNLA+VPSI++G
Sbjct: 191 GIWGAFKGSLLTMLVTLALSFPIGVATAVYLEEYARKNWMTDIIEVSINNLAAVPSIIFG 250

Query: 262 ILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKV 321
           +LG ++ +NF  +PRS ALVGG+ LALMT+P I+IA   A+++VP SIR AALG+GAS V
Sbjct: 251 LLGLSIFLNFLHLPRSAALVGGMTLALMTMPVIVIAGRNAIKSVPPSIRDAALGIGASPV 310

Query: 322 QTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQI 381
           Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AF+   P G+TD AT  PVQI
Sbjct: 311 QVVFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFIATPPGGITDPATVLPVQI 370

Query: 382 YLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           +LW+ +  + FVE+T  AI++LL+FL  +N   ++LRN+F++RW
Sbjct: 371 FLWSDEVSKGFVEKTSAAIIVLLVFLLAMNGLAIYLRNKFERRW 414


>gi|94495741|ref|ZP_01302321.1| probable phosphate ABC transporter, permease protein (PstA)
           [Sphingomonas sp. SKA58]
 gi|94425129|gb|EAT10150.1| probable phosphate ABC transporter, permease protein (PstA)
           [Sphingomonas sp. SKA58]
          Length = 400

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 179/423 (42%), Positives = 265/423 (62%), Gaps = 29/423 (6%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF--SET 65
           +K +  RY +E  FR   + AVL+   FL  LL +++  G+    +T I+L ++F  S  
Sbjct: 2   RKRIARRYAAERRFRLLGLGAVLLSAAFLAFLLVTMMGNGLRGFTRTEIALKVDFPASPL 61

Query: 66  IVDPQKKRFMDPAILLRADYNL-LVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
           ++DPQ     D A+   A+ NL +V   +A K+        L ++A   L+ TA   LR 
Sbjct: 62  LLDPQA--ITDEAL---ANANLPMVTSTVAEKM--------LGKEADAWLAPTAWTSLRD 108

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALK--GYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
            +  DP+++ +T  + + AS +ID A K  G   + A V R++             G L 
Sbjct: 109 AIKADPTILNRTDVIRVPASTDIDLAAKSDGTPAAEAAVKRLTQA-----------GILS 157

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
             FN+ F  +   + P   GI  A  GSL  ML+ + LSFP+G+A+A+YLEE++ K +++
Sbjct: 158 TGFNWSFLSSSDGTDPTQVGIWGAFKGSLLTMLVTLVLSFPIGVATALYLEEYAPKAWWT 217

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ +INNLA+VPSI++G+LG ++ +N   +PRS A+VGG+ LALMT+P I+IA   A+
Sbjct: 218 DIIEVSINNLAAVPSIIFGLLGLSIFLNVLHLPRSAAVVGGMTLALMTMPVIVIAGRNAI 277

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           ++VP SIR AALG+GAS VQ VF HVLPLA+P ILTG+ + +ARALGETAPLL +GM AF
Sbjct: 278 KSVPPSIRDAALGIGASPVQVVFQHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAF 337

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P GVTD AT  PVQI+LW+ +  + FVE+T  AI++LL+FL  +N   ++LRN+F+
Sbjct: 338 IATPPGGVTDPATVLPVQIFLWSDEVSKGFVEKTSAAIIVLLVFLLAMNGLAIYLRNKFE 397

Query: 423 KRW 425
           KRW
Sbjct: 398 KRW 400


>gi|144900228|emb|CAM77092.1| ABC-type phosphate transport system [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 309

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 151/298 (50%), Positives = 205/298 (68%), Gaps = 2/298 (0%)

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYSPANVH--RMSDYQWKWFQKLDSDGALFLDFNY 187
           PSL+G T  + L+A  ++D A+KG++   A     R++D Q  W   L+  G +   FN 
Sbjct: 12  PSLLGSTQSIWLVADDDVDMAMKGHITRTAGAEGSRLTDAQLGWLDALEKKGDVAKKFNT 71

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
             F  G S  PE AG+  AVVGS + + I + + FPLG+A+A+YLEEF+ K  ++  ++ 
Sbjct: 72  ALFTVGDSREPEQAGLWGAVVGSFFSLSITLLVCFPLGVATAVYLEEFAPKNRWTDLIEV 131

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPS+V+G+LG A+ +NFF  PRS  LVGGL+LAL++LP+IIIA   A++ VP 
Sbjct: 132 NINNLAAVPSVVFGLLGLAIFLNFFGFPRSAPLVGGLVLALISLPTIIIAGRAAMKAVPP 191

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALGLGASK+Q V  HVLPL+MP ILTG+ + +A ALGETAPLL +GMVAF+ D P
Sbjct: 192 SIREAALGLGASKLQMVTDHVLPLSMPGILTGTILGMAHALGETAPLLMIGMVAFIVDIP 251

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +   PVQ+YLWA   ER FVERT  AI++LL FL ++N   + LR +F++RW
Sbjct: 252 ASPLDPSAVLPVQVYLWADSPERAFVERTSAAIMVLLFFLGMMNVVAILLRKKFERRW 309


>gi|254509901|ref|ZP_05121968.1| phosphate ABC transporter, permease protein PstA [Rhodobacteraceae
           bacterium KLH11]
 gi|221533612|gb|EEE36600.1| phosphate ABC transporter, permease protein PstA [Rhodobacteraceae
           bacterium KLH11]
          Length = 443

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 258/428 (60%), Gaps = 28/428 (6%)

Query: 14  RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKR 73
           R  +E  FR Y ++A+     FLI+L +SI+S+GI A  +T +S  ++F+ T   PQ++ 
Sbjct: 28  RANAEKRFRAYGIIAIATGLFFLIVLFASILSQGIPAFQRTVVS--VDFTLT---PQQQE 82

Query: 74  FMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLI 133
             +  +     Y+ L    L  +L+           A + L       +R     +P  +
Sbjct: 83  EAEGTLFKTKAYSDLFIAELNAELAERGITVDFDEAAIERLLGKVGGTIRTFYADNPDKL 142

Query: 134 GKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSD--------GALFLDF 185
           G+ +   L AS+ +D   KG       V R +    ++ Q  D D        G +   F
Sbjct: 143 GEPIGFDLTASSRVDGYFKG------RVSRDTLQDSRFLQLSDLDLVDALEEAGIIKQVF 196

Query: 186 NYGFFINGASS---RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
           N+ F I GA S    P  AGIG +VVGS +MML+V+GLS P+G+A++IYLEEF+ +  F+
Sbjct: 197 NWPF-ITGADSGVDNPGGAGIGASVVGSFFMMLVVLGLSLPIGVAASIYLEEFAPQNKFT 255

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+T  +L
Sbjct: 256 DLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIISTRASL 315

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F
Sbjct: 316 KAVPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGF 375

Query: 363 VT-DYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           V   YP     G T+  +A P QIY WAA A+  F E+ +G I++LL+FL  +N   + L
Sbjct: 376 VARGYPDGFLAGFTEPNSAMPAQIYTWAARADVGFYEKAWGGIIILLMFLLTMNIIAIIL 435

Query: 418 RNRFKKRW 425
           R RF++RW
Sbjct: 436 RRRFERRW 443


>gi|307941518|ref|ZP_07656873.1| phosphate ABC transporter, permease protein PstA [Roseibium sp.
           TrichSKD4]
 gi|307775126|gb|EFO34332.1| phosphate ABC transporter, permease protein PstA [Roseibium sp.
           TrichSKD4]
          Length = 446

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 182/430 (42%), Positives = 254/430 (59%), Gaps = 28/430 (6%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R  +E  FR Y + A+ +   FL++L  SI+S+G+ A  +T + +    ++   D  +
Sbjct: 29  RIRNAAEKRFRAYGMTAIGIGLFFLVVLAYSIISEGMPAFSRTVMKVEFTLTQEQYDAAE 88

Query: 72  KRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPS 131
           K            Y  +   AL  +L  S  +    + A   L       +R     +P 
Sbjct: 89  KELFK-----TKAYESIFISALKSQLDASGISVPFDKDAIGRLVGKPGGTIRSFYKENPD 143

Query: 132 LIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSD--------GALFL 183
            +GK V   L AS+ +D    GY+        M+D   ++ QK D D        G +  
Sbjct: 144 QLGKNVAFELAASSRVD----GYINGRVTRENMTDS--RFLQKSDLDIVDALVKAGIIVN 197

Query: 184 DFNYGFFINGASS---RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
            FN+ F I GA S    P  AGIG +VVGS +MML+V+ LS P+G+A++IYLEEF+ +  
Sbjct: 198 VFNWDF-ITGADSGVDNPGGAGIGASVVGSFFMMLVVLFLSLPIGVAASIYLEEFAPQNK 256

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            +  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+T  
Sbjct: 257 ITDLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIISTRA 316

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           +L+ VP SIR AALG+GASK+Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +GMV
Sbjct: 317 SLKAVPPSIRDAALGIGASKMQAVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMV 376

Query: 361 AFVT-DYPVGVT----DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            FV   YP G+     D  +A P QIY WAA A+  F E+ +G I++LL+FL  +N   +
Sbjct: 377 GFVARGYPDGIVQGFIDPNSAMPAQIYTWAARADFAFYEKAWGGIIVLLVFLLTMNILAI 436

Query: 416 WLRNRFKKRW 425
            LR RF++RW
Sbjct: 437 ILRRRFERRW 446


>gi|218887653|ref|YP_002436974.1| phosphate ABC transporter inner membrane protein PstA
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758607|gb|ACL09506.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 389

 Score =  303 bits (775), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 173/424 (40%), Positives = 253/424 (59%), Gaps = 41/424 (9%)

Query: 4   FSINKKNL-KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           F I++K L + R  +E  FR   + A+ +   FL+  L  I  KG  A  Q  + + + +
Sbjct: 5   FGIDEKKLLRKRRAAETRFRLCAIFALFLAGAFLVFFLFDIGRKGYPAFQQAELLVSVNY 64

Query: 63  S-ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           + E   +P     MDP      D   +V ++  R +               M++  +R  
Sbjct: 65  TVEAHDNPYAA--MDP------DTVQVVSRSFTRLIP-------------SMMAENSR-- 101

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
                     LIG T EV +LASA+ D  LKG        +R+          +  +G  
Sbjct: 102 ----------LIGTTQEVWVLASADTDQYLKG------RPNRLKPRHQALVDTMRQEGKA 145

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            L FN+GFF +G S  PE+AGI  A +GSLY++LI + +SFP+G+  A+YLEEF+     
Sbjct: 146 RLAFNWGFFESGDSKLPELAGIRAAAIGSLYVLLITLAISFPVGVMCAVYLEEFAPDNRL 205

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NINNLA++PSI+YG+LG A+ INF  + RS+ALVGGL L+LMTLP+III+T  A
Sbjct: 206 TQIIEVNINNLAAIPSILYGLLGLAIFINFMGVARSSALVGGLTLSLMTLPAIIISTRAA 265

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R++P SIR AAL LGA+ +Q V+HHVLPL++P ILTG+ + LARA+GETAPLL VGM+A
Sbjct: 266 IRSIPPSIREAALALGATPLQVVWHHVLPLSLPGILTGTIIGLARAMGETAPLLIVGMMA 325

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           ++ + P      AT  P QI+ WA+D++R F ERT   IL+LL+ L  +N   +WLRN++
Sbjct: 326 YIPEAPENFNSAATVLPAQIFTWASDSQRAFSERTAAGILVLLVLLLGMNATAIWLRNKY 385

Query: 422 KKRW 425
           +++W
Sbjct: 386 ERKW 389


>gi|84501124|ref|ZP_00999359.1| phosphate ABC transporter, permease protein [Oceanicola batsensis
           HTCC2597]
 gi|84391191|gb|EAQ03609.1| phosphate ABC transporter, permease protein [Oceanicola batsensis
           HTCC2597]
          Length = 446

 Score =  302 bits (773), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 179/432 (41%), Positives = 257/432 (59%), Gaps = 24/432 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
            +  + R  SE  F+ Y +VA+ +   FL++L+ +I+  G+ A   T   + I  ++   
Sbjct: 25  DERTRRRNASEGRFKTYGIVAIAIALFFLVVLVVAILRSGLPAFTATVADVEITITQEEF 84

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D  +          +A   L + K L R+LS +         A + +       +R+   
Sbjct: 85  DAAEGELFK----TKAYEQLFIGK-LQRQLSENGMQVEFDAAAIERIMGKVGGDIREFYR 139

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLD------SDGAL 181
            +P+ +G+ V   L AS+ +D   KG +   A    + D ++     LD        G +
Sbjct: 140 ANPAQLGEPVSFQLSASSRVDGYFKGRVTREA----LQDSRFLQLSDLDLVDALEEAGII 195

Query: 182 FLDFNYGFFINGASS---RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
              FN+  FI GA S    P  AGIG +VVGS +MML+V+ LS P+G+A++IYLEEF+ +
Sbjct: 196 RQSFNW-TFIQGADSGVDNPGGAGIGASVVGSFFMMLVVLFLSLPIGVAASIYLEEFAPQ 254

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+T
Sbjct: 255 NRWTDMIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIIST 314

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             +L+ VP SIR AALG+GASK+Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +G
Sbjct: 315 RASLKAVPPSIRDAALGVGASKMQAVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIG 374

Query: 359 MVAFVT-DYPVGV----TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           MV FV   YP G+     D  +A P QIY WAA A+  F E+ +G I++LL+FL  +N  
Sbjct: 375 MVGFVARGYPDGIVSGFVDPNSAMPAQIYTWAARADAAFYEKAWGGIIILLLFLMTMNFI 434

Query: 414 MLWLRNRFKKRW 425
            + LR RF++RW
Sbjct: 435 AIVLRRRFERRW 446


>gi|103486314|ref|YP_615875.1| phosphate ABC transporter permease [Sphingopyxis alaskensis RB2256]
 gi|98976391|gb|ABF52542.1| Phosphate transport system permease protein 2 [Sphingopyxis
           alaskensis RB2256]
          Length = 418

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 168/422 (39%), Positives = 253/422 (59%), Gaps = 23/422 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K +  RY +E  F+   + AVL+   FL  LL  +V  G      TH+S+PI+F  T +
Sbjct: 16  QKRIAGRYAAERRFKAIGLAAVLLSGAFLAFLLFVMVGNGARGFTYTHVSVPIDFKATPL 75

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                R  DP      D + L+  A    +    ++ AL    S+++S  A   +R  + 
Sbjct: 76  TIDASRLDDP------DADQLIAGAGLADIVAFAADEALGEDGSKLISENAWKEVRSAIK 129

Query: 128 TDPSLIGKTVEVSLLASANID----SALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
            DP L+       L A++ +D       +G L +  +              L+ DG L  
Sbjct: 130 ADPELLNGKSVFELPAASEVDIMAKEGARGELGARVDA-------------LERDGRLST 176

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ FF N  ++ P VAGI  A+ GS+  + I   ++FP G+ +A+YLEE++ K  ++ 
Sbjct: 177 GIHWPFFRNADATDPAVAGIWGALKGSVLTIFIAFLIAFPTGVLAALYLEEYAPKNRWTD 236

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +INNLA+VPSI++G+L  AV IN+F + +++ LVGGL LALMT+P I+IA+  A++
Sbjct: 237 LIEVSINNLAAVPSIIFGLLALAVFINWFGICQASPLVGGLTLALMTMPVIVIASRNAIK 296

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP SIR AALG+GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AF+
Sbjct: 297 SVPPSIRDAALGVGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLLIGMRAFI 356

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            D P G+   +T  P+QI+LW+ + +R FVE+T  AI++LLI L  +N   ++LRN+F+K
Sbjct: 357 GDVPGGICSPSTVLPMQIFLWSDEVDRGFVEKTSAAIIVLLIVLLSMNAFAIYLRNKFEK 416

Query: 424 RW 425
           RW
Sbjct: 417 RW 418


>gi|254504060|ref|ZP_05116211.1| phosphate ABC transporter, permease protein PstA [Labrenzia
           alexandrii DFL-11]
 gi|222440131|gb|EEE46810.1| phosphate ABC transporter, permease protein PstA [Labrenzia
           alexandrii DFL-11]
          Length = 449

 Score =  300 bits (767), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 182/431 (42%), Positives = 261/431 (60%), Gaps = 30/431 (6%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K R  SE  F+ Y + A+L+  VFL+++  SI+S+GI A   T   L +EF+ T     +
Sbjct: 32  KKRNASEKRFQAYGITAILIGLVFLVVMAYSIISEGIPAF--TRTVLTVEFTVT-----Q 84

Query: 72  KRFMDPAILL---RADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
           ++F D    L   RA Y  +  +A++ +    +        A + +       +R+    
Sbjct: 85  EQFDDAESQLFKTRA-YEAVFTEAMSSQFQQKNIQVPFDIAAIERIVGKPGSTIREFYRA 143

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLD------SDGALF 182
           +P  +G+ V   L AS+ +D  + G L        ++D ++     LD        G + 
Sbjct: 144 NPDQLGQPVVFELAASSRVDGYMNGRLTR----DNITDSRFLMKSDLDLVDVLVESGIIE 199

Query: 183 LDFNYGFFINGASS---RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
             FN+ F I GA S    P  AGIG +VVGS +MML+V+ LS P+G+A++IYLEEF+ + 
Sbjct: 200 TVFNWPF-ITGADSGVDNPGGAGIGASVVGSFFMMLVVLFLSLPIGVAASIYLEEFAPQN 258

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
             +  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  +VGGL+L LMTLP+III+T 
Sbjct: 259 RITDLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPIVGGLVLTLMTLPTIIISTR 318

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L+ VP SIR AALG+GASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +GM
Sbjct: 319 ASLKAVPPSIRDAALGVGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIGM 378

Query: 360 VAFVT-DYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           V FV   YP     G  D  +A P QIY WAA ++  F E+ +G I++LL+FL  +N   
Sbjct: 379 VGFVARGYPDGFVSGFMDPNSAMPAQIYTWAARSDFAFYEKAWGGIIVLLVFLLTMNIIA 438

Query: 415 LWLRNRFKKRW 425
           + LR RF++RW
Sbjct: 439 IILRRRFERRW 449


>gi|92113602|ref|YP_573530.1| phosphate ABC transporter permease [Chromohalobacter salexigens DSM
           3043]
 gi|91796692|gb|ABE58831.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chromohalobacter salexigens DSM 3043]
          Length = 388

 Score =  298 bits (764), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 162/424 (38%), Positives = 242/424 (57%), Gaps = 38/424 (8%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +SF      LK R+      ++  + A+++   FL++ +S +V +G  A  Q  + + + 
Sbjct: 3   QSFEEISAQLKKRHRRSARMKWMTMGALILSAAFLVVFISDMVVRGWPAFQQAQLQVEVS 62

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           + E     Q ++   P   +  D   L+ +   R L                        
Sbjct: 63  YDE-----QSQKL--PLAAVDEDVRPLISRGFFRSLP----------------------- 92

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
             + +  +P L+G T    ++A + +D  LKG      N  R+     +  Q L  DG  
Sbjct: 93  --REMENNPELMGTTQTRWVIADSRVDQFLKG------NEDRLRPADKETLQALVEDGRA 144

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            L FN  FF  G S  PE+AGI  A +G++  ML+ + + FP+G+ +A+YLEEF+     
Sbjct: 145 ALKFNTTFFTTGDSKMPELAGIASAAIGTVMTMLVTMAVCFPIGVMTAVYLEEFAPDNRL 204

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NINNLA+VPSI++G+LG A+ I+FF +PRS+ LVGGL LALMTLP III+T  A
Sbjct: 205 TQLIEININNLAAVPSILFGLLGLAIYISFFGVPRSSPLVGGLTLALMTLPVIIISTRAA 264

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR+VP SIR AA G+G S+ Q V  HVLP+++P ILTGS + LA+A+GETAPL+ VGMVA
Sbjct: 265 LRSVPDSIRHAAFGVGCSRWQVVRDHVLPVSLPGILTGSIIGLAQAMGETAPLIIVGMVA 324

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D  + +TD +T  P QI+ WA++    F E+T G IL+LL  L  +N   +WLRN+F
Sbjct: 325 FIPDASISITDASTVMPAQIFTWASEPNSAFAEKTAGGILVLLAVLIFLNALAVWLRNKF 384

Query: 422 KKRW 425
           ++RW
Sbjct: 385 ERRW 388


>gi|317152750|ref|YP_004120798.1| phosphate ABC transporter inner membrane subunit PstA
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943001|gb|ADU62052.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 386

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 164/422 (38%), Positives = 242/422 (57%), Gaps = 38/422 (9%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
           +SI+ K LK R   +  FR Y   A+L+   FL+   + I++  + A  Q  + + + + 
Sbjct: 3   YSIDPKVLKRRASRDKRFRTYAYTAILMAAAFLVFFFTDIITTALSAFKQAELLVEVHYV 62

Query: 64  ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLR 123
           +                             ARK+     ++AL    S ++S      + 
Sbjct: 63  DE----------------------------ARKMG----DYALDDDVSPLVSRGFTRLIP 90

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
             +  D SL+G   E  +LA A +D  LKG        +R+   + K    + ++G   L
Sbjct: 91  NQMREDRSLLGTAEEKWVLAEAEVDQYLKG------KPNRLKKDERKIVDTMRAEGRARL 144

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
            FN GFF NG S  PE+AGI  A VGS+Y+++I    SFP G+ +AIYLEEF+       
Sbjct: 145 AFNIGFFENGDSKLPEMAGIWAAAVGSMYVLIITFLFSFPTGVMTAIYLEEFAPNNRIMQ 204

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NINNLA++PSI++G+LG ++ INFF +PRS+AL GGL LALMTLP III+T  A+R
Sbjct: 205 VIEVNINNLAAIPSILFGLLGLSIFINFFGVPRSSALAGGLTLALMTLPVIIISTRAAIR 264

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP SIR  +L LGA++ Q V  +VLPL++P ILTG+ + LA+A+GETAPLL VGM+A++
Sbjct: 265 AVPDSIREGSLALGATRWQMVLTNVLPLSLPGILTGTIIGLAQAIGETAPLLIVGMMAYI 324

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            D P   T  AT  P QIY W++D+ R F ERT   I++LL  +  +N   ++LRN+++ 
Sbjct: 325 PDAPTSFTSAATVLPAQIYTWSSDSLRAFTERTSAGIIVLLAVMLSMNAVAIYLRNKYET 384

Query: 424 RW 425
           +W
Sbjct: 385 KW 386


>gi|126642482|ref|YP_001085466.1| high-affinity phosphate transport protein [Acinetobacter baumannii
           ATCC 17978]
          Length = 386

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 172/378 (45%), Positives = 235/378 (62%), Gaps = 16/378 (4%)

Query: 53  QTHISLPIEFSETIVDPQKKRFMDPAILLRADYN-LLVRKALARKLSISDSNHALLRQAS 111
           +T    P  + E  VD Q K  M        D++ L+V   +A+  S++     L    S
Sbjct: 20  RTQGETPAHYQERYVDWQTKMGM-------VDWDSLIVNGMIAKDPSLASQRDYL----S 68

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++     
Sbjct: 69  SLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEIR 128

Query: 170 KWFQKLDSDGALFLDFNYGFFINGAS-SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           K    L + G L   FN   F N  S S P ++G+  A +GSL+MMLIVI +S P+G+AS
Sbjct: 129 KLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVAS 188

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+L
Sbjct: 189 AIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLSL 248

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A AL
Sbjct: 249 MTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHAL 308

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  +
Sbjct: 309 GETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLALM 368

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 369 IGLNSLAIWLRKKFEVRW 386


>gi|254472027|ref|ZP_05085428.1| phosphate transport system permease protein 2 [Pseudovibrio sp.
           JE062]
 gi|211959229|gb|EEA94428.1| phosphate transport system permease protein 2 [Pseudovibrio sp.
           JE062]
          Length = 615

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 195/271 (71%)

Query: 155 LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMM 214
           L +P +  + SD +  +   L S G +   +N  FF +GAS  PE+AGI  A VGS + M
Sbjct: 345 LETPESFRKFSDKEIAYTDYLVSKGTIENQWNSIFFKSGASREPEMAGIWGAAVGSFWTM 404

Query: 215 LIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM 274
           L+ + LSFP+G+A+AIYLEEF+ K  ++  ++ NINNLA+VPSIV+G+LG AV +N F +
Sbjct: 405 LVTLSLSFPIGVAAAIYLEEFAPKNRWTHLIEVNINNLAAVPSIVFGLLGLAVFLNVFGL 464

Query: 275 PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMP 334
           PRS  +VGG++LALMTLP+IIIA+  AL+ VP SIR AALG+GAS++Q VFHHVLPLAMP
Sbjct: 465 PRSAPVVGGMVLALMTLPTIIIASRAALQAVPPSIREAALGVGASRLQAVFHHVLPLAMP 524

Query: 335 AILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
            ILTG+ + +A+ALGETAPLL +GMVAF+ D P    D +T  PVQI++WA   E  F +
Sbjct: 525 GILTGTIIGMAQALGETAPLLMIGMVAFIVDIPASPVDPSTVLPVQIFMWADFPEPAFQQ 584

Query: 395 RTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           +T  AI++LL FL  +N   + LR RF++RW
Sbjct: 585 KTSAAIMVLLGFLISMNAIAIVLRKRFERRW 615



 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 77/148 (52%), Gaps = 9/148 (6%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K LK RY  E  F+ Y + A+ +   FL+LLL +IV  G+ A    ++S+P+  S   V
Sbjct: 31  RKRLKKRYSMEARFKAYGIGAIALAATFLVLLLFTIVGTGLPAFTYNYVSVPLNLSAEKV 90

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP      +PA    A YN ++R  L  +L  + S+    R    ++S+ A   L+K ++
Sbjct: 91  DP-----ANPA---GASYNKIIRDGLKAELPFA-SDRKNRRVLYSLVSSGANVILQKQVV 141

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYL 155
            D S++G T  V++  S   D  +KG +
Sbjct: 142 ADTSMLGGTGPVAIPLSDFADLYVKGLI 169


>gi|194595542|gb|ACF77053.1| putative ABC-type phosphate transporter permease protein [Halomonas
           sp. HAL1]
          Length = 388

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 161/423 (38%), Positives = 246/423 (58%), Gaps = 38/423 (8%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +F    + LK R+      ++  + ++ +  +FL+L  + ++SKG+ A  Q +I   I +
Sbjct: 4   TFDEISQQLKRRHRKSARLKWISMGSLGLAGLFLVLFFADMLSKGLPAFQQAYIQTEISY 63

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           +E                                 + +D   A  ++   ++S TA   +
Sbjct: 64  TEE--------------------------------AQTDGRQAFDQELLPLISRTAVRVI 91

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
              L  +P +IG +    +LA++ +D  LKG+       +R+S+ +     +    G + 
Sbjct: 92  PMELRNNPGMIGTSEAQWVLANSEVDQYLKGHR------NRLSEEEQAALDERVEAGQVD 145

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
           L FN  FF +G S   E AGI  AVVG++  M++ + +SFP+G+ +A+YLEEF+    F+
Sbjct: 146 LRFNSTFFGSGDSKIAENAGILSAVVGTVMTMIVTLAISFPIGVMTAVYLEEFAPDNRFT 205

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NINNLA++PSI++G+LG A+ INFF +PRS+ L GG+ LALMTLP III+T  AL
Sbjct: 206 QAIEININNLAAIPSILFGLLGLAIFINFFGVPRSSPLAGGMTLALMTLPVIIISTRTAL 265

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+VP SIR AA G+G S+ Q V  HVLPLAMP I+TGS + LA+A+GETAPL+ VGMVAF
Sbjct: 266 RSVPDSIRHAAFGVGCSRWQVVRDHVLPLAMPGIMTGSIIGLAQAMGETAPLIIVGMVAF 325

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           + D     T+ AT  P QI+ W+ + E+ FVE+T G IL+LL  L  +N   + LR +F+
Sbjct: 326 IPDVGASFTEAATVMPAQIFTWSGEPEQAFVEKTAGGILVLLTILISLNAFAVVLRKKFE 385

Query: 423 KRW 425
           +RW
Sbjct: 386 RRW 388


>gi|189345921|ref|YP_001942450.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           limicola DSM 245]
 gi|189340068|gb|ACD89471.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           limicola DSM 245]
          Length = 387

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 168/425 (39%), Positives = 252/425 (59%), Gaps = 38/425 (8%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           M+S + N +  + R   E  FRFY + A+++   FL+     I+ KG  A   T I   +
Sbjct: 1   MESSTFNDRRKRKRLSRERRFRFYGISAIVMAISFLLFFFVDIIQKGYKAFAMTEIHSEM 60

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
            +S+  V+        P +  + D    V  ++AR +  SD                   
Sbjct: 61  VYSQDAVEI-------PQLAFQEDVRDFVSYSVARMIP-SD------------------- 93

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
                L  +PSL+GK V   ++AS  +D   KG      +V R+++ + +   +L   G 
Sbjct: 94  -----LERNPSLMGKNVVKWVVASDEVDQYAKG------SVTRLTEDEQRRIDELKRQGR 142

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           L L FN  FF  G S  PEVAGI  AVVGSLY++ + +  S P+G+ SA+YL+EF+   F
Sbjct: 143 LRLSFNTRFFAAGDSKLPEVAGIFSAVVGSLYVIALTVLFSVPIGVMSALYLQEFAPDNF 202

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            +  ++ NI+NLA++PSI++G+LG ++ INFF +PRS+AL GGL LALMTLP III+T  
Sbjct: 203 LTRLIEVNISNLAAIPSIIFGLLGLSIFINFFGVPRSSALAGGLTLALMTLPVIIISTRA 262

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           ++  VP SIR  A  +GASK+Q V HH+LPLA+P I TG+ + +ARALGETAPLL +GM+
Sbjct: 263 SIGAVPDSIRHGAYAVGASKLQMVLHHLLPLAVPGITTGTIIGIARALGETAPLLIIGMM 322

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           A++ D P G+T+ AT  P QIY W++ ++R FVE+T   I++LL  + ++N   +WLR +
Sbjct: 323 AYIPDIPSGITEAATVLPAQIYTWSSASQRAFVEKTAAGIMVLLAVMLLLNATAIWLRRK 382

Query: 421 FKKRW 425
           ++ +W
Sbjct: 383 YEIKW 387


>gi|307544718|ref|YP_003897197.1| ABC transporter permease [Halomonas elongata DSM 2581]
 gi|307216742|emb|CBV42012.1| ABC-type transport system permease protein [Halomonas elongata DSM
           2581]
          Length = 388

 Score =  289 bits (739), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 164/428 (38%), Positives = 240/428 (56%), Gaps = 46/428 (10%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +SF      L+ R+      ++  + A+ +  +FL+L  + ++ KG+ A  Q  I + +E
Sbjct: 3   QSFDEISAQLRRRHRKSARLKWISMGALGLAGLFLVLFFADMLVKGLPAFQQARIQVEVE 62

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           +SE                                     S   L     ++    +R +
Sbjct: 63  YSE-----------------------------------QASQIPLAAVQEEVRPIVSRGY 87

Query: 122 LR---KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWK-WFQKLDS 177
           LR     +  +P L G T    +LA   +D  LKG+       H   D   K    +L S
Sbjct: 88  LRLIPGRMDENPDLQGTTRMEWVLADGQVDQYLKGH-------HNKLDADEKATIDRLQS 140

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           +G   L FN  FF NG S  PE+AGI  A +G++  +L+ + +SFP+G+ +A+YLEEF+ 
Sbjct: 141 EGRAELVFNTTFFTNGDSKMPELAGIASAAMGTVLTLLVTLAVSFPIGVMTAVYLEEFAP 200

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
               +  ++ NINNLA++PSI++G+LG A+ INFF +PRS+ +VGGL LALMTLP IIIA
Sbjct: 201 DNRVTQLIEININNLAAIPSILFGLLGLAIFINFFGVPRSSPVVGGLTLALMTLPVIIIA 260

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  ALR+VP SIR AA G+G S+ Q V  HVLP+A+P I+TGS + LA+A+GETAPL+ V
Sbjct: 261 TRTALRSVPDSIRHAAFGVGCSRWQMVRDHVLPVALPGIMTGSIIGLAQAMGETAPLIIV 320

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAF+ D     T+ AT  P QI+ WA + +R F+E+T G IL+LL  L  +N   + L
Sbjct: 321 GMVAFIPDVTSSFTEAATVLPAQIFTWAGEPDRAFIEKTSGGILVLLAVLITLNATAVVL 380

Query: 418 RNRFKKRW 425
           R +F++RW
Sbjct: 381 RKKFERRW 388


>gi|332185334|ref|ZP_08387083.1| phosphate ABC transporter, permease protein PstA [Sphingomonas sp.
           S17]
 gi|332015058|gb|EGI57114.1| phosphate ABC transporter, permease protein PstA [Sphingomonas sp.
           S17]
          Length = 404

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/400 (40%), Positives = 246/400 (61%), Gaps = 19/400 (4%)

Query: 28  AVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNL 87
           AV +   FL  LL ++V++GI    +T ++LP+  +   +       ++P+ +     +L
Sbjct: 22  AVALSAAFLAFLLITMVAQGIRGFTETKVTLPVNLAHADLP------IEPSRVKGRSADL 75

Query: 88  LVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANI 147
            +  A       + +     R  + +LS  A   +R  +  DPS++ +TV  +L  ++  
Sbjct: 76  ALAGAGLEDAVATAATMRFGRDGANLLSPGAWLIVRDAIKGDPSILHRTVTFTLPVASPY 135

Query: 148 DSALKGYLYSPAN--VHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV 205
           D A KG     A   V R+        Q++ S G     +N+ F  +  ++ P   GI  
Sbjct: 136 DVAAKGEGTPDAEGVVARLRQ------QRVLSTG-----WNWNFLTDADATDPTRVGIWG 184

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A  GSL  ML+ + L+FP+G+ +A+YLEE++ K  ++  ++ +INNLA+VPSI++G+LG 
Sbjct: 185 AAKGSLLTMLVTLALAFPIGVLAALYLEEYAPKNRWTDLIEVSINNLAAVPSIIFGLLGL 244

Query: 266 AVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVF 325
           AV +N F +PRS  LVGGL LALMT+P I+IA   A+++VP SIR AAL +GAS+VQ +F
Sbjct: 245 AVFLNTFGLPRSAPLVGGLTLALMTMPVIVIAGRNAIKSVPPSIRDAALAIGASRVQVIF 304

Query: 326 HHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWA 385
           HHVLPLA+P ILTG+ + +ARALGETAPLL +GM AF+   P G+TD +T  PVQI+LW+
Sbjct: 305 HHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFIAAPPRGLTDPSTVLPVQIFLWS 364

Query: 386 ADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              +R F+E+T  AI++LL+FL  +N   ++LRNRF+ RW
Sbjct: 365 DQVDRGFIEKTSAAIIVLLVFLLAMNGLAIYLRNRFETRW 404


>gi|78188477|ref|YP_378815.1| phosphate ABC transporter permease [Chlorobium chlorochromatii
           CaD3]
 gi|78170676|gb|ABB27772.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chlorobium chlorochromatii CaD3]
          Length = 396

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 157/426 (36%), Positives = 246/426 (57%), Gaps = 39/426 (9%)

Query: 1   MKSFSI-NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           M + SI +++  + R   E  FRFY + A+++   FL+     I+ KG  A   T I   
Sbjct: 9   MDNVSIKDERRKQQRLARERRFRFYGISAIVLALSFLVFFFVDIIQKGYKAFAVTEIRSE 68

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR 119
           + +S   +D        P +  + D    V  ++ R +                      
Sbjct: 69  VVYSPDALDI-------PQLAFQEDVRDFVSYSVVRMIP--------------------- 100

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDG 179
                 L  +P+L+GK+    ++A+  +D   KG      +  ++S+ + +    L   G
Sbjct: 101 ----SQLEKEPTLMGKSNVQWVVANDEVDQYCKG------SDTQLSEEEQQQINALRDAG 150

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            + + FN  FF  G S  PEVAGI  A+VG+LY++ + +  + P+G+ SA+YL+EF+   
Sbjct: 151 RVRVTFNALFFTAGDSKLPEVAGILSAIVGTLYVITLTVLFAVPIGVMSALYLQEFAPDN 210

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            F+  ++ NI+NLA++PSI++G+LG ++ INFF +PRS+AL GGL LALMTLP III+T 
Sbjct: 211 AFTRLIEVNISNLAAIPSIIFGLLGLSIFINFFGVPRSSALAGGLTLALMTLPVIIISTR 270

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L  VP SIR  A  +GAS++Q VFHH+LPLA+P I TG+ + +ARALGETAPLL VGM
Sbjct: 271 ASLAAVPDSIRHGAYAVGASRLQMVFHHLLPLAVPGITTGTIIGVARALGETAPLLIVGM 330

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           +A++ D P  +T+ AT  P QIY W++ ++R FVE+T   I++LL  + V+N    +LR 
Sbjct: 331 MAYIPDMPTSITEAATVLPAQIYTWSSASQRAFVEKTAAGIMVLLAVMLVLNAIAFFLRK 390

Query: 420 RFKKRW 425
           +++ +W
Sbjct: 391 KYEIKW 396


>gi|114569031|ref|YP_755711.1| phosphate ABC transporter inner membrane subunit PstA [Maricaulis
           maris MCS10]
 gi|114339493|gb|ABI64773.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Maricaulis maris MCS10]
          Length = 580

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 151/292 (51%), Positives = 201/292 (68%), Gaps = 7/292 (2%)

Query: 141 LLASANIDSALKGYLY---SPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSR 197
           LL S ++++     LY   +PA   R+SD    W + L++ GA+   FN   F N  S  
Sbjct: 289 LLGSGSVEATDDWTLYVIDTPAERRRVSDQLIVWTRALEARGAINAVFNTYLFANADSRE 348

Query: 198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPS 257
           PE+AG+  A+ GS+  M+I I +S P+G+ +A+YLEE++ K  F++ ++ NINNLA+VPS
Sbjct: 349 PELAGVKGALYGSILTMIITIMISVPIGVFTALYLEEYAPKNRFTALIEVNINNLAAVPS 408

Query: 258 IVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLG 317
           IV+G+LG AV IN F +PRS  LVGGL+L+LMTLP++IIAT  AL+ VP SIR AAL +G
Sbjct: 409 IVFGLLGLAVFINAFGLPRSAPLVGGLVLSLMTLPTVIIATRAALQAVPQSIRQAALAVG 468

Query: 318 ASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV----GVTDI 373
           AS+ QTVFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMVAF+ D P     G T  
Sbjct: 469 ASRTQTVFHHVLPLAAPGILTGAIIGLAQALGETAPLLMIGMVAFIADAPTLGLEGFTQP 528

Query: 374 ATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           AT  PVQI+LW+  AER F  RT  AIL+LL  +   N   ++LR RF++RW
Sbjct: 529 ATVMPVQIFLWSDGAERAFQARTGAAILVLLALMIGFNALAIYLRRRFERRW 580



 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 70/148 (47%), Gaps = 3/148 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +KNL  RY +E  FR   + AV      LI+LLSSIVS G+ A     ++L ++     V
Sbjct: 15  RKNLGARYRAELRFRAAGLGAVATAVGILIILLSSIVSGGLPAFTAHELALTVDLDRETV 74

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP+     +   L R  Y+ +++ A+  +          LR    + +      L   ++
Sbjct: 75  DPRGDGSEES--LRRGSYSRILQDAMRAEFPEVQGRRD-LRNLFSLYTALNATRLMDEVL 131

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYL 155
            DP+LIG     ++  + ++D  LKG+L
Sbjct: 132 EDPTLIGTRHTFTMPLADDLDLYLKGHL 159


>gi|296283971|ref|ZP_06861969.1| phosphate ABC transporter permease [Citromicrobium bathyomarinum
           JL354]
          Length = 421

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 158/418 (37%), Positives = 247/418 (59%), Gaps = 15/418 (3%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K LK RY  E  F+ + + A++V    L +LL ++   G+G   +  + +PI+F+E+ +
Sbjct: 19  EKRLKQRYAQERRFKLFGLFAIIVSIAILFVLLGNMTINGVGGFQRAELQVPIDFAESGL 78

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                    P  +       L  + L   ++ + +   +    ++ LS  A   + + L 
Sbjct: 79  AGDAASLSQPGAV-----QTLEMQGLPEIVAFA-AEQRMGAAGAEQLSQDAWREVAEDLR 132

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            DP+++       L AS ++ S + G           S        +L+ +G L   F++
Sbjct: 133 ADPAMLRGQETFWLPASGDLASGMDG---------EGSPEMQALAAQLEREGYLEKRFDW 183

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GF     ++ P+  G+  A+ GS+  M++ + L+FP+G+ SA+YLEE++ K  ++  ++ 
Sbjct: 184 GFLTRSDATDPQQVGVWGALKGSILTMIVTLALAFPIGVLSALYLEEYAPKNRWTDIIEV 243

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           +INNLA+VPSI++G+LG AV +  F   RS  LVGG+ LALMT+P I+I+   A++ VP 
Sbjct: 244 SINNLAAVPSIIFGLLGLAVFLWIFPNMRSAPLVGGMTLALMTMPVIVISGRNAIKAVPP 303

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR  AL +GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AFV   P
Sbjct: 304 SIRDGALAVGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLLIGMRAFVATPP 363

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            G T  AT  PVQI+LW+ + +R F+ERT  AI++LL+FL V+N   ++LRN+F+K W
Sbjct: 364 DGFTSPATVLPVQIFLWSDEIDRGFIERTSAAIIVLLLFLLVMNALAIYLRNKFEKTW 421


>gi|83859332|ref|ZP_00952853.1| probable phosphate ABC transporter, permease protein (PstA)
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852779|gb|EAP90632.1| probable phosphate ABC transporter, permease protein (PstA)
           [Oceanicaulis alexandrii HTCC2633]
          Length = 581

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 160/344 (46%), Positives = 217/344 (63%), Gaps = 9/344 (2%)

Query: 91  KALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASAN--ID 148
           + L R L ++ S+ A ++  SQ  S   R       ++     G++ +   L   +   D
Sbjct: 238 RDLVRALEMARSDTAPVQLNSQTASLMLRAQGGVLRISQLQQDGRSAQGDWLIGPDHASD 297

Query: 149 SALKGYLY---SPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV 205
           SA    L+   +P+   R++D Q  W + L   G +    N   F N  S  PE+AG+  
Sbjct: 298 SAETWSLWVIETPSIARRITDRQIVWARTLKERGLIRNGLNTTLFTNADSREPELAGVAG 357

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A+ GS+  M++ + L+ P+G+ +AIYLEEF+ K   + F++ NINNLA+VPSIV+G+LG 
Sbjct: 358 ALAGSILTMIVTMLLAVPIGVGAAIYLEEFAPKNRLTDFIEVNINNLAAVPSIVFGLLGL 417

Query: 266 AVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVF 325
           AV IN F MPRS  LVGG++LALMTLP++II+   AL+ VP SIR AALG+GAS+ Q VF
Sbjct: 418 AVFINLFGMPRSAPLVGGMVLALMTLPTVIISARAALKAVPPSIREAALGVGASRTQAVF 477

Query: 326 HHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV----GVTDIATAFPVQI 381
           HHVLPLAMP ILTGS + LA+ALGETAPLL +GMVAF+ D P     G T+ AT  PVQI
Sbjct: 478 HHVLPLAMPGILTGSIIGLAQALGETAPLLMIGMVAFIADPPTLGLSGFTEPATVMPVQI 537

Query: 382 YLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           Y+W++ AER F  RT  AIL LL  L   N   ++LR RF++RW
Sbjct: 538 YIWSSSAERAFEARTAAAILALLTLLVSFNAVAIYLRRRFERRW 581



 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 70/146 (47%), Gaps = 3/146 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +  L  R+ +E  F+FY + A+    +FL +LL S++ + + A     + L ++    I 
Sbjct: 12  QARLAKRHRAEQRFQFYGLAAISAAVLFLAVLLGSLIIQSVPAFTAHKLVLDVDIRPEIA 71

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP+       A L R  YN L++ +L  +   + S    +R+   + S      L   ++
Sbjct: 72  DPRGD--ASEASLRRGSYNTLIQNSLWAQFPEAGSVSE-MRELFGLYSAVNAARLLNEVV 128

Query: 128 TDPSLIGKTVEVSLLASANIDSALKG 153
            +P ++G+T+  +L  S + D  LKG
Sbjct: 129 NNPDVLGETIRFTLPISDDADLYLKG 154


>gi|149184839|ref|ZP_01863157.1| probable phosphate ABC transporter, permease protein (PstA)
           [Erythrobacter sp. SD-21]
 gi|148832159|gb|EDL50592.1| probable phosphate ABC transporter, permease protein (PstA)
           [Erythrobacter sp. SD-21]
          Length = 416

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 157/418 (37%), Positives = 246/418 (58%), Gaps = 15/418 (3%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +  LK RY +E  F+   + A+L     LI LL S+   GI    +  +++PI+F++  +
Sbjct: 14  EARLKKRYAAEKRFKAMGLTAILFSVAVLIYLLGSMTINGISGFQRAEVAVPIDFTQAGI 73

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                   DP+++  +     +     R +    +   L    ++ + T A   +   + 
Sbjct: 74  S------ADPSVMGTSQAMQSLEAQGLRDVVQYFAVEELGEAGAEEIGTQAWRDVAAAIS 127

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            DP ++ +     + ASA++   L G     A +  ++        +L  +G L  +F+ 
Sbjct: 128 ADPGIVQRQETFWIPASADLAQGLAGE--GSAEMQALAS-------QLADEGKLAKNFDA 178

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFF    ++ P+  GI  A+ GS+  M++ + L+FP+G+ +A+YLEE++ K  ++  ++ 
Sbjct: 179 GFFSRADATNPQQVGIWGALKGSILTMIVTLALAFPIGVLAALYLEEYAPKNRWTDLIEL 238

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           +INNLA+VPSI++G+LG AV +  F   RS  L+GG+ LALMT+P I+IA   A++ VP 
Sbjct: 239 SINNLAAVPSIIFGLLGLAVFLTIFPSYRSAPLIGGMTLALMTMPVIVIAGRNAIKAVPP 298

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR  AL +GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AFV   P
Sbjct: 299 SIRDGALAVGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFVASPP 358

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              T  AT  P+QI+LW+ + +R FVERT  AI++LL FL V+N   ++LRN+F+K+W
Sbjct: 359 DSFTAPATVLPMQIFLWSDEIDRGFVERTSAAIIVLLAFLLVMNGLAIYLRNKFEKKW 416


>gi|326387439|ref|ZP_08209048.1| phosphate ABC transporter permease [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208095|gb|EGD58903.1| phosphate ABC transporter permease [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 434

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 163/422 (38%), Positives = 254/422 (60%), Gaps = 23/422 (5%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGAL--WQTHISLPIEFSET 65
           +  L  R++ + LFR+    AV    + L+LLL+S+   G+     ++  + LP++  E 
Sbjct: 32  RAGLARRHLDDRLFRWAGFAAVGFSALILVLLLASMSLNGLAGFERYEIRLDLPVK-GEL 90

Query: 66  IVDPQKKRFMDPAILLR-ADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
           +VDP +     P   L       L+  A  R+L   D   AL+       + T       
Sbjct: 91  LVDPSRLAQPQPLDALEVGGLPALIDAAAERQLG--DGGSALI-------ADTGWRDAGA 141

Query: 125 TLMTDPSLIG-KTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
            L+  P L+  +++ +++ AS  + +A +G   +P    R         +KL + G L  
Sbjct: 142 ELVAHPDLLAARSIPLTVPASDELANAARGS-GAPELQARA--------RKLMASGVLVH 192

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
            F++GF     ++ P++ GI  A+ GS+  ML+ + L+FP+G+ +A+YLEE++ +  ++ 
Sbjct: 193 SFDWGFLARSDATSPQMVGIWGALKGSIMTMLVTLALAFPVGVLAALYLEEYAPRNRWTD 252

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +INNLA+VPSI++G+LG AV +  F   RS  LVGG+ LALMT+P I+I+   A++
Sbjct: 253 LIEISINNLAAVPSIIFGLLGLAVFLVIFPNDRSAPLVGGMTLALMTMPVIVISGRNAIK 312

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S+R AAL +GAS +Q VFHHVLP+A+P ILTG+ + +ARALGETAPLL +GM AFV
Sbjct: 313 AVPPSLRDAALAVGASPLQVVFHHVLPMALPGILTGTIIGMARALGETAPLLMIGMRAFV 372

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  +T  AT  PVQI+LW+ + +R F+ERT  AI++LL+FL V+N   ++LRNRF+K
Sbjct: 373 ASPPATLTSPATVLPVQIFLWSDEIDRGFIERTSAAIIVLLVFLLVMNGLAIYLRNRFEK 432

Query: 424 RW 425
           RW
Sbjct: 433 RW 434


>gi|268680476|ref|YP_003304907.1| phosphate ABC transporter inner membrane subunit PstA
           [Sulfurospirillum deleyianum DSM 6946]
 gi|268618507|gb|ACZ12872.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 389

 Score =  275 bits (704), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 157/425 (36%), Positives = 246/425 (57%), Gaps = 44/425 (10%)

Query: 7   NKKN------LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           N KN      +K R     LF+   ++A++    FL+  L+ IV  G  A  QT+I + +
Sbjct: 3   NDKNYFYIPQIKKRNQKAALFKSLTILAIVFSISFLVFFLTDIVRAGYPAFTQTYIQMEV 62

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           E +E +         +P   L+            + L I+  + A LR    ++      
Sbjct: 63  EINEEVAQ-------NPYGALKG-----------KNLKIA--SRAWLRDLPNLIKE---- 98

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
                   +PS +  T  + +LA++ +D  +KG         R  + +  +  +L ++G 
Sbjct: 99  --------NPSWMNTTQILWVLANSEVDQYVKG------KESRTKESERAYVDELRAEGK 144

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           +   FN  F   G S  PE +GI  ++VG++  +++ + ++FP+G+ +AIYLEEF+    
Sbjct: 145 VERKFNTIFMTTGDSKIPENSGIYASIVGTVLTVIVTMAIAFPIGVMTAIYLEEFAPDNR 204

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           F+  ++ NINNLA++PSI++G+LG A+ INFF +PRS+ LVGG+ LALM LP II+++  
Sbjct: 205 FTQIIEVNINNLAAIPSILFGLLGLAIFINFFGVPRSSPLVGGMTLALMCLPVIIVSSKA 264

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           AL++VPSSIR A  GLG +K Q V  HVLPLAMP I+TGS +S+A ALGETAPL+ VGM+
Sbjct: 265 ALKSVPSSIRQAGFGLGLTKWQIVRDHVLPLAMPGIMTGSIISIAHALGETAPLIIVGMI 324

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AFV D    +TD +T  P QI+ WA   E+ ++ERT   I++LL+ L  +N   ++LR +
Sbjct: 325 AFVPDAATSITDASTVLPAQIFTWAGMPEKAYLERTAAGIIVLLVVLLSLNAVAVYLRRK 384

Query: 421 FKKRW 425
           F+++W
Sbjct: 385 FERKW 389


>gi|157736359|ref|YP_001489042.1| phosphate ABC transporter, permease protein [Arcobacter butzleri
           RM4018]
 gi|157698213|gb|ABV66373.1| phosphate ABC transporter, permease protein [Arcobacter butzleri
           RM4018]
          Length = 394

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 156/415 (37%), Positives = 234/415 (56%), Gaps = 38/415 (9%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           LK R+ S   F+ + + +++    FL   L  +++KG+ A    ++ + + FSE      
Sbjct: 18  LKSRHTSAARFKKFTLTSLIFSIAFLAFFLFDMITKGVPAFNVAYVKIDVTFSE------ 71

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            K   D    +   Y  +V +A  R +        LL+Q                   +P
Sbjct: 72  -KSLEDTRFAVDKKYKDIVSRAWLRDIP------TLLKQ-------------------NP 105

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
             +  T  + +LA   +D  +K +       + + + +     +L S G +   FN  FF
Sbjct: 106 DYMNTTQNLWVLADDQVDQYIKNH------NNNLKEKEILIVDELYSQGLIEKKFNAIFF 159

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
            NG S  PE AGI  AV+GS+  ++I + ++FP+G+ +AIYLEEF+    F+ F++ NIN
Sbjct: 160 KNGDSKIPEYAGIFSAVIGSILTLIITMLVAFPIGVMTAIYLEEFAGDNKFTRFIEININ 219

Query: 251 NLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIR 310
           NLA++PSI++G+LG A+ IN F MPRS+ LVGGL LALMTLP II+++  ALR VP SIR
Sbjct: 220 NLAAIPSILFGLLGLAIFINLFGMPRSSPLVGGLTLALMTLPIIIVSSRAALRAVPDSIR 279

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
            A  GLG +K+Q    HVLPLA P ILTGS + LA+A+GETAPL+ +GM+AF+ D P  V
Sbjct: 280 QAGYGLGLNKIQVTRDHVLPLAFPGILTGSIIGLAQAMGETAPLIIIGMIAFIPDAPTMV 339

Query: 371 TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           T  AT  P Q++ WA   E  ++E+T   IL+LL  L  +N   ++LR + + +W
Sbjct: 340 TQAATVMPAQLFTWAGMPEGMYIEKTAAGILVLLTILISLNAIAIYLRKKLEVKW 394


>gi|85708494|ref|ZP_01039560.1| phosphate ABC transporter, permease protein [Erythrobacter sp.
           NAP1]
 gi|85690028|gb|EAQ30031.1| phosphate ABC transporter, permease protein [Erythrobacter sp.
           NAP1]
          Length = 421

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 157/417 (37%), Positives = 251/417 (60%), Gaps = 15/417 (3%)

Query: 9   KNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD 68
           K L  RY +E  FR   + A++     LI LL ++++ GIG   +  +++ I   E+ V 
Sbjct: 20  KRLNQRYRAERRFRALGLGAIVFSIAVLIFLLGNMLANGIGGFQRAELAVEINMPESGVT 79

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
             +     P+        +L  + L   +    +  +L    ++ +S  A   +   L  
Sbjct: 80  GDEVSLTAPS-----STQVLEMQGLPDIVEFY-AEQSLGEAGAEQVSRDAWRDVADALKE 133

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           DPSLI +T    L AS+++ + L G     A +  ++       ++L ++G L  ++++G
Sbjct: 134 DPSLIERTETFQLAASSDLAAGLAGE--GSAEMQALA-------EQLANEGKLAENWDWG 184

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F     ++ P+  GI  A+ GS+  M++   L+FP+G+ +A+YLEE++ K  ++  ++ +
Sbjct: 185 FLARSDATSPQQVGIWGALKGSILTMIVTFLLAFPIGVLAALYLEEYAPKNRWTDLIEVS 244

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSI++G+LG AV +  F   RS  ++GG+ LALMT+P I+I+   A+++VP S
Sbjct: 245 INNLAAVPSIIFGLLGLAVFLTLFPNLRSAPVIGGMTLALMTMPVIVISGRNAIKSVPPS 304

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR  AL +GAS VQ VFHHVLPLA+P +LTG+ + +ARALGETAPLL +GM AFV   P 
Sbjct: 305 IRDGALAVGASPVQVVFHHVLPLALPGMLTGTIIGMARALGETAPLLLIGMRAFVATPPD 364

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           G T  AT  P+QI+LW+ + +R FVERT  AI++LL+FL ++N   ++LRN+F+K W
Sbjct: 365 GFTAPATVLPMQIFLWSDEIDRGFVERTSAAIIVLLLFLLLMNGLAIYLRNKFEKTW 421


>gi|34557335|ref|NP_907150.1| phosphate ABC transporter permease [Wolinella succinogenes DSM
           1740]
 gi|34483051|emb|CAE10050.1| PHOSPHATE TRANSPORT PERMEASE [Wolinella succinogenes]
          Length = 390

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 159/421 (37%), Positives = 235/421 (55%), Gaps = 43/421 (10%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
            IN++N +        F+     A+ V   FL+  L  +V +G  A  Q +I + +  S+
Sbjct: 13  QINQRNRRGER-----FKILAASALFVSIAFLLFFLYDMVRQGYPAFKQAYIKVEMPISQ 67

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
              +       +P  +L    + LV +A  R L                           
Sbjct: 68  EAAE-------NPYGVLEKQLSRLVSRAWLRDLP-------------------------N 95

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            +  +P  + KT     LASA +D  LKG+       HR+SD Q +    L ++G L + 
Sbjct: 96  QIRANPEWMDKTHTFWALASAEVDQYLKGHH------HRLSDTQIEMVTHLKNEGKLEMK 149

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           +N  FF  G S  PE +G+  AV+G++  ML+ + +S P+G+ +AIYLEEF+     +  
Sbjct: 150 WNSIFFTTGDSKIPENSGLYSAVIGTILTMLVTMAISVPIGVMTAIYLEEFAPDNRVTQI 209

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA++PSI++G+LG A+ INFF  PRS+ LVGG+ LALM+LP II+++  AL+ 
Sbjct: 210 IEVNINNLAAIPSILFGLLGLAIFINFFGAPRSSPLVGGMTLALMSLPIIIVSSKAALKA 269

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP+SIR A   LG +K Q V  HVLPLA P ILTGS +SLA+A+GETAPL+ VGM+AF+ 
Sbjct: 270 VPASIRQAGFALGLTKWQIVKDHVLPLATPGILTGSIISLAQAMGETAPLIIVGMIAFIP 329

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P  +   AT  P QI+ W+   ER +VERT   IL+LL  L  +N   ++ R +F+++
Sbjct: 330 DAPDSIFHAATVMPAQIFTWSGMPERAYVERTAAGILVLLSVLLSLNAVAIYFRKKFERK 389

Query: 425 W 425
           W
Sbjct: 390 W 390


>gi|87200292|ref|YP_497549.1| phosphate ABC transporter permease [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135973|gb|ABD26715.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 428

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 165/399 (41%), Positives = 243/399 (60%), Gaps = 18/399 (4%)

Query: 28  AVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI-VDPQKKRFMDPAILLRADYN 86
           AV    + L  LL S+ S G     +T +   I  +  + +D Q+    DP   L     
Sbjct: 47  AVAFSAIMLAFLLVSMSSAGFAGFQRTEVKFSIPLAGAMQIDAQRLTQPDPVGGLEL--- 103

Query: 87  LLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASAN 146
                A   K+    +  AL      ML+  A   +   L+ DPSL+  T++VSL AS +
Sbjct: 104 -----AGLPKVVDGAAKAALGPDGGDMLAEGAWREVAARLIEDPSLLNGTLDVSLPASDD 158

Query: 147 IDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVA 206
           + SAL+G     A++ +++        KL  +G L   F+ GF     ++ P+  GI  A
Sbjct: 159 LASALRGE--GDASLQQVA-------TKLRGEGKLLRAFDKGFLSRSDATSPQSVGIWGA 209

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           + GS+  M + + L+FP+G+ +A+YLEE++ K  ++ +++ +INNLA+VPSI++G+LG A
Sbjct: 210 LKGSMLTMFVTLVLAFPVGVLAALYLEEYAPKNRWTEWIEISINNLAAVPSIIFGLLGLA 269

Query: 267 VLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFH 326
           V +  F   RS  L+GG+ LALMT+P I+I+   A++ VP SIR AAL +GASKVQ VFH
Sbjct: 270 VFLALFPHYRSAPLIGGMTLALMTMPVIVISGRNAIKAVPPSIRDAALAIGASKVQVVFH 329

Query: 327 HVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA 386
           HVLPLA+P ILTG+ + +ARALGETAPLL +GM AFV   P G T  ++  PVQI+LW+ 
Sbjct: 330 HVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFVASPPSGFTAPSSVLPVQIFLWSD 389

Query: 387 DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           + +R FVERT  AI++LL+FL ++N   ++LRNRF+KRW
Sbjct: 390 EIDRGFVERTSAAIVVLLVFLLLMNGLAIYLRNRFEKRW 428


>gi|315635497|ref|ZP_07890763.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Arcobacter butzleri JV22]
 gi|315480255|gb|EFU70922.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Arcobacter butzleri JV22]
          Length = 359

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 205/330 (62%), Gaps = 6/330 (1%)

Query: 96  KLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL 155
           K S+ D+  A+ ++   ++S      +   L  +P  +  T  + +LA   +D  +K + 
Sbjct: 36  KESLEDTRFAVDKKYRDIVSRAWLRDIPHLLKQNPDYMNTTQNLWVLADDQVDQYIKNH- 94

Query: 156 YSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMML 215
                 + + + +     +L S G +   FN  FF NG S  PE AGI  AVVGS+  ++
Sbjct: 95  -----NNNLKEKEILLVDELYSQGLIEKKFNAIFFKNGDSKIPEYAGIFSAVVGSILTLI 149

Query: 216 IVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMP 275
           I + ++FP+G+ +AIYLEEF+    F+ F++ NINNLA++PSI++G+LG A+ IN F MP
Sbjct: 150 ITMLVAFPIGVMTAIYLEEFAGDNKFTRFIEININNLAAIPSILFGLLGLAIFINLFGMP 209

Query: 276 RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPA 335
           RS+ LVGGL LALMTLP II+++  ALR VP SIR A  GLG +K+Q    HVLPLA P 
Sbjct: 210 RSSPLVGGLTLALMTLPIIIVSSRAALRAVPDSIRQAGYGLGLNKIQVTRDHVLPLAFPG 269

Query: 336 ILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVER 395
           ILTGS + LA+A+GETAPL+ +GM+AF+ D P  VT  AT  P Q++ WA   E  ++E+
Sbjct: 270 ILTGSIIGLAQAMGETAPLIIIGMIAFIPDAPTMVTQAATVMPAQLFTWAGMPEGMYIEK 329

Query: 396 TFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           T   IL+LL  L  +N   ++LR + + +W
Sbjct: 330 TAAGILVLLTILISLNAIAIYLRKKLEVKW 359


>gi|85373910|ref|YP_457972.1| phosphate ABC transporter permease [Erythrobacter litoralis
           HTCC2594]
 gi|84786993|gb|ABC63175.1| probable phosphate ABC transporter, permease protein (PstA)
           [Erythrobacter litoralis HTCC2594]
          Length = 412

 Score =  266 bits (679), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 155/419 (36%), Positives = 246/419 (58%), Gaps = 17/419 (4%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           ++ LK RY SE  F+     A+    + L LLL +++  G+    +  + + I+F+    
Sbjct: 10  EQRLKQRYASERRFKMLGFSAIAFSVLVLALLLGNMLYSGVAGFQRDELRVSIDFT---- 65

Query: 68  DPQKKRFMDPAILLRAD-YNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTL 126
             Q     +   L ++D    L R+ L + +  + +       A++ +S  A   + + +
Sbjct: 66  --QAGLAGNADTLSQSDAVQELERQGLPQVIEFAATEQLGAAGAAE-VSNQAWREVAQDI 122

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
           + DP L+    +  L  S ++   + G           S       Q+L ++G L  +F+
Sbjct: 123 IADPGLLQSQEDFWLPTSGDLAQGVDG---------EGSPEMQALAQRLVAEGKLETNFD 173

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
            GF     ++ P++ GI  A+ GS+  ML+ + L+FP+G+ +A+YLEE++ K  ++  ++
Sbjct: 174 IGFLTRSDATDPQMVGIWGALKGSILTMLVTLALAFPIGVLAALYLEEYAPKNRWTDILE 233

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
            +INNLA+VPSI++G+LG AV +  F   RS  L+GG+ LALMT+P I+I+   A++ VP
Sbjct: 234 VSINNLAAVPSIIFGLLGLAVFLTIFPNMRSAPLIGGMTLALMTMPVIVISGRNAIKAVP 293

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            SIR  AL +GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AFV   
Sbjct: 294 PSIRDGALAVGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFVASP 353

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           P G T  AT  PVQI+LW+ + +  F+ERT  AI++LL+FL ++N   ++LRN+F+K W
Sbjct: 354 PDGFTSPATVLPVQIFLWSDEIDTGFIERTSAAIIVLLLFLLLMNGLAIYLRNKFEKSW 412


>gi|222823803|ref|YP_002575377.1| phosphate ABC transporter permease [Campylobacter lari RM2100]
 gi|222539025|gb|ACM64126.1| phosphate ABC transporter, permease protein [Campylobacter lari
           RM2100]
          Length = 362

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 236/418 (56%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+ +C + + +  +FL + LSS+   GIGA  QT+I           
Sbjct: 2   KKLFKQRKKASKNFKRFCKIGLYINLIFLCVFLSSVGYLGIGAFKQTYI----------- 50

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                         +AD N                ++ LL +A Q    T          
Sbjct: 51  ------------YTQADRN--------------SPSYELLSRAEQRKIRT---------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K       N +++SD Q K   +L     + L FN
Sbjct: 75  ------GQIKEKSWLLANSEVDQYMK------KNYNKLSDEQKKLVDELVQKQEIKLSFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+ +AIYLEEF+ +  F+ F++
Sbjct: 123 TNFFLNGDSKSPENSGIFASVVGTLLVMLVCMAVSIPIGVGAAIYLEEFAPQNVFTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +K+Q +   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKIQMIKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              V    +  P QI+ W+A  ER F+ERT   I++LL  L ++N A + LR  F+ +
Sbjct: 303 ANSVFAPTSVLPAQIFSWSAMPERAFLERTAAGIIVLLSLLVILNLAAILLRRYFQGK 360


>gi|114799902|ref|YP_760729.1| phosphate ABC transporter permease PtsA [Hyphomonas neptunium ATCC
           15444]
 gi|114740076|gb|ABI78201.1| phosphate ABC transporter, permease protein PtsA [Hyphomonas
           neptunium ATCC 15444]
          Length = 525

 Score =  252 bits (644), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 133/268 (49%), Positives = 183/268 (68%)

Query: 158 PANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIV 217
           P     +SD Q  W   L   G +     +    +  S+ PE+AG   A+VGSL+ ML+ 
Sbjct: 258 PEAQRVVSDQQIAWTLALQEMGRISRVPRWSLLTHSDSTYPELAGGLAALVGSLFTMLVT 317

Query: 218 IGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS 277
             ++ P+GI +A+YLEEF+ K   + F++ NINNLA+VPSIV+G+LG+AV INF  MPRS
Sbjct: 318 ALVAIPIGILAAVYLEEFAPKNRLTDFIEVNINNLAAVPSIVFGLLGAAVYINFLGMPRS 377

Query: 278 TALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAIL 337
             LVGGL+LALMT P +IIA   AL+ VP S+RS AL +GAS++QTVFHHV+PLA P IL
Sbjct: 378 APLVGGLVLALMTFPVVIIAARAALKAVPPSVRSGALAIGASQMQTVFHHVVPLAAPGIL 437

Query: 338 TGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF 397
           TG+ + +ARALGETAPLL +GMVAFV D P   TD +T  PV I+ W+ +AER +   T 
Sbjct: 438 TGAILGMARALGETAPLLLIGMVAFVGDVPSSPTDESTVMPVLIFSWSNNAERAWEPMTS 497

Query: 398 GAILLLLIFLAVINTAMLWLRNRFKKRW 425
             I++LL  L ++N  +++LR ++++RW
Sbjct: 498 AMIVILLAVLLLMNGLVVFLRRKYERRW 525



 Score = 43.9 bits (102), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 75/181 (41%), Gaps = 4/181 (2%)

Query: 9   KNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD 68
           K LK R  S+  FR Y + A+ +    L++L  SI S+ I A         I     ++ 
Sbjct: 16  KRLKRRRASDVRFRLYGMGAIFLALGALVMLALSIGSQAISAATYHVARYDITLDPAVIA 75

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
           P  +   +        +  LVR  L      SD + A   + S+ ++  A     + +  
Sbjct: 76  PPGENTPEEIARNVDGFWELVRDNLIATFPESDRDRATRLEVSEFITRLAVLPAARKVAA 135

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
            P LIG  +E++   + ++D  LKG  ++   V R+S       Q+   DG++ L     
Sbjct: 136 RPQLIGNEIELAAPLNDDLDLYLKGQAFAERRV-RVSGITSVAAQE---DGSVLLTGQGA 191

Query: 189 F 189
           F
Sbjct: 192 F 192


>gi|148925971|ref|ZP_01809658.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|145844957|gb|EDK22061.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8486]
          Length = 362

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 234/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L ++N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVMLNLSAILLRKYFQGK 360


>gi|153952260|ref|YP_001398147.1| phosphate ABC transporter permease [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939706|gb|ABS44447.1| putative phosphate ABC transporter, permease protein PstA
           [Campylobacter jejuni subsp. doylei 269.97]
          Length = 362

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 154/417 (36%), Positives = 230/417 (55%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   GIGA  QT+I +    +  + 
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGIGAFKQTYIFVEANRNSPVY 61

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D                                            +LS   +  +R   +
Sbjct: 62  D--------------------------------------------LLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K         +R+S+ Q      L     + L FN 
Sbjct: 78  TEKSW--------LLANSEVDQYMK------QKYNRLSEKQRALVDDLVQKDEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|157414897|ref|YP_001482153.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|157385861|gb|ABV52176.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|307747535|gb|ADN90805.1| Phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni M1]
          Length = 362

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 160/418 (38%), Positives = 234/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|86151687|ref|ZP_01069901.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315124135|ref|YP_004066139.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
 gi|85841316|gb|EAQ58564.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315017857|gb|ADT65950.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
          Length = 362

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 160/418 (38%), Positives = 234/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQIAEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|57238189|ref|YP_178730.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni RM1221]
 gi|57166993|gb|AAW35772.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni RM1221]
 gi|315058029|gb|ADT72358.1| Phosphate transport system permease protein PstA [Campylobacter
           jejuni subsp. jejuni S3]
          Length = 362

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 233/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLMQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L ++N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVMLNLSAILLRKYFQGK 360


>gi|218562266|ref|YP_002344045.1| putative phosphate transport system permease [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|112359972|emb|CAL34761.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni NCTC 11168]
 gi|315927351|gb|EFV06695.1| phosphate ABC transporter, permease protein PstA [Campylobacter
           jejuni subsp. jejuni DFVF1099]
          Length = 362

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 160/418 (38%), Positives = 233/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLMQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDSTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|205355465|ref|ZP_03222236.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|205346699|gb|EDZ33331.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8421]
          Length = 362

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 160/418 (38%), Positives = 233/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|57167644|ref|ZP_00366784.1| probable phosphate transport system permease protein Cj0615
           [Campylobacter coli RM2228]
 gi|57020766|gb|EAL57430.1| probable phosphate transport system permease protein Cj0615
           [Campylobacter coli RM2228]
          Length = 362

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 232/417 (55%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I           
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI----------- 50

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                        + A+ N                ++ LL +A Q         +R   +
Sbjct: 51  ------------FVEANRN--------------SPSYDLLSRAEQ-------RKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K         +R+S+ Q      L   G + L FN 
Sbjct: 78  TEKSW--------LLANSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|305433150|ref|ZP_07402306.1| phosphate ABC superfamily ATP binding cassette transporter,
           permease protein [Campylobacter coli JV20]
 gi|304443851|gb|EFM36508.1| phosphate ABC superfamily ATP binding cassette transporter,
           permease protein [Campylobacter coli JV20]
          Length = 362

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 233/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLMQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|283956028|ref|ZP_06373517.1| putative phosphate ABC transporter, permease protein PstA
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792504|gb|EFC31284.1| putative phosphate ABC transporter, permease protein PstA
           [Campylobacter jejuni subsp. jejuni 1336]
          Length = 342

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 136/292 (46%), Positives = 196/292 (67%), Gaps = 7/292 (2%)

Query: 134 GKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFIN 192
           G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN  FF+N
Sbjct: 55  GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRALVDDLVQKGEIELKFNSNFFLN 108

Query: 193 GASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNL 252
           G S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +  F+ F++  INNL
Sbjct: 109 GDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNLFTHFIEVCINNL 168

Query: 253 ASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSA 312
           AS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  ++++A
Sbjct: 169 ASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDINMKNA 228

Query: 313 ALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTD 372
           A  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D    + D
Sbjct: 229 AYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVASSIFD 288

Query: 373 IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 289 PTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 340


>gi|284925876|gb|ADC28228.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni IA3902]
          Length = 362

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 233/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQIAEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|88596972|ref|ZP_01100208.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|88190661|gb|EAQ94634.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 84-25]
          Length = 362

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 157/418 (37%), Positives = 231/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I           
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI----------- 50

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                        + A+ N                ++ LL +A Q    T          
Sbjct: 51  ------------FVEANRN--------------SPSYDLLSRAEQRKIRT---------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQIAEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLMQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDSTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|86149928|ref|ZP_01068157.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85839746|gb|EAQ57006.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni CF93-6]
          Length = 362

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 158/418 (37%), Positives = 234/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I          V
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI---------FV 52

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +     PA      Y+LL R A  RK+                              
Sbjct: 53  EANRN---SPA------YDLLSR-AEQRKIRT---------------------------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRILVDDLMQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F +PRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGIPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L ++N + ++LR  F+ +
Sbjct: 303 ASSIFDSTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVMLNLSAIFLRKYFQGK 360


>gi|315931816|gb|EFV10771.1| phosphate ABC transporter, permease protein PstA [Campylobacter
           jejuni subsp. jejuni 327]
          Length = 342

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 196/292 (67%), Gaps = 7/292 (2%)

Query: 134 GKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFIN 192
           G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN  FF+N
Sbjct: 55  GQITEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFNSNFFLN 108

Query: 193 GASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNL 252
           G S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++  INNL
Sbjct: 109 GDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEVCINNL 168

Query: 253 ASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSA 312
           AS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  ++++A
Sbjct: 169 ASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDINMKNA 228

Query: 313 ALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTD 372
           A  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D    + D
Sbjct: 229 AYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDVASSIFD 288

Query: 373 IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 289 PTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 340


>gi|121612431|ref|YP_001000317.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167005266|ref|ZP_02271024.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87250397|gb|EAQ73355.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 362

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 156/418 (37%), Positives = 231/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I           
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI----------- 50

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                        + A+ N                ++ LL +A Q    T          
Sbjct: 51  ------------FVEANRN--------------SPSYDLLSRAEQRKIRT---------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LLA++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQIAEKSWLLANSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|86153473|ref|ZP_01071677.1| phosphate ABC transporter, permease protein PstA [Campylobacter
           jejuni subsp. jejuni HB93-13]
 gi|85843199|gb|EAQ60410.1| phosphate ABC transporter, permease protein PstA [Campylobacter
           jejuni subsp. jejuni HB93-13]
          Length = 362

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 155/418 (37%), Positives = 231/418 (55%), Gaps = 60/418 (14%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I           
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYI----------- 50

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                        + A+ N                ++ LL +A Q    T          
Sbjct: 51  ------------FVEANRN--------------SPSYDLLSRAEQRKIRT---------- 74

Query: 128 TDPSLIGKTVEVS-LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                 G+  E S LL ++ +D  +K         +R+S+ Q      L   G + L FN
Sbjct: 75  ------GQIAEKSWLLVNSEVDQYMK------QKYNRLSEKQRTLVDDLVQKGEIELKFN 122

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
             FF+NG S  PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++
Sbjct: 123 SNFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIE 182

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
             INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V 
Sbjct: 183 VCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVD 242

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D 
Sbjct: 243 INMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDV 302

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 ASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|283954104|ref|ZP_06371629.1| LOW QUALITY PROTEIN: phosphate ABC transporter, permease protein
           PstC, putative [Campylobacter jejuni subsp. jejuni 414]
 gi|283794383|gb|EFC33127.1| LOW QUALITY PROTEIN: phosphate ABC transporter, permease protein
           PstC, putative [Campylobacter jejuni subsp. jejuni 414]
          Length = 666

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 156/405 (38%), Positives = 230/405 (56%), Gaps = 60/405 (14%)

Query: 21  FRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAIL 80
           F+  C + + +  VFL + L S+   GIGA  Q++I          V+  +     PA  
Sbjct: 319 FKRLCKMGLYINLVFLCIFLGSVAYLGIGAFKQSYI---------FVEANRN---SPA-- 364

Query: 81  LRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVS 140
               Y+LL R A  RK+ I                                  G+  E +
Sbjct: 365 ----YDLLSR-AEQRKIRI----------------------------------GQITEKT 385

Query: 141 -LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPE 199
            LLA++ +D       Y     +R+++ Q      L   G + L FN  FF+NG S  PE
Sbjct: 386 WLLANSEVDQ------YMKQKYNRLNEKQRVLVDDLVQKGEIELKFNSNFFLNGDSKSPE 439

Query: 200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIV 259
            +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++  INNLAS+PSI+
Sbjct: 440 NSGILSSVIGTLLVMLVCMVVSVPMGVAAAIYLEEFAPQNILTHFIEVCINNLASIPSIL 499

Query: 260 YGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGAS 319
           +G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  ++++AA  LG +
Sbjct: 500 FGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDINMKNAAYALGMT 559

Query: 320 KVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPV 379
           KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D    + D  +  P 
Sbjct: 560 KVQMVKGIMLPLAMPMILTGSILALAGAIGETAPLMIIGMIAFIPDVASSIFDPTSVLPA 619

Query: 380 QIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 620 QIYSWSAMPERAFLERTAAGIIVLLGLLVVLNFSAILLRKYFQGK 664



 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 110/226 (48%), Gaps = 17/226 (7%)

Query: 209 GSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL 268
           G+ Y+ LI +  + PLG+  AIYL  F+ K    ++++  +  +A +P++V+G   + V+
Sbjct: 77  GTFYISLIAMLTALPLGVMCAIYLGVFAGKKS-KNYLKPILEIIAGIPTVVFGFFAAIVV 135

Query: 269 INF-------FKMPRS--TALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGAS 319
             F       F +  S  +AL  G I+ +M +P +   +   +  V     + A  LG +
Sbjct: 136 APFIVWFFSLFGIQASFQSALGAGFIMGIMIVPIVASLSQDCIEAVSEKRINGAYALGMT 195

Query: 320 KVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPV 379
           K + VF  +LP A+P I+    + L+RALGET  ++ V   +   +  +   +  T   V
Sbjct: 196 KKEVVFAVILPEAIPGIVAACLLGLSRALGET--MIVVMAASLRPNLTLNFLEDMTTVTV 253

Query: 380 QIYLWAADAERPFVE----RTFGAILLLLIFLAVINTAMLWLRNRF 421
           +I + A   ++ F        F   L+L I   +IN   ++L NRF
Sbjct: 254 KI-VEALSGDQAFDSSLALSAFSLGLVLFIITLIINMFSVYLINRF 298


>gi|84514491|ref|ZP_01001855.1| phosphate ABC transporter, permease protein [Loktanella
           vestfoldensis SKA53]
 gi|84511542|gb|EAQ07995.1| phosphate ABC transporter, permease protein [Loktanella
           vestfoldensis SKA53]
          Length = 575

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 140/352 (39%), Positives = 209/352 (59%), Gaps = 22/352 (6%)

Query: 96  KLSISDSNHALLRQA-------SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANID 148
           + +++D+  AL + A       S ++  T R  +R  L+ +P L+G T +  +    ++ 
Sbjct: 224 QAALTDAAGALRQPAQFDDAALSSIIFATNRRDVRDQLVDNPDLVGTTEKTGVPIDISVT 283

Query: 149 SALKGYLYSPANVHRMSDYQWKWFQKLDS--DGALFLD-FNYGFFINGASSRPEVAGIGV 205
             L G L           +       +D+  +  L  + F + FF N  S   E+ GIG 
Sbjct: 284 RYLSGELSGVGTAQMPPGFDIGQLALVDAMVEADLISNSFRWHFFTNPYSQSGEITGIGP 343

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A++GS YMML+V+  S   G+A++IYLEEF+ K  F++F++ NI NLA+VPSIV+GILG+
Sbjct: 344 ALMGSAYMMLVVLVFSLVFGVAASIYLEEFAPKNRFTNFIEINIANLAAVPSIVFGILGA 403

Query: 266 AVL-----INFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           A+L     + F    R TAL+GGL+L+LMTLP+I+IAT  AL+ VP SI  AALG+GASK
Sbjct: 404 AILFTLMDLGFGSSIRGTALLGGLVLSLMTLPTIVIATRAALKAVPPSIADAALGVGASK 463

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM------VAFVTDYPVGVTDIA 374
           VQ VFHH LPLA P ILTG+ + +A+ALGETAPLL +G+          + +  G+ + A
Sbjct: 464 VQMVFHHKLPLAAPGILTGTIIGIAQALGETAPLLLIGLSVSTGAALLSSPFSGGLLEQA 523

Query: 375 TAFPVQIYLWAADAERPFVER-TFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            + P  +YL A + + P  E     AIL++L+ L  +N   + LR +F++RW
Sbjct: 524 QSMPTVVYLLAQNQDAPVREGLAQSAILVMLVLLFALNILAIILRRKFERRW 575


>gi|269958661|ref|YP_003328448.1| phosphate ABC transporter permease [Anaplasma centrale str. Israel]
 gi|269848490|gb|ACZ49134.1| phosphate ABC transporter permease [Anaplasma centrale str. Israel]
          Length = 415

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 139/361 (38%), Positives = 208/361 (57%), Gaps = 22/361 (6%)

Query: 36  LILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALAR 95
           LIL+L SIV+ G  AL  T I L  +  E  VDP    F    I     Y   ++ AL R
Sbjct: 43  LILVLCSIVNNGYKALTTTKILLSFDEVER-VDPDDSAFRSVCI----QY---IQDALER 94

Query: 96  --KLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKG 153
             + S+   NH   R A  ++S TA Y L   +     L   +V  +  AS++  S++ G
Sbjct: 95  VVQNSVDLGNHETRRIAHSVISETAHYDLANLIKKGTQLSNTSVWFN--ASSDFVSSIPG 152

Query: 154 YLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYM 213
                 NV           QKL ++  +   FN   F +  S  PE AGI  A++GSL  
Sbjct: 153 N-----NV-----VYDAIMQKLVAENRVKRFFNSALFTSSHSKVPESAGITGALIGSLLT 202

Query: 214 MLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK 273
           +++ + L+ P+G+ S I ++E   +G  +S ++ +INNL+SVPSI++G+LG  V +N F 
Sbjct: 203 IMVCLALAIPVGVMSGICMQELLKRGKLASMIEVSINNLSSVPSIIFGVLGLIVYLNIFG 262

Query: 274 MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAM 333
           +PRS+AL GG+ L++M LP++II+T  A   VP S++ AA  LGAS++Q + HH LP+A+
Sbjct: 263 VPRSSALAGGMTLSIMILPNLIISTRQAFAAVPESVKQAAFALGASEMQVIMHHSLPIAL 322

Query: 334 PAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFV 393
           PA++ G  VS+AR +GE++PL+ +GMVAFV D P    D A+  PVQIY+WA ++   F 
Sbjct: 323 PAVVQGVMVSVARIIGESSPLIMIGMVAFVVDLPKTFLDPASVLPVQIYIWANNSNIEFT 382

Query: 394 E 394
           +
Sbjct: 383 K 383


>gi|56416925|ref|YP_153999.1| phosphate ABC transporter [Anaplasma marginale str. St. Maries]
 gi|56388157|gb|AAV86744.1| phosphate ABC transporter [Anaplasma marginale str. St. Maries]
          Length = 461

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 144/389 (37%), Positives = 222/389 (57%), Gaps = 22/389 (5%)

Query: 35  FLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALA 94
            L+L+L SIV+ G  AL  T I L  +  E I DP    F D  I         ++ AL 
Sbjct: 88  MLVLVLCSIVNNGYKALTTTKILLSFDQIEHI-DPGDSGFRDVCIQH-------IQGALE 139

Query: 95  R--KLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALK 152
           +  + S+  SN    R A  ++S TA Y+    +    SL   +V  +  AS++  S+  
Sbjct: 140 KIVQNSVDLSNPETRRIAHSIISETAHYNFAHLIEKGTSLSNASVWFN--ASSDFVSSTP 197

Query: 153 GYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLY 212
           G           ++      +KL ++  +   FN   F N  S  PE AGI  A++GSL 
Sbjct: 198 GS----------NEVYDAIMRKLVAENRIKRFFNSALFTNSHSKVPESAGITGALIGSLL 247

Query: 213 MMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFF 272
            +++ + L+ P+G+ S I ++E   +G  +S ++ +INNL+SVPSI++G+LG  V +N F
Sbjct: 248 TIIVCLALAIPVGVMSGICMQELLKRGKLASMIEVSINNLSSVPSIIFGVLGLIVYLNIF 307

Query: 273 KMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLA 332
            +PRS+AL GG+ L++M LP++II+T  A   VP S++ AA  LGAS++Q + HH LP+A
Sbjct: 308 GVPRSSALAGGMTLSIMILPNLIISTRQAFAAVPESVKQAAFALGASEMQVIMHHSLPIA 367

Query: 333 MPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPF 392
           +P ++ G  VS+AR +GE++PL+ +GMVAFV D P    D A+  PVQIY+WA ++   F
Sbjct: 368 LPTVVQGVMVSVARMIGESSPLIMIGMVAFVVDLPRTFLDPASVLPVQIYIWANNSNIEF 427

Query: 393 VERTFGAILLLLIFLAVINTAMLWLRNRF 421
            + +  AIL LL+ L ++N     +R RF
Sbjct: 428 TKISAIAILALLVILLILNMIADLIRKRF 456


>gi|222475292|ref|YP_002563708.1| phosphate ABC transporter (pstA) [Anaplasma marginale str. Florida]
 gi|254995109|ref|ZP_05277299.1| phosphate ABC transporter (pstA) [Anaplasma marginale str.
           Mississippi]
 gi|255003275|ref|ZP_05278239.1| phosphate ABC transporter (pstA) [Anaplasma marginale str. Puerto
           Rico]
 gi|255004404|ref|ZP_05279205.1| phosphate ABC transporter (pstA) [Anaplasma marginale str.
           Virginia]
 gi|222419429|gb|ACM49452.1| phosphate ABC transporter (pstA) [Anaplasma marginale str. Florida]
          Length = 487

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 144/389 (37%), Positives = 222/389 (57%), Gaps = 22/389 (5%)

Query: 35  FLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALA 94
            L+L+L SIV+ G  AL  T I L  +  E I DP    F D  I         ++ AL 
Sbjct: 114 MLVLVLCSIVNNGYKALTTTKILLSFDQIEHI-DPGDSGFRDVCIQH-------IQGALE 165

Query: 95  R--KLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALK 152
           +  + S+  SN    R A  ++S TA Y+    +    SL   +V  +  AS++  S+  
Sbjct: 166 KIVQNSVDLSNPETRRIAHSIISETAHYNFAHLIEKGTSLSNASVWFN--ASSDFVSSTP 223

Query: 153 GYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLY 212
           G           ++      +KL ++  +   FN   F N  S  PE AGI  A++GSL 
Sbjct: 224 GS----------NEVYDAIMRKLVAENRIKRFFNSALFTNSHSKVPESAGITGALIGSLL 273

Query: 213 MMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFF 272
            +++ + L+ P+G+ S I ++E   +G  +S ++ +INNL+SVPSI++G+LG  V +N F
Sbjct: 274 TIIVCLALAIPVGVMSGICMQELLKRGKLASMIEVSINNLSSVPSIIFGVLGLIVYLNIF 333

Query: 273 KMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLA 332
            +PRS+AL GG+ L++M LP++II+T  A   VP S++ AA  LGAS++Q + HH LP+A
Sbjct: 334 GVPRSSALAGGMTLSIMILPNLIISTRQAFAAVPESVKQAAFALGASEMQVIMHHSLPIA 393

Query: 333 MPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPF 392
           +P ++ G  VS+AR +GE++PL+ +GMVAFV D P    D A+  PVQIY+WA ++   F
Sbjct: 394 LPTVVQGVMVSVARMIGESSPLIMIGMVAFVVDLPRTFLDPASVLPVQIYIWANNSNIEF 453

Query: 393 VERTFGAILLLLIFLAVINTAMLWLRNRF 421
            + +  AIL LL+ L ++N     +R RF
Sbjct: 454 TKISAIAILALLVILLILNMIADLIRKRF 482


>gi|57239255|ref|YP_180391.1| phosphate ABC transporter permease [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579218|ref|YP_197430.1| phosphate ABC transporter permease [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161334|emb|CAH58257.1| putative ABC transporter, membrane-spanning protein [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417844|emb|CAI27048.1| Phosphate transport system permease protein pstA [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 420

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/403 (33%), Positives = 215/403 (53%), Gaps = 40/403 (9%)

Query: 9   KNLKYRYIS---------EWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           K LK+R+I+         + +     + A++     L L+L SI++ G  AL  T I LP
Sbjct: 9   KLLKHRHIASRVSLKNRKDRILSILSMSALISSLGILFLILGSIINNGYNALTATEILLP 68

Query: 60  IEFSE-TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTA 118
           I  ++ T  D    R     IL+ + +  L     +  + ISD N+        ++S TA
Sbjct: 69  ITINKSTTADNMALR----GILIDSIHKSL-ETLFSDVVDISDPNNK--NTIYSIISDTA 121

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKW------- 171
            ++L   +  +P                  +  K +  S    +R+   +  +       
Sbjct: 122 HHNLADFIYKNPE----------------TTTFKMWFKSSTTFNRIIKQKNTYNKVYSAI 165

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
             KL ++  +   FN   FI   S  PE +GI  +++GS++ ++I +  + P+GI S I 
Sbjct: 166 ITKLQNENLIKQSFNNALFIKYNSRSPESSGIIGSLIGSIFSIIICLTFAVPIGITSGIC 225

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           L E   K   S  ++ +I NLA+VPSI++GILG A+ IN FK+PRS++ +GGL L+LM L
Sbjct: 226 LNELIPKNRISYIIEVSITNLAAVPSIIFGILGLAIYINIFKIPRSSSFIGGLTLSLMML 285

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P+++IAT  AL  VPSS++ AA  LGAS +Q + HH  PLA+P I+ G  +S+AR LGE+
Sbjct: 286 PNLVIATKQALTAVPSSVKDAAFSLGASNMQVIMHHSFPLALPGIMQGVILSIARILGES 345

Query: 352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
           +PL+ +GMVAF+ D P    D  T  PVQIY+WA++    F++
Sbjct: 346 SPLIMIGMVAFIVDIPKNFLDPTTVLPVQIYMWASNPHIEFIQ 388


>gi|58617270|ref|YP_196469.1| phosphate ABC transporter permease [Ehrlichia ruminantium str.
           Gardel]
 gi|58416882|emb|CAI27995.1| Phosphate transport system permease protein pstA [Ehrlichia
           ruminantium str. Gardel]
          Length = 420

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 137/403 (33%), Positives = 216/403 (53%), Gaps = 40/403 (9%)

Query: 9   KNLKYRYIS---------EWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           K LK+R+I+         + +     + A++     L L+L SI++ G  AL  T I LP
Sbjct: 9   KLLKHRHIASRVSLKNRKDRILSILSMSALISSLGILFLILGSIINNGYNALTATEILLP 68

Query: 60  IEFSE-TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTA 118
           I  ++ T  D    R     IL+ + +  L     +  + ISD N+        ++S TA
Sbjct: 69  ITINKSTTADNMALR----GILIDSIHKSL-ETLFSDVVDISDPNNK--NTIYSIISDTA 121

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQ----- 173
            ++L   +  +P                  +  K +  S    +R+   +  + +     
Sbjct: 122 HHNLADFIYKNPE----------------TTTFKMWFKSSTTFNRIIKQKNTYNKVYSAI 165

Query: 174 --KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
             KL ++  +   FN   FI   S  PE +GI  +++GS++ ++I +  + P+GI S I 
Sbjct: 166 ITKLQNENLIKQSFNNALFIKYNSRSPESSGIIGSLIGSIFSIIICLIFAVPIGITSGIC 225

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           L E   K   S  ++ +I NLA+VPSI++GILG A+ IN FK+PRS++ +GGL L+LM L
Sbjct: 226 LNELIPKNRISYIIEVSITNLAAVPSIIFGILGLAIYINIFKIPRSSSFIGGLTLSLMML 285

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P+++IAT  AL  VPSS++ AA  LGAS +Q + HH  PLA+P I+ G  +S+AR LGE+
Sbjct: 286 PNLVIATKQALTAVPSSVKDAAFSLGASNMQVIMHHSFPLALPGIMQGVILSIARILGES 345

Query: 352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
           +PL+ +GMVAF+ D P    D  T  PVQIY+WA++    F++
Sbjct: 346 SPLIMIGMVAFIVDIPKNFLDPTTVLPVQIYMWASNPHIEFIQ 388


>gi|68171174|ref|ZP_00544581.1| Binding-protein-dependent transport systems inner membrane
           component [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657651|ref|YP_507307.1| putative phosphate ABC transporter, permease protein [Ehrlichia
           chaffeensis str. Arkansas]
 gi|67999405|gb|EAM86047.1| Binding-protein-dependent transport systems inner membrane
           component [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599108|gb|ABD44577.1| putative phosphate ABC transporter, permease protein [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 422

 Score =  219 bits (557), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 144/424 (33%), Positives = 235/424 (55%), Gaps = 26/424 (6%)

Query: 9   KNLKYRYIS---------EWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           K LKYR+I+         + +     + A++     L ++L SIV+ G  AL  T I L 
Sbjct: 9   KLLKYRHIASRISLKNRKDRILSILSMTALVSSLGILFIILGSIVNNGYNALTTTKILLS 68

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLS--ISDSNHALLRQASQMLSTT 117
           I  +   ++ Q K      + LR +    + ++L    S  I  SN    +    +++ T
Sbjct: 69  ITINNDTIEQQDK------LTLRNNLIYFIHQSLEELFSNVIDLSNPDNRKIIYNIINDT 122

Query: 118 ARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDS 177
           A ++L   L+ +P        +   +S   + A+K       N++  + YQ K   KL +
Sbjct: 123 AHHNLADFLLKNPK--STKFNIWFQSSTTFNKAIKN-----KNINH-AIYQ-KVIAKLQN 173

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           +  + + FN   F    S  PE  GI  +++GS++ ++I +  + P+GI S I L E   
Sbjct: 174 ENRIKVSFNDALFTKYNSRSPENTGILGSLIGSMFTIIICLTFALPIGITSGICLSELIP 233

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K   SS ++ +I NLASVPSI++GILG A+ IN F +PRS+AL+GG+ L+LM LP+++ +
Sbjct: 234 KNKISSIIEISITNLASVPSIIFGILGLAIYINIFDIPRSSALIGGMTLSLMMLPNLVTS 293

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  A   VP S++ AA  LGAS +Q + HH  P+A+P+I+ G+ +S+AR LGE++PL+ +
Sbjct: 294 TKQAFAAVPPSVKDAAFSLGASNMQVILHHSFPIALPSIMQGAILSIARILGESSPLIMI 353

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAF+ D P    D  T  PVQIY+WA++    F++    AI+ LL+ L ++N  + ++
Sbjct: 354 GMVAFIVDIPKDFLDPTTVLPVQIYMWASNPHIEFIQLAAIAIVALLLMLLILNLIVTFI 413

Query: 418 RNRF 421
           R +F
Sbjct: 414 RKKF 417


>gi|88607119|ref|YP_504976.1| phosphate ABC transporter, permease protein PtsA [Anaplasma
           phagocytophilum HZ]
 gi|19880590|gb|AAM00409.1|AF392616_4 phosphate ABC transporter [Anaplasma phagocytophilum]
 gi|88598182|gb|ABD43652.1| phosphate ABC transporter, permease protein PtsA [Anaplasma
           phagocytophilum HZ]
          Length = 448

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 141/397 (35%), Positives = 217/397 (54%), Gaps = 34/397 (8%)

Query: 7   NKKNLK--YRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
           ++K+++  +R   +  F    + A+ +    L+L+L SIV+ G  AL  T I L ++ +E
Sbjct: 45  HRKSMRVFFRSKQDRFFSLLSLSALGISVGMLMLVLCSIVNNGYKALTATKILLHLDDTE 104

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLS--ISDSNHALLRQASQMLSTTARYHL 122
           +I    +          R D    +  AL + LS  +  +N    R A  ++S TA Y L
Sbjct: 105 SIRKDSE--------YFREDCIKRIHSALDKILSSHVDLNNPETKRIAYSIVSETAHYEL 156

Query: 123 RKTLMTDPSLIGKTVEVS-----LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDS 177
                    LI K V +S     L AS    S +K         + +S    K F+  + 
Sbjct: 157 -------ADLIQKNVRISPDGLWLNASTEFLSGVKN--------NEISSVVLKTFEDQER 201

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
               F  FN   F N  S  PE AGI  A++GSL  +++ + ++ PLGI + I ++E   
Sbjct: 202 IKRSF--FNKSLFTNSHSKVPENAGILGALIGSLLTIIVCLAIAIPLGIMTGICMQELLS 259

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
               SS ++ +INNL+SVPSI++G+LG  V +N F +PRS++L GG+ L++M LP +I+ 
Sbjct: 260 NNKVSSIIEISINNLSSVPSIIFGVLGLVVYLNIFGVPRSSSLAGGMTLSIMILPYLILT 319

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  AL  VP S++ AAL LGA+ +Q + HH LP+A PA++ G  VS+AR +GE++PL+ +
Sbjct: 320 TRQALAAVPESVKHAALSLGATNMQVIMHHSLPIAFPALVQGVLVSVARIIGESSPLIMI 379

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
           GMVAFV D P    D A+  PVQIY+WA ++   F +
Sbjct: 380 GMVAFVIDLPKTFLDPASVLPVQIYIWANNSSAEFTK 416


>gi|73667154|ref|YP_303170.1| binding-protein dependent transport system inner membrane protein
           [Ehrlichia canis str. Jake]
 gi|72394295|gb|AAZ68572.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Ehrlichia canis str. Jake]
          Length = 421

 Score =  209 bits (531), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 144/425 (33%), Positives = 231/425 (54%), Gaps = 37/425 (8%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           I+ KN K R +S        + A++     L ++L SIV+ G  AL  T I L I+ ++ 
Sbjct: 20  ISLKNRKDRILSTL-----SMSALISSLGILFIILGSIVNNGYNALTTTTILLSIKINDN 74

Query: 66  IVDPQKKRFMDPAILLRADYNLLVRKALARKLS--ISDSNHALLRQASQMLSTTARYHLR 123
           I    K       ++LR++    + ++L    S  I  SN    +    ++S TA ++L 
Sbjct: 75  IEQQDK-------LILRSNLINYIHQSLEELFSDVIDTSNLDNKKIIYSIVSDTAHHNLA 127

Query: 124 KTLMTDPS-------LIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLD 176
             +  +P            T    ++ + + D+ +               Y+ K   KL 
Sbjct: 128 DFVFKNPKANKFNMWFKSSTTFNKIIQTQSTDNTI---------------YK-KIITKLQ 171

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           ++  +   FN   F    S  PE  GI  +++GS++ ++I +  +FP+GI S I L E  
Sbjct: 172 NEHRIKKSFNDTLFKKYNSISPENTGIIGSLIGSMFTIIICLAFAFPIGITSGICLSELI 231

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K   SS ++ +I NLASVPSI++GILG A+ I  F +PRS+AL+GG+ L+LM LP+++I
Sbjct: 232 PKNKISSIIEISITNLASVPSIIFGILGLAIYIKIFNIPRSSALIGGMTLSLMMLPNLVI 291

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           AT  A   VPSS++ AA  LGAS +Q + HH  P+A+P I+ G+ +S+AR LGE++PL+ 
Sbjct: 292 ATKQAFTAVPSSVKDAAFSLGASNMQVILHHSFPIALPGIMQGAILSIARILGESSPLIM 351

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           +GMVAF+ D P    D  T  PVQIY+WA++    F++    AI+ LL+ L ++N  + +
Sbjct: 352 IGMVAFIVDIPKNFLDPTTVLPVQIYMWASNPHIEFIQLAAIAIVALLLMLLILNLIVTF 411

Query: 417 LRNRF 421
           +R +F
Sbjct: 412 IRKKF 416


>gi|172056899|ref|YP_001813359.1| phosphate ABC transporter, inner membrane subunit PstA
           [Exiguobacterium sibiricum 255-15]
 gi|171989420|gb|ACB60342.1| phosphate ABC transporter, inner membrane subunit PstA
           [Exiguobacterium sibiricum 255-15]
          Length = 302

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/248 (43%), Positives = 164/248 (66%), Gaps = 3/248 (1%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DGA +L  +  F  N  S RP+ AGI  A++GS+++ML++I + F LG+ +AIYLEE++ 
Sbjct: 58  DGAAWLSLD--FLQNAPSRRPDRAGIYPALMGSIFLMLLIIPMIFILGVGAAIYLEEYAK 115

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           KG  +SF++ NI+NLA VPSIV+G+LG    +       ST + G L LALM+LP +I++
Sbjct: 116 KGRMTSFIEVNISNLAGVPSIVFGLLGLTFFVRNMGF-GSTLIAGALTLALMSLPVVIVS 174

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           +  A+R VP ++R A+L LGASK QT F  VLP ++P ++TG  ++++RA+GETAPL+ V
Sbjct: 175 SQEAIRAVPQAMRHASLALGASKWQTTFKVVLPASLPGVITGIILAVSRAIGETAPLIMV 234

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           G   F+   P G+    TA P+QIY W +  +  F       I++L++ L  +N+  +W+
Sbjct: 235 GAAIFIARAPEGIFSEFTALPIQIYNWTSRPQADFQGLAAAGIIILMVILLTMNSLAIWI 294

Query: 418 RNRFKKRW 425
           RNRF KR+
Sbjct: 295 RNRFSKRY 302


>gi|327439647|dbj|BAK16012.1| ABC-type phosphate transport system, permease component
           [Solibacillus silvestris StLB046]
          Length = 292

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 166/252 (65%), Gaps = 3/252 (1%)

Query: 174 KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
           ++ S G  FLD N  F  N AS  PE AGI  A+VGSL++M +V  +S  LG+++A+YLE
Sbjct: 44  RILSQGIGFLDMN--FITNFASRIPENAGIKAALVGSLWLMSVVAPVSIILGVSTALYLE 101

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           E++ +   + F++ NI+NLA VPSIV+G+LG  + +  F   +S  L  GL ++L+ LP 
Sbjct: 102 EYAKQNKLNDFIRINISNLAGVPSIVFGLLGLTIFVRLFGFEKSI-LAAGLTMSLLILPV 160

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           II+A   A+R+VP+  R A+ G+GA+K QT+   VLP A+P ILTGS ++L+RA+GETAP
Sbjct: 161 IIVAAQEAIRSVPNEQREASYGMGATKWQTIVRVVLPAAIPGILTGSILALSRAIGETAP 220

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           L+ +G+   +   P G  D  TA P+QI+ WA   +  F       I++L+IFL  +N+ 
Sbjct: 221 LVVIGIPVILQFLPTGYLDTFTALPMQIFDWAKRPQEAFQYVASAGIIVLMIFLLTMNSI 280

Query: 414 MLWLRNRFKKRW 425
            +++RN+F+KR+
Sbjct: 281 AIFIRNKFQKRY 292


>gi|58699112|ref|ZP_00373943.1| phosphate ABC transporter, permease protein PstA [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630683|ref|YP_002727474.1| phosphate ABC transporter, permease protein [Wolbachia sp. wRi]
 gi|58534372|gb|EAL58540.1| phosphate ABC transporter, permease protein PstA [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592664|gb|ACN95683.1| phosphate ABC transporter, permease protein [Wolbachia sp. wRi]
          Length = 416

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 134/393 (34%), Positives = 205/393 (52%), Gaps = 32/393 (8%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           I +KN K R +     RF    A+++     + +L SI+     AL  T I LP+E +  
Sbjct: 20  IKRKNKKNRAL-----RFCSFTALVISLGCPVCILLSILVNSYSALTVTKILLPVEINAD 74

Query: 66  IV---DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           +    +P   R+    +L     N  +RK         D +  L R + + L    R  +
Sbjct: 75  LALASNPSDLRYKSIGLL-----NDSLRKVFG-GTDFKDGDEILSRNSYKELEKFFRKKV 128

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
           + +            E+   AS+ I+S  K           ++D   K    L     + 
Sbjct: 129 KDS---------GEYEIWFTASSIINSINKD--------KYLNDRYAKLLDWLKEKRRVK 171

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FF 241
             FN   F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  K    
Sbjct: 172 KFFNKSLFLKSDSREPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPKNRLM 231

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           ++ V+ +INNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A
Sbjct: 232 TNIVEISINNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNA 291

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
              VP +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVA
Sbjct: 292 FANVPITIKDAAFALGAPHIKVILDHSLPIALPRIIHGTVLAIARILGESSPLLMMGMVA 351

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
           F+ D P    D AT  PVQIY+W+++ E  FVE
Sbjct: 352 FIADTPTSFFDPATVLPVQIYIWSSNPEIAFVE 384


>gi|225631219|ref|ZP_03787913.1| phosphate ABC transporter, permease protein [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
 gi|225591082|gb|EEH12270.1| phosphate ABC transporter, permease protein [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
          Length = 417

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 134/393 (34%), Positives = 205/393 (52%), Gaps = 32/393 (8%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           I +KN K R +     RF    A+++     + +L SI+     AL  T I LP+E +  
Sbjct: 21  IKRKNKKNRAL-----RFCSFTALVISLGCPVCILLSILVNSYSALTVTKILLPVEINAD 75

Query: 66  IV---DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           +    +P   R+    +L     N  +RK         D +  L R + + L    R  +
Sbjct: 76  LALASNPSDFRYKSVGLL-----NDSLRKVFG-GTDFKDGDEILSRNSYKELEKFFRKKV 129

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
           + +            E+   AS+ I+S  K           ++D   K    L     + 
Sbjct: 130 KDS---------GEYEIWFTASSIINSINKD--------KYLNDRYAKLLDWLKEKRRVK 172

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FF 241
             FN   F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  K    
Sbjct: 173 KFFNKSLFLKSDSREPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPKNRLM 232

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           ++ V+ +INNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A
Sbjct: 233 TNIVEISINNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNA 292

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
              VP +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVA
Sbjct: 293 FANVPITIKDAAFALGAPHIKVILDHSLPIALPRIIHGTVLAIARILGESSPLLMMGMVA 352

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
           F+ D P    D AT  PVQIY+W+++ E  FVE
Sbjct: 353 FIADTPTSFFDPATVLPVQIYIWSSNPEIAFVE 385


>gi|99034180|ref|ZP_01314263.1| hypothetical protein Wendoof_01000943 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 409

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 134/393 (34%), Positives = 204/393 (51%), Gaps = 32/393 (8%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           I +KN K R +     RF    A+++     + +L SI+     AL  T I LP+E +  
Sbjct: 20  IKRKNKKNRAL-----RFCSFTALVISLGCPVCILLSILVNSYSALTVTKILLPVEINAD 74

Query: 66  IV---DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           +    +P   R+    +L     N  +RK         D +  L R + + L    R  +
Sbjct: 75  LALASNPSDLRYKSIGLL-----NDSLRKVFG-GTDFKDGDEILSRNSYKELEKFFRKKV 128

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
           + +            E+   AS+ I+S  K           ++D   K    L     + 
Sbjct: 129 KDS---------GEYEIWFTASSIINSINKD--------KYLNDRYAKLLDWLKEKRRVK 171

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FF 241
             FN   F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  K    
Sbjct: 172 KFFNKSLFLKSDSREPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPKNRLM 231

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           ++ V+  INNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A
Sbjct: 232 TNIVEIGINNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNA 291

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
              VP +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVA
Sbjct: 292 FANVPITIKDAAFALGAPHIKVILDHSLPIALPRIIHGTVLAIARILGESSPLLMMGMVA 351

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
           F+ D P    D AT  PVQIY+W+++ E  FVE
Sbjct: 352 FIADTPTSFFDPATVLPVQIYIWSSNPEIAFVE 384


>gi|212638724|ref|YP_002315244.1| phosphate ABC transporter permease [Anoxybacillus flavithermus WK1]
 gi|212560204|gb|ACJ33259.1| ABC-type phosphate transport system, permease component
           [Anoxybacillus flavithermus WK1]
          Length = 293

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 162/241 (67%), Gaps = 1/241 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N+ F  N  S RPE AGI   +VGSL++M+IV  +S  LG+ +AIYLEE++ K  F+ F
Sbjct: 54  LNFDFLNNFPSRRPEDAGIKAGLVGSLWLMVIVAPVSLILGVGTAIYLEEYAKKNRFTDF 113

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           +Q NI+NLA VPSIV+G+LG  + +    + RS  L  GL ++L+ LP I++A   ALR 
Sbjct: 114 IQTNISNLAGVPSIVFGLLGLTLFVRELNLGRSI-LAAGLTMSLLVLPVIVVAAQEALRA 172

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP+ +R A+ G+GA+K QT++  VLP A+P ILTGS ++L+RA+GETAPL+ +G+  F+ 
Sbjct: 173 VPNQLREASYGMGATKWQTIYRIVLPAAIPGILTGSILALSRAIGETAPLVVLGIPTFLA 232

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G+ D  T  P+QIY W +  +  F       I++LL+ L ++N+  +++RN+F+KR
Sbjct: 233 YLPRGILDTFTVMPMQIYNWTSRPQADFQHVAAAGIVVLLVVLILMNSIAIFIRNKFQKR 292

Query: 425 W 425
           +
Sbjct: 293 Y 293


>gi|58584491|ref|YP_198064.1| ABC-type phosphate transport system, permease component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418807|gb|AAW70822.1| ABC-type phosphate transport system, permease component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 416

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 135/399 (33%), Positives = 206/399 (51%), Gaps = 44/399 (11%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFL-ILLLSSIVSKGIGALWQTHISLPIEFSE 64
           I +KN K + +      + C    LV+ +   + +L SI+     AL  T I LPIE   
Sbjct: 20  IKRKNKKDKAL------YSCSFMTLVISLSCPVCILLSILINSYSALTVTKILLPIE--- 70

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHAL--------LRQASQMLST 116
                           +  D+ L    +  R  SI+  N +L         +   ++LS 
Sbjct: 71  ----------------INTDFALADNPSNLRYKSINSLNDSLRKIFKGTDFKSGEEILSR 114

Query: 117 TARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLD 176
            +   L   +       G+  E+   AS+ I+S  KG  ++   V  +S     W +K  
Sbjct: 115 NSYKELENFVRRKVKHNGE-YEIWFTASSIINSINKGKYFNSHYVELLS-----WLKKQG 168

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF- 235
             G  F   N   F+   S  PE AGI  A +GSL  +++ + L+ P GI S I L EF 
Sbjct: 169 RVGKFF---NRSLFLKSDSREPENAGILGAFIGSLMTIMVCLALALPAGIMSGICLHEFM 225

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
                 ++ ++ +INNLA+VPSI++G++G  + +  F++PRS+ LVGG+ L+ M LP+II
Sbjct: 226 PRNSMITNVIEVSINNLAAVPSIIFGVVGLTLYLGIFELPRSSPLVGGMTLSFMMLPNII 285

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT  A   V  +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL
Sbjct: 286 IATKNAFANVSITIKDAAFALGAPHIRVILDHSLPIALPRIIHGTMLAVARVLGESSPLL 345

Query: 356 FVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
            +GMVAF+TD P    D AT  PVQIY+W++  E  FVE
Sbjct: 346 MIGMVAFITDTPRSFFDPATVLPVQIYIWSSSPEIAFVE 384


>gi|42520829|ref|NP_966744.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42410569|gb|AAS14678.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 416

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 204/393 (51%), Gaps = 32/393 (8%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           I +KN K R +     RF    A+++     + +L SI+     AL  T I LP+E +  
Sbjct: 20  IKRKNKKNRAL-----RFCSFTALVISLGCPVCILLSILVNSYSALTVTKILLPVEINAD 74

Query: 66  IV---DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           +    +P   R+    +L     N  +RK         D +  L R + + L    R  +
Sbjct: 75  LALASNPSDLRYKSIGLL-----NDSLRKVFG-GTDFKDGDEILSRNSYKELEKFFRKKV 128

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
           + +            E+   AS+ I+S  K           ++D   K    L     + 
Sbjct: 129 KDS---------GEYEIWFTASSIINSINKD--------KYLNDRYAKLLDWLKEKRRVK 171

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FF 241
             FN   F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  K    
Sbjct: 172 KFFNKSLFLKSDSREPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPKNRLM 231

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           ++ V+ +INNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A
Sbjct: 232 TNIVEISINNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNA 291

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
              VP +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVA
Sbjct: 292 FANVPITIKDAAFALGAPHIKVILDHSLPIALPRIIHGTVLAIARILGESSPLLMMGMVA 351

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
           F+ D P    D AT   VQIY+W+++ E  FVE
Sbjct: 352 FIADTPTSFFDPATVLSVQIYIWSSNPEIAFVE 384


>gi|254796836|ref|YP_003081673.1| phosphate ABC transporter, permease protein PstA [Neorickettsia
           risticii str. Illinois]
 gi|254590061|gb|ACT69423.1| phosphate ABC transporter, permease protein PstA [Neorickettsia
           risticii str. Illinois]
          Length = 397

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 134/388 (34%), Positives = 199/388 (51%), Gaps = 30/388 (7%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            L  R  +   F F CV    +  VFL +LL S  S    AL QT  ++ +E  +  V  
Sbjct: 9   KLNTRSFTNRFFSFMCVFCAFLPVVFLFVLLFSTFSGAYKALQQTKFAVDLE--KVGVAS 66

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
              R+      +R  +       L  +L   +    ++       S  A   + + L   
Sbjct: 67  GNSRYE-----IREKF----ISYLKDQLPWEEDPFTIM----NFFSNYAVDEVLEALNVG 113

Query: 130 PSLIGKTVEVSLLASANIDSALK-GYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
              +  T+      S   D+  K G+  SP           K  Q     G L   FNY 
Sbjct: 114 EKKVWTTI------SGEADTVHKYGHSGSPG--------MKKVVQYFSEHGLLKKAFNYK 159

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            FIN  S     AGI  A++GSLY + + + +SF +G+ +A++L E+S +   +  ++ +
Sbjct: 160 LFINPDSRDSSQAGIVGALIGSLYTVFVSLLVSFFIGVLTALWLGEYSSRSSITRVLEVS 219

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNL+S P IV+GILG    INF  +PRS++LVGGL LA +  P ++ ++  A+R+VP +
Sbjct: 220 INNLSSTPPIVFGILGLTFYINFLGLPRSSSLVGGLTLAFIMFPILVTSSLHAIRSVPDN 279

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           I+ AA  LGASKVQ + HHVLP++MP I+TG+ + +AR LGE+APLL +GM AFV   P 
Sbjct: 280 IKQAAFALGASKVQVILHHVLPISMPGIMTGTILGIARILGESAPLLMIGMAAFVGSIPE 339

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERT 396
            + + A  F VQIY+WA   +    E+T
Sbjct: 340 SIKEPANVFAVQIYIWATSPDVSTNEKT 367


>gi|190571278|ref|YP_001975636.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213018673|ref|ZP_03334481.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|190357550|emb|CAQ54987.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995624|gb|EEB56264.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 417

 Score =  199 bits (505), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 196/371 (52%), Gaps = 28/371 (7%)

Query: 24  YCVVAVLVVFVFL-ILLLSSIVSKGIGALWQTHISLPIEFSETIV---DPQKKRFMDPAI 79
           +C    L+V +   I +L SI+     AL  T I LP+E +  ++   +P   R+    +
Sbjct: 33  FCSFTALIVSIGCPICILLSILVNSYSALTVTKILLPVEINADLILTNNPGDLRYKSIGL 92

Query: 80  LLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEV 139
           L           +L +    +D      +   ++LS  +   L K         G+  E+
Sbjct: 93  L---------NNSLRKVFEGTD-----FKDGDEILSRNSYKELEKFFHKKVKDSGE-YEI 137

Query: 140 SLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPE 199
              AS+ I+S  K   Y   N H      W     L   G +   FN   F+   S  PE
Sbjct: 138 WFTASSIINSINK---YKHLNDHYAKLLDW-----LKEKGRVRKFFNKSLFLKSDSCEPE 189

Query: 200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FFSSFVQANINNLASVPSI 258
            AGI  A +GSL  +++ + L+ P+GI S I L EF  +    +S V+ ++NNLA+VPSI
Sbjct: 190 NAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPRNRLITSIVEISMNNLAAVPSI 249

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           ++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A   VP +I+ AA  LGA
Sbjct: 250 IFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNAFTNVPIAIKDAAFALGA 309

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
             ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVAF+ D P    D AT  P
Sbjct: 310 PHIKVILDHSLPIALPRIIHGAVLAIARILGESSPLLMIGMVAFIADTPTSFFDPATVLP 369

Query: 379 VQIYLWAADAE 389
           VQIY+W++  E
Sbjct: 370 VQIYIWSSSPE 380


>gi|268317379|ref|YP_003291098.1| phosphate ABC transporter, inner membrane subunit PstA
           [Rhodothermus marinus DSM 4252]
 gi|262334913|gb|ACY48710.1| phosphate ABC transporter, inner membrane subunit PstA
           [Rhodothermus marinus DSM 4252]
          Length = 297

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 159/247 (64%), Gaps = 3/247 (1%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            GA +LD+   F  +  S  PE AGI  A+VGS +MML+    S P+G+ +A+YLEE++ 
Sbjct: 51  KGASWLDWQ--FLTSYPSRNPEEAGIKSAIVGSFWMMLLTALFSVPVGVGAAVYLEEYAP 108

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           +G+F   +Q NI NLA +PS++YGILG  + + +F + RS  L G L ++L+ LP I+I+
Sbjct: 109 RGWFLRLIQLNIANLAGIPSVIYGILGLGLFVRYFALGRSL-LAGALTMSLLVLPIIVIS 167

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  ALR VP  IR +A  LGA++ Q V  H+LP+A P ILTG  ++L+RA+GETAPL+ +
Sbjct: 168 TQEALRAVPQGIRESAYALGATRWQVVSSHLLPIAAPGILTGIILALSRAVGETAPLVMI 227

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           G + F+   P  + D  T  P+QI+ W A  +  F      AI++L++FL ++N + + L
Sbjct: 228 GALTFIAFLPESLLDPFTVLPIQIFNWTARPQEEFRGLAAAAIIVLMVFLFLMNLSAILL 287

Query: 418 RNRFKKR 424
           RN +++ 
Sbjct: 288 RNYYERH 294


>gi|148658244|ref|YP_001278449.1| phosphate ABC transporter inner membrane subunit PstA [Roseiflexus
           sp. RS-1]
 gi|148570354|gb|ABQ92499.1| phosphate ABC transporter, inner membrane subunit PstA [Roseiflexus
           sp. RS-1]
          Length = 424

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 155/252 (61%), Gaps = 12/252 (4%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F     SS P +AG+G A++GSL+++ I + L+ P+GI   +YLEE++   ++   +
Sbjct: 173 NREFLTRPMSSVPLLAGVGNAILGSLWVIAITMLLAIPIGILGGVYLEEYASDTWYYRLI 232

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVG------------GLILALMTLPS 293
           + NINNLA VPSI+YGILG AV +   +   S A+ G            GL +AL+ LP 
Sbjct: 233 ETNINNLAGVPSIIYGILGLAVFVRALEALTSGAMFGVTDSNGRTILSAGLTMALLVLPL 292

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +II    A+R VP S+R A+ GLGA+K QTV+HHVLP A+P ILTG+ +S++RA+GETAP
Sbjct: 293 MIINAREAIRAVPQSLRQASYGLGATKWQTVWHHVLPNALPGILTGTILSVSRAMGETAP 352

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           L+ +G   FV  +P  V D  T  P+QIY W +     F      AI++LL+ L  +N  
Sbjct: 353 LIVIGASTFVVFFPDSVFDKFTVIPIQIYNWTSQPGAQFRSIAAAAIIVLLVTLLALNAT 412

Query: 414 MLWLRNRFKKRW 425
            + LRNR ++ +
Sbjct: 413 AILLRNRLRRNY 424


>gi|58696973|ref|ZP_00372459.1| phosphate ABC transporter [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58536786|gb|EAL60024.1| phosphate ABC transporter [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 378

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 126/362 (34%), Positives = 192/362 (53%), Gaps = 27/362 (7%)

Query: 37  ILLLSSIVSKGIGALWQTHISLPIEFSETIV---DPQKKRFMDPAILLRADYNLLVRKAL 93
           + +L SI+     AL  T I LP+E +  +    +P   R+    +L     N  +RK  
Sbjct: 8   VCILLSILVNSYSALTVTKILLPVEINADLALASNPSDLRYKSIGLL-----NDSLRKVF 62

Query: 94  ARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKG 153
                  D +  L R + + L    R  ++ +            E+   AS+ I+S  K 
Sbjct: 63  GGT-DFKDGDEILSRNSYKELEKFFRKKVKDS---------GEYEIWFTASSIINSINKD 112

Query: 154 YLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYM 213
                     ++D   K    L     +   FN   F+   S  PE AGI  A +GSL  
Sbjct: 113 --------KYLNDRYAKLLDWLKEKRRVKKFFNKSLFLKSDSREPENAGILGAFIGSLMT 164

Query: 214 MLIVIGLSFPLGIASAIYLEEFSHKG-FFSSFVQANINNLASVPSIVYGILGSAVLINFF 272
           +++ + L+ P+GI S I L EF  K    ++ V+ +INNLA+VPSI++G++G  + +  F
Sbjct: 165 IIVCLALALPIGIMSGICLYEFMPKNRLMTNIVEISINNLAAVPSIIFGVVGLTLYLGIF 224

Query: 273 KMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLA 332
            +PRS+ LVGG+ L+ M LP+IIIAT  A   VP +I+ AA  LGA  ++ +  H LP+A
Sbjct: 225 GLPRSSPLVGGMTLSFMMLPNIIIATKNAFANVPITIKDAAFALGAPHIKVILDHSLPIA 284

Query: 333 MPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPF 392
           +P I+ G+ +++AR LGE++PLL +GMVAF+ D P    D AT  PVQIY+W+++ E  F
Sbjct: 285 LPRIIHGTVLAIARILGESSPLLMMGMVAFIADTPTSFFDPATVLPVQIYIWSSNPEIAF 344

Query: 393 VE 394
           VE
Sbjct: 345 VE 346


>gi|138896032|ref|YP_001126485.1| phosphate ABC transporter permease [Geobacillus thermodenitrificans
           NG80-2]
 gi|196248925|ref|ZP_03147625.1| phosphate ABC transporter, inner membrane subunit PstA [Geobacillus
           sp. G11MC16]
 gi|134267545|gb|ABO67740.1| Phosphate ABC transporter [Geobacillus thermodenitrificans NG80-2]
 gi|196211801|gb|EDY06560.1| phosphate ABC transporter, inner membrane subunit PstA [Geobacillus
           sp. G11MC16]
          Length = 289

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/237 (42%), Positives = 155/237 (65%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F  N  S RPE AG+   ++GSL++M+IV  +SF LG+ +AIYLEE++ K  F++F+Q N
Sbjct: 54  FLNNFPSRRPEEAGMKSGLIGSLWLMMIVAPVSFILGVGTAIYLEEYALKNRFTAFIQTN 113

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NL  VPSIV+G+LG  + +    + RS  L  GL ++L+  P I++A   A+R VP  
Sbjct: 114 ISNLTGVPSIVFGLLGLTIFVRELGLGRSV-LAAGLTMSLLVFPVIVVAAQEAIRAVPQQ 172

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+  +GA+K QT+   VLP A+P +LTG+ ++L+RA+GETAPL+ +G+  F+   P 
Sbjct: 173 LREASYAMGATKWQTICRVVLPAALPGMLTGAILALSRAVGETAPLVVLGIPTFIAYLPS 232

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           GV D  T  P+QIY W    +  F       I++LL FL ++N+  + +RN+F+KR+
Sbjct: 233 GVLDTFTVMPLQIYNWTGRPQEEFQHVAAAGIVVLLGFLIMMNSVAVLIRNKFQKRF 289


>gi|229916293|ref|YP_002884939.1| phosphate ABC transporter inner membrane subunit PstA
           [Exiguobacterium sp. AT1b]
 gi|229467722|gb|ACQ69494.1| phosphate ABC transporter, inner membrane subunit PstA
           [Exiguobacterium sp. AT1b]
          Length = 303

 Score =  196 bits (498), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 161/248 (64%), Gaps = 3/248 (1%)

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           S GA ++D +  F  N  S RPE AG+  A++GSL++ML+++ + F +G+ +AIYLEE++
Sbjct: 58  SKGAGWVDLD--FLRNFPSRRPEQAGLYPALIGSLWLMLLIVPMVFVIGVGAAIYLEEYA 115

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K   +SF++ NI+NLA VPSIV+G+LG  + +   ++  S  + G L L LM+LP +I+
Sbjct: 116 PKNRMTSFIEVNISNLAGVPSIVFGLLGLTIFVRVMELGNSI-MAGALTLGLMSLPIVIV 174

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           A+  ALR V   +R A+L LGASK QT F+ VLP A+P I+TG  ++++RA+GETAPL+ 
Sbjct: 175 ASQEALRAVKMELRHASLALGASKWQTTFNVVLPSALPGIITGIILAVSRAIGETAPLIM 234

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           VG   F++  P  +    TA P+QIY W +  +  F       I++L+  L  +N+  ++
Sbjct: 235 VGAATFISTTPSNIFSDFTALPIQIYNWTSRPQAEFQNLAAAGIIVLMTMLIAMNSVAIY 294

Query: 417 LRNRFKKR 424
           +RN++  R
Sbjct: 295 IRNKYTNR 302


>gi|327475174|gb|AEA77182.1| PstA [Exiguobacterium sp. EPVM]
          Length = 303

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 157/239 (65%), Gaps = 1/239 (0%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F  N  S RPE AG+  A++G+ ++ML+++ + F +G+ +AIYLEE++ K   +SF+
Sbjct: 65  NLDFLRNFPSRRPEQAGLYPALIGTFWLMLLIVPMVFIVGVGAAIYLEEYAPKNRITSFI 124

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA VPSIV+G+LG  + +   ++  S  + G L L LM+LP +I+A+  ALR+V
Sbjct: 125 EVNISNLAGVPSIVFGLLGLTIFVRVMELGNSI-MAGALTLGLMSLPIVIVASQEALRSV 183

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
              +R A+L LGASK QT F+ VLP A+P I+TG  ++++RA+GETAPL+ VG   F++ 
Sbjct: 184 KMELRHASLALGASKWQTTFNVVLPSAIPGIITGIILAVSRAIGETAPLIMVGAATFIST 243

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            P  V    TA P+QIY W +  +  F       I++L+  L ++N+A +++RN++  R
Sbjct: 244 TPSSVFSDFTALPIQIYNWTSRPQAEFQNLAAAGIIVLMTMLIIMNSAAIYIRNKYTNR 302


>gi|323490094|ref|ZP_08095315.1| phosphate ABC transporter, permease protein PstA [Planococcus
           donghaensis MPA1U2]
 gi|323396390|gb|EGA89215.1| phosphate ABC transporter, permease protein PstA [Planococcus
           donghaensis MPA1U2]
          Length = 292

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/237 (41%), Positives = 156/237 (65%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F  N AS  PE AGI  A+VGSL++ML+V   S  LG+ SAIYLEE++ +   ++F++ N
Sbjct: 57  FLTNFASRFPEKAGIKAALVGSLWLMLVVAPTSIILGVGSAIYLEEYAKQNRITTFIRMN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPS+V+G+LG  + +    +  S  L  G  ++L+ LP I++++  A+R+VP  
Sbjct: 117 ISNLAGVPSVVFGLLGLTIFVRALALGNSV-LAAGFTMSLLILPVIVVSSQEAIRSVPRE 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ G+GA+K QT+   +LP A+P ILTGS ++L+RA+GETAPL+ +G+   +   P 
Sbjct: 176 LRDASFGMGATKWQTIIKIILPAAIPGILTGSILALSRAIGETAPLIVIGVPVIIQFLPA 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           GV D  TA P+QIY W++  ++ F       I++L+  L  +N+  + +RN+F KR+
Sbjct: 236 GVMDTFTALPMQIYDWSSRPQQEFQTVAAAGIMVLMAVLLFMNSIAVIIRNKFDKRY 292


>gi|88608117|ref|YP_506363.1| phosphate ABC transporter, permease protein PstA [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600286|gb|ABD45754.1| phosphate ABC transporter, permease protein PstA [Neorickettsia
           sennetsu str. Miyayama]
          Length = 397

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/224 (44%), Positives = 144/224 (64%)

Query: 173 QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL 232
           Q     G L    NY  F N  S     AGI  A++GSLY + + + +SF +G+ +A++L
Sbjct: 144 QYFSERGLLKKALNYKLFTNPDSRDSSQAGIVGALIGSLYTVFVSLLVSFFIGVLTALWL 203

Query: 233 EEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLP 292
            E+S +   +  ++ +INNL+S P IV+GILG    INF  +PRS++LVGGL LA +  P
Sbjct: 204 GEYSSRSSITRVLEVSINNLSSTPPIVFGILGLTFYINFLGLPRSSSLVGGLTLAFIMFP 263

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            ++ ++  A+R+VP +I+ AA  LGASKVQ + HHVLPL+MP I+TG+ + +AR LGE+A
Sbjct: 264 ILVTSSLHAIRSVPDNIKQAAFALGASKVQVILHHVLPLSMPGIMTGTILGIARILGESA 323

Query: 353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERT 396
           PLL +GMVAFV   P  + + A  F VQIY+WA   +    E+T
Sbjct: 324 PLLMIGMVAFVGSIPESIREPANVFAVQIYIWATSPDISTNEKT 367


>gi|156740605|ref|YP_001430734.1| phosphate ABC transporter inner membrane subunit PstA [Roseiflexus
           castenholzii DSM 13941]
 gi|156231933|gb|ABU56716.1| phosphate ABC transporter, inner membrane subunit PstA [Roseiflexus
           castenholzii DSM 13941]
          Length = 419

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 155/252 (61%), Gaps = 12/252 (4%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F     SS P +AG+G A++GSL+++ I + L+ P+GI   +YLEE++   ++   +
Sbjct: 168 NREFLTRPMSSSPILAGVGNAILGSLWVIAITMLLAIPIGILGGVYLEEYASDTWYYRLI 227

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVG------------GLILALMTLPS 293
           + NINNLA VPSI+YGILG AV +   +   S A  G            GL +AL+ LP 
Sbjct: 228 ETNINNLAGVPSIIYGILGLAVFVRALEALTSGATFGVTDSNGRTILSAGLTMALLVLPL 287

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +II    A+R VP SIR A+ GLGA+K QTV+HHVLP A+P ILTG+ +S++RA+GETAP
Sbjct: 288 MIINAREAIRAVPQSIRQASYGLGATKWQTVWHHVLPNALPGILTGTILSMSRAMGETAP 347

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           L+ VG   FV  +P  V D  T  P+QIY W       F      AI++LL+ L ++N  
Sbjct: 348 LIVVGASTFVVFFPDSVFDKFTVIPIQIYNWTQQPGAQFRSIAAAAIIVLLVTLLLLNAT 407

Query: 414 MLWLRNRFKKRW 425
            + LRNRFK+ +
Sbjct: 408 AILLRNRFKRSY 419


>gi|218460110|ref|ZP_03500201.1| phosphate ABC transporter, inner membrane subunit PstA [Rhizobium
           etli Kim 5]
          Length = 187

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 123/161 (76%)

Query: 265 SAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTV 324
           S  ++N F +PRS  +VGGL+LALMTLP++II T V+L+ VPSSIR AALG+GASK + +
Sbjct: 27  SGGVLNGFGVPRSAPIVGGLVLALMTLPTLIIVTRVSLKAVPSSIREAALGIGASKHEMI 86

Query: 325 FHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLW 384
           FHHVL LAMP ++TG+ +SLARALGETAPLL +GM AF+T  P G+   +TA P QIY+W
Sbjct: 87  FHHVLSLAMPTVMTGAIISLARALGETAPLLLIGMNAFITSPPEGIFSASTALPSQIYIW 146

Query: 385 AADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           A   ER FV RT  AIL+LL FL ++N   ++LR RF++RW
Sbjct: 147 ADSPERGFVSRTSAAILVLLGFLVIMNAIAIFLRQRFERRW 187


>gi|89099175|ref|ZP_01172053.1| phosphate ABC transporter, permease protein, putative [Bacillus sp.
           NRRL B-14911]
 gi|89086021|gb|EAR65144.1| phosphate ABC transporter, permease protein, putative [Bacillus sp.
           NRRL B-14911]
          Length = 292

 Score =  193 bits (491), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 163/252 (64%), Gaps = 3/252 (1%)

Query: 174 KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
           ++ + GA +LD    F  +  S +PE+AG+  A++G++++M +V  +S  LG+ +AIYLE
Sbjct: 44  RILTQGAGYLDMQ--FLQSLPSRKPELAGVKTALIGTIWLMGVVAPVSLLLGVGTAIYLE 101

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           E++ K  F+ F+Q NI+NLA VPSIV+G+LG  V +       S  +  GL ++L+ LP 
Sbjct: 102 EYAKKNKFTDFIQVNISNLAGVPSIVFGLLGLTVFVRAAGFGTSV-IAAGLTMSLLVLPI 160

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           II+A+  A+R+VP  +R A+ G+GA+K QT+   V+P A+P ILTG  ++L+RA+GETAP
Sbjct: 161 IIVASQEAIRSVPKELREASYGMGATKWQTIVRVVMPAAVPGILTGGILALSRAIGETAP 220

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           L+ +G+  F+   P  V D+ T  P+QIY W    +  F       I++LL+ L  +N+ 
Sbjct: 221 LVVLGLPLFLAFLPRSVFDMFTVLPMQIYNWTGRPQEEFQALAAAGIIVLLVLLIGMNSV 280

Query: 414 MLWLRNRFKKRW 425
            + +RN+F+KR+
Sbjct: 281 AVLIRNKFQKRY 292


>gi|288553549|ref|YP_003425484.1| phosphate ABC transporter permease [Bacillus pseudofirmus OF4]
 gi|288544709|gb|ADC48592.1| phosphate ABC transporter (permease) [Bacillus pseudofirmus OF4]
          Length = 306

 Score =  192 bits (488), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 159/242 (65%), Gaps = 3/242 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F     S+ P+ AGI  A++G+L++M +V  ++  LG+ +AIYLE ++ KG   SF+
Sbjct: 66  NVDFLTGRLSNNPDRAGIMGAILGTLWLMAVVAPVTMLLGVGTAIYLEAYAKKGKIHSFI 125

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           QANI+NLA VPSIV+GILG  + +    +     L GGL ++L+ LP +++A+  A+R V
Sbjct: 126 QANISNLAGVPSIVFGILGMTIFVRALDL-GGVVLAGGLTMSLLVLPIVVVASQEAIRAV 184

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P+ +  A+ G+GA+K QT+ + +LP A+P ILTG+ +SL+RA+GETAPL+ +G+ A +  
Sbjct: 185 PNHLSEASYGMGATKWQTIKNVILPAALPGILTGAILSLSRAIGETAPLIVIGIPALLIP 244

Query: 366 YPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +P G+ D  T  PVQIY W  DA     +       I++LLI L ++N+  + +RN+F++
Sbjct: 245 FPGGLMDRFTILPVQIYYWTIDASLVAEYANLAAATIIVLLIVLFILNSTAIIIRNKFQQ 304

Query: 424 RW 425
           R+
Sbjct: 305 RY 306


>gi|221633803|ref|YP_002523029.1| phosphate ABC transporter permease PstA [Thermomicrobium roseum DSM
           5159]
 gi|221155671|gb|ACM04798.1| phosphate ABC transporter, permease protein PstA [Thermomicrobium
           roseum DSM 5159]
          Length = 298

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 159/240 (66%), Gaps = 1/240 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            ++ F  +  S RPE AGI  A+VGS Y++++V  ++FPLG+A+AIYLEEF+ +   ++ 
Sbjct: 57  LSWDFLTSYPSRRPEQAGIRSALVGSFYILILVALIAFPLGVAAAIYLEEFAPQNRLTAT 116

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ N++NLA+VPSIVYG+LG  V +  F + RS  L G L L+L+ LP IIIA+  ALR 
Sbjct: 117 IEINLSNLAAVPSIVYGLLGLGVFVRTFMLGRSL-LAGALTLSLLVLPIIIIASREALRA 175

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR A L LGAS  QTV   VLP A+P ILTG+ ++LARA+GETAPL+ +G + +V 
Sbjct: 176 VPPSIREAGLALGASHWQTVRLFVLPAALPGILTGTILALARAIGETAPLITIGALTYVA 235

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P  + D  T  P+QI+ W +  +  F ER    I++LL  L + N   ++LR R ++R
Sbjct: 236 FTPKSLFDPFTVLPIQIFNWISRPQPAFHERAAAGIIVLLAVLLLFNGLAIFLRARLQRR 295


>gi|327475172|gb|AEA77181.1| PstA [Bacillus sp. 15.4]
          Length = 294

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 164/254 (64%), Gaps = 5/254 (1%)

Query: 174 KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
           ++ SD   ++DF  GF     S  P+ AGI  A++G++++ML+V  ++  LG+ +AIYLE
Sbjct: 44  RVASDSVGWIDF--GFLSGKLSVNPDKAGILGAILGTVWLMLVVAPVTMFLGVGTAIYLE 101

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           E++ +G   S +Q NI+NLA VPS+V+GILG  V +    +  +  L GGL ++L+ LP 
Sbjct: 102 EYAKEGKLKSIIQTNISNLAGVPSVVFGILGLTVFVRMADL-GNIVLAGGLTMSLLVLPI 160

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +++A+  ALR VP  +R A+ G+GA+K QTV + VLP A+P ILTG  ++L+RA+GETAP
Sbjct: 161 VVVASQEALRAVPQFLREASYGMGATKWQTVKNIVLPTAIPGILTGVILALSRAIGETAP 220

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVIN 411
           L+ +G+ A +   P GV D  T  P+QIY W  D+     +       I++LLI L  +N
Sbjct: 221 LVVIGIPALLIPLPEGVFDKFTVMPMQIYYWTVDSALTDEYAYLAAATIVVLLIVLFAMN 280

Query: 412 TAMLWLRNRFKKRW 425
           +  + +RN+F+KR+
Sbjct: 281 SIAIIIRNKFQKRF 294


>gi|262197755|ref|YP_003268964.1| phosphate ABC transporter inner membrane subunit PstA [Haliangium
           ochraceum DSM 14365]
 gi|262081102|gb|ACY17071.1| phosphate ABC transporter, inner membrane subunit PstA [Haliangium
           ochraceum DSM 14365]
          Length = 294

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 158/247 (63%), Gaps = 3/247 (1%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DG   LD+N  FF    SS   +AGI  A+ GS+Y++ +    + PLG+ +AIYLEE+  
Sbjct: 49  DGLGRLDWN--FFQGNPSSDAALAGIRPALFGSVYLIALTALFALPLGVGAAIYLEEYGG 106

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           +   +S ++  I NLA VPS++YG+LG  + +  F    S  L G   LAL+ LP +I++
Sbjct: 107 QSRLASTIEVAIANLAGVPSVIYGLLGLGLFVRAFGFGPSL-LAGACTLALLVLPIVIMS 165

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           +  ALRTVP S+R  ALGLGA++ Q +   +LP+ +P ILTG+ +S++RA+GETAPL+ +
Sbjct: 166 SREALRTVPDSLREGALGLGATRWQMIRRVILPMCLPGILTGAILSVSRAIGETAPLIVI 225

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           G+  F++  P G+    TA P+QIY W +  +R F+  +   I++L+  L V+N+  ++L
Sbjct: 226 GVAVFISTVPSGLDSQFTALPIQIYNWVSMPQREFLTNSAAGIVVLMGTLLVLNSIAIFL 285

Query: 418 RNRFKKR 424
           RNRF+ R
Sbjct: 286 RNRFQTR 292


>gi|149182007|ref|ZP_01860493.1| phosphate ABC transporter (permease) [Bacillus sp. SG-1]
 gi|148850272|gb|EDL64436.1| phosphate ABC transporter (permease) [Bacillus sp. SG-1]
          Length = 294

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/242 (41%), Positives = 158/242 (65%), Gaps = 3/242 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           + GF     S  PE AGI  A++G++++ML+V  ++  LG+ +AIYLEE++ +G   S +
Sbjct: 54  DMGFLSGKLSVNPEKAGILGAILGTVWLMLVVAPVTMFLGVGTAIYLEEYAKEGKLKSII 113

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           Q NI+NLA VPS+V+GILG  V +    +  +  L GGL ++L+ LP +++A+  ALR+V
Sbjct: 114 QTNISNLAGVPSVVFGILGLTVFVRMADL-GNIVLAGGLTMSLLVLPIVVVASQEALRSV 172

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P  +R A+ G+GA+K QTV + VLP A+P ILTG  ++L+RA+GETAPL+ +G+ A +  
Sbjct: 173 PQFLREASYGMGATKWQTVKNIVLPTAIPGILTGVILALSRAIGETAPLVVIGIPALLIP 232

Query: 366 YPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P GV D  T  P+QIY W  D+     +       I++LL+ L  +N+  + +RN+F+K
Sbjct: 233 LPDGVFDKFTVMPMQIYYWTVDSALTDEYAYLAAATIVVLLVVLFAMNSIAIVIRNKFQK 292

Query: 424 RW 425
           R+
Sbjct: 293 RF 294


>gi|170078882|ref|YP_001735520.1| phosphate ABC transporter, permease protein [Synechococcus sp. PCC
           7002]
 gi|169886551|gb|ACB00265.1| phosphate ABC transporter, permease protein [Synechococcus sp. PCC
           7002]
          Length = 303

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 159/253 (62%), Gaps = 10/253 (3%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DG   LD  +    +  S RPE AG+  A+VG++++M++   ++FP+G+ + I+LEEFS 
Sbjct: 54  DGLPRLD--WKLLTSFPSRRPEDAGLKSALVGTIWLMILTAIITFPIGVGAGIFLEEFSA 111

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS---TALVGGLILALMTLPSI 294
           +  F+  ++ NINNLA+VPSI+YG+LG  V +     P +   + L G L L+L+ LP +
Sbjct: 112 ENTFTKIIEVNINNLAAVPSIIYGLLGLQVFVRLLS-PMTGGRSVLAGALTLSLLILPIV 170

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I+AT  AL+ VP S+R A L LGA+K Q V   + PLA+P ILTG+ ++L+RA+GETAPL
Sbjct: 171 IVATREALKAVPDSLRQAGLALGATKWQVVREQIFPLALPGILTGTILALSRAIGETAPL 230

Query: 355 LFVGMVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
           + +G + F+   P     G+    TA P+QI+ W +  +  F       I++L++ L  +
Sbjct: 231 ITLGALTFIAFLPSLSLEGLQTPFTALPIQIFNWVSRPQEEFHTVAAAGIIVLMVVLLAM 290

Query: 411 NTAMLWLRNRFKK 423
           N   ++LRN+F+K
Sbjct: 291 NGTAIFLRNKFQK 303


>gi|15615554|ref|NP_243858.1| phosphate ABC transporter (permease) [Bacillus halodurans C-125]
 gi|10175614|dbj|BAB06711.1| phosphate ABC transporter (permease) [Bacillus halodurans C-125]
          Length = 294

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 167/251 (66%), Gaps = 5/251 (1%)

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           +DGA +++ +  F     SS PE AGI  A++G+L++ML+V  ++  LG+ +AIYLE ++
Sbjct: 47  ADGASWINLD--FLTGRHSSDPEKAGIMGALLGTLWLMLVVTPVTMFLGVGTAIYLECYA 104

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            KG   SF++ NI+NLA VPSIV+GILG  V +    +  S  L GGL ++L+ LP +++
Sbjct: 105 KKGRLQSFIETNISNLAGVPSIVFGILGLTVFVRTMDL-GSVVLAGGLTMSLLVLPIVVV 163

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           A+  A+R +PS +  A+ GLGA+K QT+ + +LP A+P ILTG+ +SL+RA+GETAPL+ 
Sbjct: 164 ASQEAIRAIPSHLSEASFGLGATKWQTIKNIILPAALPGILTGAILSLSRAIGETAPLIV 223

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAM 414
           +G+ A +  +P G+ D  T  PVQIY W  D+     +       I++LL+ L ++N+  
Sbjct: 224 LGIPALLIPFPGGLMDRFTILPVQIYYWTIDSALVAEYANLAAATIIILLLVLFLLNSTA 283

Query: 415 LWLRNRFKKRW 425
           + +RN+F+KR+
Sbjct: 284 IIIRNKFQKRY 294


>gi|311030802|ref|ZP_07708892.1| phosphate ABC transporter (permease) [Bacillus sp. m3-13]
          Length = 294

 Score =  185 bits (470), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 102/256 (39%), Positives = 164/256 (64%), Gaps = 5/256 (1%)

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
           F ++ S    ++D    F  N  S+  + AGI  A++G+L++ML+V  ++  LG+ +AIY
Sbjct: 42  FYRVISQSMGWIDLQ--FITNKLSTMADRAGIMGAIMGTLWLMLVVAPITLFLGVGTAIY 99

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           LEE++ KG    F+Q NI+NLA VPSIV+GILG  + +    +  +  L GGL +AL+ L
Sbjct: 100 LEEYAKKGRLQRFLQTNISNLAGVPSIVFGILGLTIFVRAAGL-GNIVLAGGLTMALLVL 158

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +++A+  A+R+VP  +R A+ G+GA+K QT+ + VLP ++P ILTG  ++L+RA+GET
Sbjct: 159 PIVVVASQEAIRSVPGYLREASYGMGATKWQTIKNIVLPASLPGILTGVILALSRAIGET 218

Query: 352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAV 409
           APL+ +G+ A +   P G+ D  T  P+QIY W  DA     +       I++LL  L V
Sbjct: 219 APLVVLGIPALLIPLPEGIFDKFTVLPMQIYYWTIDAALVAEYANLAAATIVVLLFILLV 278

Query: 410 INTAMLWLRNRFKKRW 425
           +N+  + +RN+F++R+
Sbjct: 279 MNSIAVIIRNKFQRRF 294


>gi|302388939|ref|YP_003824760.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Thermosediminibacter oceani DSM 16646]
 gi|302199567|gb|ADL07137.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Thermosediminibacter oceani DSM 16646]
          Length = 294

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/249 (44%), Positives = 156/249 (62%), Gaps = 5/249 (2%)

Query: 176 DSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
           DS G L L F   F     S  PE AGI  A+ G++Y+M+I    + PLGIA+A++LEE+
Sbjct: 47  DSWGWLDLQFITSF----PSRSPEKAGILPALYGTIYVMIITAVFAIPLGIAAAVFLEEY 102

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           S K  F SF+Q NI NLA +PSIVYGILG  V + +  + RS  L GGL + L+ LP II
Sbjct: 103 SKKSKFLSFIQVNIYNLAGIPSIVYGILGLTVFVRWMMLGRSL-LAGGLTMGLLILPVII 161

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           +    A+R VP S R A+  LGASK QT+ + VLP A+P ILTG  ++L+RA+GETAPL+
Sbjct: 162 VTAQEAIRAVPQSWRHASYALGASKWQTIRYVVLPSALPGILTGIILALSRAIGETAPLI 221

Query: 356 FVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            +G + FV   P  + D  +  P+QIY W +  +  F       I++LL+ L  +N+A +
Sbjct: 222 PIGALTFVRVIPRSLFDSFSVLPIQIYNWTSRPQDDFRAIAAAGIVVLLVVLLGMNSAAI 281

Query: 416 WLRNRFKKR 424
            LRN+++ R
Sbjct: 282 LLRNKYQGR 290


>gi|319651559|ref|ZP_08005686.1| phosphate ABC transporter [Bacillus sp. 2_A_57_CT2]
 gi|317396626|gb|EFV77337.1| phosphate ABC transporter [Bacillus sp. 2_A_57_CT2]
          Length = 294

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/242 (43%), Positives = 159/242 (65%), Gaps = 3/242 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F +N  S+ PE AGI  A+ G+L++ML+V  ++  LG+ +AIYLEE++ KG  SSF+
Sbjct: 54  NMDFLMNRLSTDPERAGIWGAITGTLWLMLVVAPVTMILGVGTAIYLEEYAAKGRISSFI 113

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA VPS+V+GILG  V      +  S  L GGL +AL+ LP +++A+  A+R V
Sbjct: 114 KTNISNLAGVPSVVFGILGLTVFARALDL-GSVVLAGGLTMALLVLPVVVVASQEAIRAV 172

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P  +R A+ G+GA+K QT+ + VLP A+P ILTG  ++L+RA+GETAPL+ +G+ A +  
Sbjct: 173 PQFLREASYGMGATKWQTIKNVVLPAALPGILTGVILALSRAIGETAPLVVIGIPALLIP 232

Query: 366 YPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P G+ D  T  PVQIY W  D+     +       I++LLI L  +N+  + +RN+F+K
Sbjct: 233 VPDGIFDKFTILPVQIYYWTIDSALVAEYANLAAATIVILLIVLFAMNSIAILIRNKFQK 292

Query: 424 RW 425
           R+
Sbjct: 293 RF 294


>gi|288931343|ref|YP_003435403.1| phosphate ABC transporter inner membrane subunit PstA [Ferroglobus
           placidus DSM 10642]
 gi|288893591|gb|ADC65128.1| phosphate ABC transporter, inner membrane subunit PstA [Ferroglobus
           placidus DSM 10642]
          Length = 282

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 104/238 (43%), Positives = 150/238 (63%), Gaps = 4/238 (1%)

Query: 190 FINGASSR-PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F+    SR PE AGI  A+V S+YM+ +V     PLG+ +A+YLEE++ KG  +  +  N
Sbjct: 42  FLTSPPSRFPEKAGIYPALVSSVYMITLVGIFVLPLGVGAALYLEEYAKKGKLTRIIDVN 101

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA+VPSIVYG+LG  + +  FK+   T LVG L L L+ +P +I+    ALR VP S
Sbjct: 102 ISNLAAVPSIVYGLLGIGLFVATFKLKPGTVLVGALTLTLLVVPIVIVTAQEALRAVPKS 161

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+  LGA+K QT+   VLP A P ILTG  ++L+RA+GETAPL+ +GM   V   P 
Sbjct: 162 VREASFALGATKWQTIKEVVLPQAFPGILTGVILALSRAIGETAPLIMIGMATTVFVAPK 221

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERT--FGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +   ATA P+QI++W    +  F+      G I+LL + L+ +N   ++LRNRF ++
Sbjct: 222 DIFSPATAMPLQIFMWTDMPQEEFLHGVAPAGVIVLLAVMLS-MNALAIYLRNRFYRK 278


>gi|159900512|ref|YP_001546759.1| phosphate ABC transporter inner membrane subunit PstA
           [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893551|gb|ABX06631.1| phosphate ABC transporter, inner membrane subunit PstA
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 416

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 110/277 (39%), Positives = 157/277 (56%), Gaps = 23/277 (8%)

Query: 171 WFQKLDSDGALFLDF-----------NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIG 219
           WF K   D  +  +F             GF     SS P  AG+  A++GSL+M+ I I 
Sbjct: 139 WFNKAAIDAQVASEFPEAKLEFRSWLTAGFLTTPMSSDPLRAGVRTALLGSLWMIAITIL 198

Query: 220 LSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA 279
            +FP+G+ +AIYLEE++    F+  +Q NINNLA VPSI+YG+LG  + +   +   S  
Sbjct: 199 FAFPIGVGAAIYLEEYATDNRFNRIIQTNINNLAGVPSIIYGMLGLVIFVRTLEPLTSGR 258

Query: 280 LVGG------------LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHH 327
           + G             L + L+ LP +II    A+R VP S+R A+ GLGA+K QT++HH
Sbjct: 259 IFGADSGNGRTIVAASLTMMLLILPIMIINGQEAIRAVPLSLRQASYGLGATKWQTIWHH 318

Query: 328 VLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAAD 387
           VLP A+P I TG+ ++++RA+GETAPL+ VG   F+   P G     TA P+QIY W + 
Sbjct: 319 VLPNALPGIFTGTILAVSRAIGETAPLIVVGASTFIVTDPDGPFAKFTALPIQIYNWTSR 378

Query: 388 AERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +  F      AI++LL+ L  +N   + LRNRF KR
Sbjct: 379 PQPEFAHIAASAIVVLLVMLLSLNAIAVLLRNRFSKR 415


>gi|257387839|ref|YP_003177612.1| phosphate ABC transporter inner membrane subunit PstA
           [Halomicrobium mukohataei DSM 12286]
 gi|257170146|gb|ACV47905.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halomicrobium mukohataei DSM 12286]
          Length = 565

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 156/244 (63%), Gaps = 5/244 (2%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK----GFF 241
           ++GF  +  S     AGI  A+VGS+ M+++++  +FP+G+ +AIYLEE++      G F
Sbjct: 322 DWGFLTSATSRTAADAGIYPAMVGSVMMIIVIVLATFPVGVGAAIYLEEYAPSEGPMGKF 381

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
            + V+ NI NLA VPS+VYG+LG A+ I   + P+ + +V GL + L+ LP +II++  A
Sbjct: 382 VTLVEINIGNLAGVPSVVYGLLGLALFIRIVQWPQGSIVVAGLAVGLLILPIVIISSQEA 441

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R+VP S R A+ G+GA++ QT+   VLP A+P ILTG+ ++L RA+GETAPLL +G  A
Sbjct: 442 IRSVPDSFRQASYGMGATRWQTIRQVVLPEALPGILTGTILALGRAIGETAPLLMIGAAA 501

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA-ILLLLIFLAVINTAMLWLRNR 420
            V   P G  D+A   P QIY W+++ E  F      A ++ LL  L V+N   + +RNR
Sbjct: 502 SVRLAPNGFFDVAGMMPRQIYSWSSELEPAFRHGVLAAGVITLLAVLLVMNATAIVIRNR 561

Query: 421 FKKR 424
           +++ 
Sbjct: 562 YQRE 565


>gi|305665603|ref|YP_003861890.1| phosphate ABC transporter permease [Maribacter sp. HTCC2170]
 gi|88710359|gb|EAR02591.1| phosphate ABC transporter, permease protein [Maribacter sp.
           HTCC2170]
          Length = 284

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 160/240 (66%), Gaps = 1/240 (0%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++GF  +  S +PE +GI  A++GS++++L+   ++FPLG+A+ IYLEE+  K  F+  +
Sbjct: 45  DWGFISSLPSRKPEKSGIYTALMGSIWILLLTTVIAFPLGVAAGIYLEEYGKKNRFAGIL 104

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA VPSI+YG+LG  V +    +  S  L G L L+L+ LP +I+AT  A++ V
Sbjct: 105 EINISNLAGVPSIIYGLLGLEVFVRIMNLGASV-LAGSLTLSLLILPIVIVATREAIKAV 163

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P++++ A+  LGASK QT++H +LP +   ILTG  ++L+RA+GETAPL+ VG +A+V  
Sbjct: 164 PTTVKDASYALGASKWQTIWHQILPASSGGILTGVILALSRAVGETAPLIVVGALAYVPF 223

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P    D  +  P+QI+ W +  +  F+E    AI++LL+   ++N   ++ RN+++K+W
Sbjct: 224 APESPMDEFSVLPIQIFNWISRPQHGFIENAAAAIIILLLITFIMNGIAVYFRNKWQKKW 283


>gi|219850476|ref|YP_002464909.1| phosphate ABC transporter inner membrane subunit PstA [Chloroflexus
           aggregans DSM 9485]
 gi|219544735|gb|ACL26473.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chloroflexus aggregans DSM 9485]
          Length = 311

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 158/240 (65%), Gaps = 1/240 (0%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            + FF N  S  PE AG   A+VG+LY + + I  +FPLG+A+AIYLEE++   +FS  V
Sbjct: 73  TWEFFNNFDSRFPERAGAKAAIVGTLYTISLTILFAFPLGVAAAIYLEEYARDNWFSKLV 132

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLA+VPSI+YG+LG  V   +  + RS  + G L LAL+ +P II+A+  ++R V
Sbjct: 133 EINISNLAAVPSIIYGLLGLQVFARWLFLGRSI-ITGALTLALLVVPIIIVASRESIRAV 191

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S+R A+  LGA++ QTV+H VLP ++  ILTGS ++++RA+GETAPL+ +G + FV  
Sbjct: 192 PLSLRQASYALGATRWQTVWHVVLPQSIGGILTGSILAVSRAIGETAPLITIGALTFVPF 251

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P  V DI T  P+QI+ W +     F       IL+LL  L +IN   ++LRNR++KR+
Sbjct: 252 LPRSVFDIFTVLPIQIFNWTSRPNDDFRALAAAGILVLLTILLLINALAIYLRNRYQKRY 311


>gi|23100589|ref|NP_694056.1| phosphate ABC transporter permease [Oceanobacillus iheyensis
           HTE831]
 gi|22778822|dbj|BAC15090.1| phosphate ABC transporter permease [Oceanobacillus iheyensis
           HTE831]
          Length = 296

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/242 (42%), Positives = 158/242 (65%), Gaps = 3/242 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ F     S+ PE AGI  A++G+ ++MLIVI ++  +G+ +AIYLE ++ KG F SF+
Sbjct: 56  NWDFLTGHLSTAPERAGIMGAILGTAWLMLIVIPVTMLIGVGTAIYLELYAKKGKFQSFI 115

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
             NI+NLA VPSIVYG+LG  + +   +   +  L GGL L+L+ LP +I+A   A+R V
Sbjct: 116 ATNISNLAGVPSIVYGLLGLTLFVRTLEF-GNVILAGGLTLSLLVLPIVIVAAQEAIRAV 174

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P  +  A+ G+GA+K QTV   VLP A+P ILTGS ++L+RA+GETAPL  +G+ A +  
Sbjct: 175 PGHLSEASYGMGATKWQTVKKIVLPAALPGILTGSILALSRAIGETAPLTVLGIPALLIP 234

Query: 366 YPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +P GV D  TA P+QIY W  D+     +       I++LL+ L ++N+  + +RN+F++
Sbjct: 235 FPGGVFDTFTALPMQIYYWTLDSSLVAEYAYLAAATIIVLLVLLFLLNSIAIIIRNKFQQ 294

Query: 424 RW 425
           R+
Sbjct: 295 RY 296


>gi|330684710|gb|EGG96408.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis VCU121]
          Length = 309

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 157/241 (65%), Gaps = 4/241 (1%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P +AG+  A+VG+L++M+ +I +S  LG+ +AIYLEE++ K  F++FV+  
Sbjct: 69  FFTNFSSSTPSMAGVKGALVGTLWLMITIIPISIVLGVGTAIYLEEYARKNPFTNFVKVC 128

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPR----STALVGGLILALMTLPSIIIATGVALRT 304
           I+NLA VPS+V+G+LG  + +    +       + L G L ++L+ LP II+A   A+R 
Sbjct: 129 ISNLAGVPSVVFGLLGLTLFVRGMGVESLSLGKSILAGALTMSLLILPVIIVAAQEAIRA 188

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S+R A+ GLGA+K QT++  VLP A+P ILTG  ++L+RALGETAPL+ +G+   + 
Sbjct: 189 VPKSVREASYGLGANKWQTIYKVVLPAALPGILTGFILALSRALGETAPLILIGIPTILL 248

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G+ D   A P+QIY WA   +  F       I++LL+ L ++N   ++ RN+F K+
Sbjct: 249 RLPSGIMDQFQALPIQIYNWAKMPQEEFQNVASAGIIVLLVILLLMNGLAIFFRNKFSKK 308

Query: 425 W 425
           +
Sbjct: 309 F 309


>gi|239637076|ref|ZP_04678070.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           warneri L37603]
 gi|239597426|gb|EEQ79929.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           warneri L37603]
          Length = 309

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 158/241 (65%), Gaps = 4/241 (1%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P +AGI  A+VG+L++M+ +I +S  LG+ +AIYLEE++ K  F++FV+  
Sbjct: 69  FFTNFSSSTPSMAGIKGALVGTLWLMITIIPISIVLGVGTAIYLEEYARKNPFTNFVKVC 128

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPR----STALVGGLILALMTLPSIIIATGVALRT 304
           I+NLA VPS+V+G+LG  + +    +       + + G L ++L+ LP II+A   A+R 
Sbjct: 129 ISNLAGVPSVVFGLLGLTLFVRGMGVESLSLGKSIIAGALTMSLLILPVIIVAAQEAIRA 188

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP+S+R A+ GLGA+K QT++  VLP A+P ILTG  ++L+RALGETAPL+ +G+   + 
Sbjct: 189 VPNSVREASYGLGANKWQTIYKVVLPAALPGILTGFILALSRALGETAPLILIGIPTILL 248

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G+ D   A P+QIY WA   +  F       I++LL+ L ++N   ++ RN+F K+
Sbjct: 249 RLPSGIMDQFQALPIQIYNWAKMPQEEFQNVASAGIIVLLVILLLMNGLAIFFRNKFSKK 308

Query: 425 W 425
           +
Sbjct: 309 F 309


>gi|299537692|ref|ZP_07050981.1| phosphate ABC transporter, permease protein PstA [Lysinibacillus
           fusiformis ZC1]
 gi|298726671|gb|EFI67257.1| phosphate ABC transporter, permease protein PstA [Lysinibacillus
           fusiformis ZC1]
          Length = 292

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 155/241 (64%), Gaps = 1/241 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  F  N AS   + AGI  A++GSL++M +V  +S  LG+ +AIYLEE++ K   + F
Sbjct: 53  LNIDFLTNFASRFADKAGIKAALIGSLWLMAVVAPVSIILGVGTAIYLEEYAKKNKINDF 112

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI+NLA VPSIV+G+LG  + +   ++ +S  L  G  ++L+ LP II+A   A+R 
Sbjct: 113 IRMNISNLAGVPSIVFGLLGLTIFVRMMELGKSI-LAAGFTMSLLILPVIIVAAQEAIRA 171

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP+  R A+ G+GA+K QT+   VLP A+P ILTGS ++L+RA+GETAPL+ +G+   + 
Sbjct: 172 VPNEQREASYGMGATKWQTILRVVLPAAIPGILTGSILALSRAIGETAPLVVIGIPVILQ 231

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G+    TA P+QIY WA   +  F       IL+L+  L ++N+  +++RN+F+KR
Sbjct: 232 FLPNGLLSQFTALPMQIYDWAKRPQEAFQYVAAAGILVLMTVLLLMNSIAIYIRNKFQKR 291

Query: 425 W 425
           +
Sbjct: 292 Y 292


>gi|254424358|ref|ZP_05038076.1| phosphate ABC transporter, permease protein PstA [Synechococcus sp.
           PCC 7335]
 gi|196191847|gb|EDX86811.1| phosphate ABC transporter, permease protein PstA [Synechococcus sp.
           PCC 7335]
          Length = 309

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 154/252 (61%), Gaps = 6/252 (2%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
           +D  G L    N+ F  +  S + E AGI  A+ G++++M +V   +FP+G+ + IYLEE
Sbjct: 60  MDGLGTL----NWNFVTSFPSRKAERAGIVAALAGTVWLMGLVALFAFPIGVGAGIYLEE 115

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK--MPRSTALVGGLILALMTLP 292
           F+   +F+ FV+ NI NLA VPSI+YG+LG AV +   +      + L G L ++L+ LP
Sbjct: 116 FAGDNWFTRFVEINIGNLAGVPSIIYGLLGLAVFVRIMEPITGGRSVLSGSLTISLLILP 175

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +I+AT  ALR +P S+R A   LGA++ Q V  HVLP A P ILTG  ++L+RA+GETA
Sbjct: 176 IVIVATREALRAIPESLRLAGYALGATRWQVVRSHVLPAAAPGILTGMILALSRAIGETA 235

Query: 353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
            L+ VG   F++  P G+    TA P+QIY W +  +  F       I++L+  L V+N 
Sbjct: 236 SLIAVGAAVFISFLPEGLNSQFTAMPIQIYNWISRPQDEFHYIAASGIIVLMTALLVMNG 295

Query: 413 AMLWLRNRFKKR 424
             ++LRNRF++ 
Sbjct: 296 LAIYLRNRFQQE 307


>gi|21283004|ref|NP_646092.1| hypothetical protein MW1275 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486229|ref|YP_043450.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207959|ref|ZP_06924390.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300912043|ref|ZP_07129486.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21204443|dbj|BAB95140.1| MW1275 [Staphylococcus aureus subsp. aureus MW2]
 gi|49244672|emb|CAG43104.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887202|gb|EFH26104.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300886289|gb|EFK81491.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 305

 Score =  182 bits (463), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+GILG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGILGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|304407965|ref|ZP_07389615.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus curdlanolyticus YK9]
 gi|304342984|gb|EFM08828.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus curdlanolyticus YK9]
          Length = 291

 Score =  182 bits (463), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 100/235 (42%), Positives = 144/235 (61%), Gaps = 1/235 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F N  S R   AG+  A+VG+LYM+ I++ LSF LG+ +AIYLEE++ K   +  +Q N
Sbjct: 56  LFNNFPSRRATQAGMKSAIVGTLYMLAIMLPLSFVLGVGAAIYLEEYAKKNRLTRIIQLN 115

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+ LA VPSIVYGILG  + +    + RS  L G   + L+ LP II++   A+R VP S
Sbjct: 116 ISTLAGVPSIVYGILGLTIFVRMMHLDRSL-LSGAFTMTLLVLPIIIVSAQEAIRAVPKS 174

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
            R A+  LGA+K QTV   VLP ++  ILTG  ++++RA+GETAPL+ +G + FV   P 
Sbjct: 175 RRDASFALGATKWQTVARSVLPSSISGILTGVILAMSRAIGETAPLVMIGALTFVAFLPD 234

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              D  T  P+QIY W +  +  F E     I++LL  L ++N + + LRN++ K
Sbjct: 235 SPMDSFTVMPIQIYNWVSRPQEAFQELAAAGIIVLLAMLLLMNFSAIMLRNKYNK 289


>gi|219667309|ref|YP_002457744.1| phosphate ABC transporter inner membrane subunit PstA
           [Desulfitobacterium hafniense DCB-2]
 gi|219537569|gb|ACL19308.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfitobacterium hafniense DCB-2]
          Length = 295

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 173/285 (60%), Gaps = 15/285 (5%)

Query: 147 IDSALKGYLYSPANVHRMSDYQWKWFQ-KLDSDGAL---FLDFNYGFFINGASSRPEVAG 202
           +++AL  YL+S + V  +       +Q  LDS G L   FL  N   F       PE AG
Sbjct: 20  LNNALN-YLFSLSTVFSILVLGVLLYQVGLDSMGWLDGQFLTSNLSIF-------PEKAG 71

Query: 203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGI 262
           I  A++G++ MMLIVI ++  LG+++AIYLEE++ KG     +  NI+NLASVPS+++G+
Sbjct: 72  IYGAIIGTILMMLIVIPVTIILGVSTAIYLEEYAQKGRLQYLINVNISNLASVPSVIFGL 131

Query: 263 LGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQ 322
           LG  V      +  S+ L GGL ++L+ LP +++A   A+R VP  +R A+  +GA K  
Sbjct: 132 LGLTVFGRLMNL-GSSILAGGLTMSLLVLPIVVVAAQEAIRAVPDFLREASYAMGADKWT 190

Query: 323 TVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIY 382
           TV   +LP+A+P ILTG+ ++++RA+GETAPL+ +G+   +   P  V D  T  P+QIY
Sbjct: 191 TVRKVILPVAIPGILTGTILAMSRAIGETAPLVVLGIPTLIMRIPTSVMDDFTVLPIQIY 250

Query: 383 LWAADA--ERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            W  DA  +  +       I++LL+ L ++N+  + +RN+F++R+
Sbjct: 251 YWTLDAVLKPEYANLAAATIVVLLVILFLMNSVAVIIRNKFQQRF 295


>gi|258423651|ref|ZP_05686539.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9635]
 gi|257846149|gb|EEV70175.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9635]
          Length = 305

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASFGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|169829092|ref|YP_001699250.1| ABC transporter permease [Lysinibacillus sphaericus C3-41]
 gi|168993580|gb|ACA41120.1| Probable ABC transporter permease protein [Lysinibacillus
           sphaericus C3-41]
          Length = 292

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 155/241 (64%), Gaps = 1/241 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  F  N AS   + AG+  A++GSL++M +V  +S  LG+ +AIYLEE++ K   + F
Sbjct: 53  LNIDFLTNFASRFADKAGVKAALIGSLWLMAVVAPVSIILGVGTAIYLEEYAKKNRINDF 112

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI+NLA VPSIV+G+LG  + +    + +S  L  GL ++L+ LP II+A   A+R 
Sbjct: 113 IRMNISNLAGVPSIVFGLLGLTIFVRMMGLGKSV-LAAGLTMSLLILPVIIVAAQEAIRA 171

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP+  R A+ G+GA+K QT+   VLP A+P ILTGS ++++RA+GETAPL+ +G+   + 
Sbjct: 172 VPNEQREASYGMGATKWQTILRVVLPAAIPGILTGSILAMSRAIGETAPLVVIGIPVILQ 231

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G+    TA P+QIY WA   +  F       IL+L+  L ++N+  +++RN+F+KR
Sbjct: 232 FLPNGLLSQFTALPMQIYDWAKRPQEAFQYVAAAGILVLMTVLLLMNSIAIFIRNKFQKR 291

Query: 425 W 425
           +
Sbjct: 292 Y 292


>gi|126652195|ref|ZP_01724374.1| ABC-type phosphate transport system permease component [Bacillus
           sp. B14905]
 gi|126590927|gb|EAZ85039.1| ABC-type phosphate transport system permease component [Bacillus
           sp. B14905]
          Length = 292

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 156/241 (64%), Gaps = 1/241 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  F +N AS   + AG+  A++GSL++M +V  +S  LG+ +AIYLEE++ K   + F
Sbjct: 53  LNIDFLMNFASRFADKAGVKAALLGSLWLMAVVAPVSIILGVGTAIYLEEYAKKNRINDF 112

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI+NLA VPSIV+G+LG  + +    + +S  L  GL ++L+ LP II+A   A+R 
Sbjct: 113 IRMNISNLAGVPSIVFGLLGLTIFVRMMGLGKSV-LAAGLTMSLLILPVIIVAAQEAIRA 171

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP+  R A+ G+GA+K QT+   VLP A+P ILTGS ++++RA+GETAPL+ +G+   + 
Sbjct: 172 VPNEQREASYGMGATKWQTILRVVLPAAIPGILTGSILAMSRAIGETAPLVVIGIPVILQ 231

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G+    TA P+QIY WA   +  F       IL+L+  L ++N+  +++RN+F+KR
Sbjct: 232 FLPNGLLSQFTALPMQIYDWAKRPQEAFQYVAAAGILVLMTVLLLMNSIAIFIRNKFQKR 291

Query: 425 W 425
           +
Sbjct: 292 Y 292


>gi|258444723|ref|ZP_05693052.1| phosphate ABC transporter [Staphylococcus aureus A8115]
 gi|282892879|ref|ZP_06301114.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A8117]
 gi|257850216|gb|EEV74169.1| phosphate ABC transporter [Staphylococcus aureus A8115]
 gi|282764876|gb|EFC05001.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A8117]
          Length = 305

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|283470601|emb|CAQ49812.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus ST398]
          Length = 305

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPTSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|15924377|ref|NP_371911.1| phosphate ABC transporter permease [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926967|ref|NP_374500.1| hypothetical protein SA1219 [Staphylococcus aureus subsp. aureus
           N315]
 gi|57651887|ref|YP_186274.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus COL]
 gi|87160734|ref|YP_493978.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|88195113|ref|YP_499913.1| phosphate ABC transporter permease [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267875|ref|YP_001246818.1| phosphate ABC transporter, inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus JH9]
 gi|150393939|ref|YP_001316614.1| phosphate ABC transporter inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus JH1]
 gi|151221510|ref|YP_001332332.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156979706|ref|YP_001441965.1| hypothetical protein SAHV_1375 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509553|ref|YP_001575212.1| phosphate ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|221140588|ref|ZP_03565081.1| phosphate ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus str. JKD6009]
 gi|253317020|ref|ZP_04840233.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus str. CF-Marseille]
 gi|253733365|ref|ZP_04867530.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006176|ref|ZP_05144777.2| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus Mu50-omega]
 gi|257795558|ref|ZP_05644537.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9781]
 gi|258413366|ref|ZP_05681642.1| ABC phosphate transporter ATP-binding protein [Staphylococcus
           aureus A9763]
 gi|258420527|ref|ZP_05683469.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9719]
 gi|258434701|ref|ZP_05688775.1| phosphate ABC transporter [Staphylococcus aureus A9299]
 gi|258447442|ref|ZP_05695586.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A6300]
 gi|258449283|ref|ZP_05697386.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A6224]
 gi|258451784|ref|ZP_05699808.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A5948]
 gi|258454663|ref|ZP_05702627.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A5937]
 gi|262049856|ref|ZP_06022719.1| hypothetical protein SAD30_0585 [Staphylococcus aureus D30]
 gi|262052197|ref|ZP_06024404.1| hypothetical protein SA930_0547 [Staphylococcus aureus 930918-3]
 gi|269203009|ref|YP_003282278.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus ED98]
 gi|282926209|ref|ZP_06333843.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9765]
 gi|282928947|ref|ZP_06336536.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A10102]
 gi|284024388|ref|ZP_06378786.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus 132]
 gi|294848392|ref|ZP_06789139.1| phosphate ABC transporter [Staphylococcus aureus A9754]
 gi|295406332|ref|ZP_06816139.1| phosphate ABC transporter [Staphylococcus aureus A8819]
 gi|296276663|ref|ZP_06859170.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus MR1]
 gi|297244561|ref|ZP_06928444.1| phosphate ABC transporter [Staphylococcus aureus A8796]
 gi|304381037|ref|ZP_07363691.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|13701184|dbj|BAB42479.1| SA1219 [Staphylococcus aureus subsp. aureus N315]
 gi|14247158|dbj|BAB57549.1| similar to phosphate ABC transporter [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|57286073|gb|AAW38167.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus COL]
 gi|87126708|gb|ABD21222.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|87202671|gb|ABD30481.1| phosphate ABC transporter, permease protein, putative
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740944|gb|ABQ49242.1| phosphate ABC transporter, inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149946391|gb|ABR52327.1| phosphate ABC transporter, inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus JH1]
 gi|150374310|dbj|BAF67570.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156721841|dbj|BAF78258.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368362|gb|ABX29333.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253728633|gb|EES97362.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257789530|gb|EEV27870.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9781]
 gi|257839930|gb|EEV64398.1| ABC phosphate transporter ATP-binding protein [Staphylococcus
           aureus A9763]
 gi|257843475|gb|EEV67882.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9719]
 gi|257849062|gb|EEV73044.1| phosphate ABC transporter [Staphylococcus aureus A9299]
 gi|257853633|gb|EEV76592.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A6300]
 gi|257857271|gb|EEV80169.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A6224]
 gi|257860615|gb|EEV83439.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A5948]
 gi|257863046|gb|EEV85810.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A5937]
 gi|259159941|gb|EEW44978.1| hypothetical protein SA930_0547 [Staphylococcus aureus 930918-3]
 gi|259162080|gb|EEW46659.1| hypothetical protein SAD30_0585 [Staphylococcus aureus D30]
 gi|262075299|gb|ACY11272.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus ED98]
 gi|269940883|emb|CBI49265.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282589456|gb|EFB94546.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A10102]
 gi|282592273|gb|EFB97291.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9765]
 gi|285817065|gb|ADC37552.1| Phosphate transport system permease protein PstA [Staphylococcus
           aureus 04-02981]
 gi|294825192|gb|EFG41614.1| phosphate ABC transporter [Staphylococcus aureus A9754]
 gi|294968920|gb|EFG44942.1| phosphate ABC transporter [Staphylococcus aureus A8819]
 gi|297178591|gb|EFH37837.1| phosphate ABC transporter [Staphylococcus aureus A8796]
 gi|302751217|gb|ADL65394.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304340346|gb|EFM06286.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|312829782|emb|CBX34624.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus ECT-R 2]
 gi|315131193|gb|EFT87177.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315196353|gb|EFU26705.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140282|gb|EFW32140.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus MRSA131]
 gi|320143946|gb|EFW35718.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus MRSA177]
 gi|329314063|gb|AEB88476.1| Phosphate ABC transporter, inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus T0131]
 gi|329727410|gb|EGG63866.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus 21172]
 gi|329728712|gb|EGG65139.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus 21189]
 gi|329728914|gb|EGG65332.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus 21193]
          Length = 305

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|298694683|gb|ADI97905.1| probable phosphate ABC transporter permease [Staphylococcus aureus
           subsp. aureus ED133]
 gi|323441172|gb|EGA98879.1| phosphate ABC transporter permease [Staphylococcus aureus O11]
 gi|323444041|gb|EGB01652.1| phosphate ABC transporter permease [Staphylococcus aureus O46]
          Length = 305

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|310657923|ref|YP_003935644.1| phosphate ABC transporter permease [Clostridium sticklandii DSM
           519]
 gi|308824701|emb|CBH20739.1| phosphate ABC transporter, permease protein [Clostridium
           sticklandii]
          Length = 316

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 168/267 (62%), Gaps = 16/267 (5%)

Query: 161 VHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGL 220
           ++R+S     W   LD D   FL  N   F       PE AGI  A++G+LY+M IVI +
Sbjct: 64  IYRISIQSIGW---LDMD---FLTSNLSIF-------PEKAGIKGAILGTLYLMSIVIPV 110

Query: 221 SFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTAL 280
              LG+++AIYLEE+++KG   SF++ NI+NLASVPS+++G+LG AV    F +  S+ L
Sbjct: 111 VCILGVSTAIYLEEYANKGKIQSFIKVNISNLASVPSVIFGLLGLAVFGRIFSL-GSSIL 169

Query: 281 VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGS 340
            GGL ++L+ LP +++A+  ALR VP  +R A+  +GASK  T +  VLP+A+P ILTG 
Sbjct: 170 AGGLTMSLLVLPVVVVASQEALRAVPGYLREASYAMGASKWTTTWKVVLPVAVPGILTGV 229

Query: 341 TVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFG 398
            +S++RA+GETAPL+ +G+   +   P  + D  TA P+QIY W  D    + +      
Sbjct: 230 ILSVSRAIGETAPLVVLGVPTLIMKLPTSIMDDFTAMPIQIYYWTLDTVLTKEYANLAAA 289

Query: 399 AILLLLIFLAVINTAMLWLRNRFKKRW 425
            I++LL+ L ++N   + +RN+F++++
Sbjct: 290 TIVVLLLVLFIMNFTAILIRNKFQRKF 316


>gi|282916654|ref|ZP_06324412.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus D139]
 gi|283770459|ref|ZP_06343351.1| phosphate transport system permease [Staphylococcus aureus subsp.
           aureus H19]
 gi|282319141|gb|EFB49493.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus D139]
 gi|283460606|gb|EFC07696.1| phosphate transport system permease [Staphylococcus aureus subsp.
           aureus H19]
          Length = 305

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|302333000|gb|ADL23193.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           JKD6159]
          Length = 305

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNIASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|89896862|ref|YP_520349.1| hypothetical protein DSY4116 [Desulfitobacterium hafniense Y51]
 gi|89336310|dbj|BAE85905.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 303

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/315 (34%), Positives = 182/315 (57%), Gaps = 17/315 (5%)

Query: 114 LSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQ 173
           +S    Y  R   + D   I   ++V+++           YL+S + +  +       +Q
Sbjct: 3   MSMNEGYSSRPKFIIDSKRIDNRIKVNIMLK---------YLFSFSTIFSLLVLGVLLYQ 53

Query: 174 -KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL 232
             +DS G  +LD    F  +  S  P  AGI   ++G++ MMLIVI ++  LG+++AIYL
Sbjct: 54  VGVDSIG--WLDLQ--FLTSNLSIFPHKAGIYGVILGTVMMMLIVIPVTTVLGVSTAIYL 109

Query: 233 EEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLP 292
           EE++ KG     +  NI+NLASVPS+++G+LG  V      +  S+ L GGL ++L+ LP
Sbjct: 110 EEYAQKGKLQYLINVNISNLASVPSVIFGLLGLTVFGRLMNL-GSSILAGGLTMSLLVLP 168

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +++A   A+R VPS +R A+  +GA K  TV   VLP+A+P ILTG+ ++++RA+GETA
Sbjct: 169 IVVVAAQEAIRAVPSFLREASYAMGADKWTTVRKVVLPVALPGILTGTILAMSRAIGETA 228

Query: 353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVI 410
           PL+ +G+   +  +P  V D  TA P+QIY W  D+  +  +       I++LL  L ++
Sbjct: 229 PLVVLGIPTLIMKFPTSVMDNFTALPIQIYYWTLDSVLKPEYANLAAATIVVLLAILFLM 288

Query: 411 NTAMLWLRNRFKKRW 425
           N+  + +RN+F++R+
Sbjct: 289 NSVAIIIRNKFQQRF 303


>gi|82750979|ref|YP_416720.1| phosphate ABC transporter permease [Staphylococcus aureus RF122]
 gi|82656510|emb|CAI80932.1| probable phosphate ABC transporter permease [Staphylococcus aureus
           RF122]
          Length = 305

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 156/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI  AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGKAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASHGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|49483578|ref|YP_040802.1| ABC transporter permease [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257425452|ref|ZP_05601877.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428112|ref|ZP_05604510.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430743|ref|ZP_05607125.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433503|ref|ZP_05609861.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436344|ref|ZP_05612391.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus M876]
 gi|282903968|ref|ZP_06311856.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus C160]
 gi|282905733|ref|ZP_06313588.1| phosphate ABC transporter permease PstA [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282908704|ref|ZP_06316522.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282910968|ref|ZP_06318770.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282914176|ref|ZP_06321963.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M899]
 gi|282919098|ref|ZP_06326833.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus C427]
 gi|282924281|ref|ZP_06331955.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus C101]
 gi|283958150|ref|ZP_06375601.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|293501203|ref|ZP_06667054.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293510164|ref|ZP_06668872.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus M809]
 gi|293526756|ref|ZP_06671441.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M1015]
 gi|295427901|ref|ZP_06820533.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297591138|ref|ZP_06949776.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49241707|emb|CAG40397.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|257271909|gb|EEV04047.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274953|gb|EEV06440.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278871|gb|EEV09490.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281596|gb|EEV11733.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284626|gb|EEV14746.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus M876]
 gi|282313668|gb|EFB44061.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus C101]
 gi|282316908|gb|EFB47282.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus C427]
 gi|282322244|gb|EFB52568.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M899]
 gi|282324663|gb|EFB54973.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282326968|gb|EFB57263.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282331025|gb|EFB60539.1| phosphate ABC transporter permease PstA [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282595586|gb|EFC00550.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus C160]
 gi|283790299|gb|EFC29116.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|290920828|gb|EFD97891.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M1015]
 gi|291096208|gb|EFE26469.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291467108|gb|EFF09626.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus M809]
 gi|295128259|gb|EFG57893.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297576024|gb|EFH94740.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|312438212|gb|ADQ77283.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315195279|gb|EFU25666.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 305

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+G+LG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           ++ K++
Sbjct: 300 KYSKKF 305


>gi|229163215|ref|ZP_04291170.1| ABC transporter permease protein [Bacillus cereus R309803]
 gi|228620278|gb|EEK77149.1| ABC transporter permease protein [Bacillus cereus R309803]
          Length = 288

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 158/267 (59%), Gaps = 8/267 (2%)

Query: 161 VHRMSDYQWKWFQKLDSDGALFLDFNYG-------FFINGASSRPEVAGIGVAVVGSLYM 213
           ++++S Y   WF  +     LF  F  G       FF N AS  P+ AGI  A+ G++  
Sbjct: 22  IYKLSFYIAIWFSIVILFILLFQIFEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILF 81

Query: 214 MLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK 273
           M IVI +SF  G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    
Sbjct: 82  MSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALH 141

Query: 274 MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAM 333
           +  S  +   L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP A 
Sbjct: 142 LGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYRVVLPYAF 200

Query: 334 PAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFV 393
           P I+TG T++++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F 
Sbjct: 201 PGIITGCTLAISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQ 260

Query: 394 ERTFGAILLLLIFLAVINTAMLWLRNR 420
                 +++LL  L  IN  +LWLRNR
Sbjct: 261 YVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|226349693|ref|YP_002776807.1| putative phosphate ABC transporter permease protein [Rhodococcus
           opacus B4]
 gi|226245608|dbj|BAH55955.1| putative phosphate ABC transporter permease protein [Rhodococcus
           opacus B4]
          Length = 303

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 151/251 (60%), Gaps = 6/251 (2%)

Query: 178 DGALFLDFNYGFFINGASSR--PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
           +G    D+N    I+   SR  PE +G+  A+ G+L++ML  I L+ P+GIA A+YLEE+
Sbjct: 56  EGLARFDWN---LISQQPSRLHPETSGVQSAIFGTLWVMLGTIILAIPIGIAGAVYLEEY 112

Query: 236 SHK-GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           +    +++  ++ NI NL +VP+I+YGIL  A ++          L G + LAL+ LP I
Sbjct: 113 ADSTKWWNRLIELNIQNLVAVPTIIYGILTLAFVVRGPISLGPVVLAGSVALALLILPVI 172

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           II T  ALR+VP  IR A+L LGA+  QT +  VLP A+  I TG+ ++L+RA+GE APL
Sbjct: 173 IITTREALRSVPRDIRDASLALGATLWQTTWKQVLPSAISGIATGTILALSRAIGEAAPL 232

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           L VG   FVT  P G  D  T  PVQI+      E    +  +  ILLL++ L  +N   
Sbjct: 233 LLVGATVFVTVNPEGFLDRYTVLPVQIFNLVKLPEEANQQLAWATILLLMVILLAMNGLA 292

Query: 415 LWLRNRFKKRW 425
           +W+RNRF++RW
Sbjct: 293 IWMRNRFQRRW 303


>gi|70726525|ref|YP_253439.1| hypothetical protein SH1524 [Staphylococcus haemolyticus JCSC1435]
 gi|68447249|dbj|BAE04833.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 306

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 158/241 (65%), Gaps = 4/241 (1%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AGI  A+ G++++M+ +I +S  LG+ +AIYLEE++   FF+SFV+ +
Sbjct: 66  FFTNFSSSTPSQAGIKGALAGTIWLMISIIPISIVLGVGTAIYLEEYAKDNFFTSFVKIS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPR----STALVGGLILALMTLPSIIIATGVALRT 304
           I+NLA VPSIV+G+LG  + +    +      ++ +   L ++L+ LP II+++  A+R 
Sbjct: 126 ISNLAGVPSIVFGLLGLTLFVRGGGIQALALGNSVIAAALTMSLLILPIIIVSSQEAIRA 185

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   + 
Sbjct: 186 VPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLILIGIPTILL 245

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P  +  + TA P QIY WA   +  F      AI++LL+ L ++N   ++LRN+F ++
Sbjct: 246 ATPTSIMSMFTALPTQIYTWAKMPQAEFQNVASAAIIILLVILLLMNAVAIFLRNKFSRK 305

Query: 425 W 425
           +
Sbjct: 306 Y 306


>gi|229031918|ref|ZP_04187905.1| ABC transporter permease protein [Bacillus cereus AH1271]
 gi|228729382|gb|EEL80372.1| ABC transporter permease protein [Bacillus cereus AH1271]
          Length = 286

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FFIN AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 55  FFINFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPSS 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEASYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 285


>gi|76803411|ref|YP_327680.1| phosphate ABC transporter permease [Natronomonas pharaonis DSM
           2160]
 gi|76559226|emb|CAI50830.1| ABC-type transport system permease protein I (probable substrate
           phosphate) 2 [Natronomonas pharaonis DSM 2160]
          Length = 303

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 101/236 (42%), Positives = 148/236 (62%), Gaps = 2/236 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F     S RPE++G   A+V S+ +M +   LSF +G+ SAIYLEE++     +  ++AN
Sbjct: 69  FVTRDGSRRPELSGFRGAIVASVMLMALTAFLSFFIGVGSAIYLEEYAPDNRITRLIEAN 128

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + NLA VPSIVYG+L  A L N   +     LVGG+ LAL+ +P II+++  ALR VP S
Sbjct: 129 LANLAGVPSIVYGLLALAALRNGIGL-GPIVLVGGVALALLVMPIIIVSSQEALRAVPDS 187

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R  +   GA++ QT+   VLP A+P I TG+ ++LARA+GETAPLL VG + FV   P 
Sbjct: 188 VRRGSYATGATQWQTIRKVVLPAALPGIFTGTILALARAIGETAPLLMVGAL-FVNRMPR 246

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           G+ D  +  P QIY WAA+  + F+      I++LL F+ V+N   ++LRN+++  
Sbjct: 247 GLMDRFSGMPTQIYSWAAEPSQHFIHLAAVGIVVLLTFMLVMNGIAVYLRNKYETE 302


>gi|300711668|ref|YP_003737482.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halalkalicoccus jeotgali B3]
 gi|299125351|gb|ADJ15690.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halalkalicoccus jeotgali B3]
          Length = 305

 Score =  179 bits (454), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 151/237 (63%), Gaps = 2/237 (0%)

Query: 190 FINGASSR-PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F+  A SR P+ AGI  A++GS+ MM++V   + P+G+ +A+YL E++ +  F+  +Q N
Sbjct: 69  FLTSAPSRFPDEAGIYPALIGSIMMMIVVAVATVPIGVGAALYLVEYAPQNRFTELIQLN 128

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA VPS+VYG+LG A+ I  F +P  + LVGG+ + L+ LP +II+   A+ +VP S
Sbjct: 129 IANLAGVPSVVYGLLGLALFIRVFTLPYGSVLVGGMAVGLLILPIVIISAQEAIDSVPDS 188

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
            R A+L +GA++ QT  + VLP A+P ILTG+ ++  RA+GETAPLL +G  A + + P 
Sbjct: 189 QREASLAMGATRWQTTRNVVLPGALPGILTGTILAFGRAIGETAPLLMIGAAATIYNPPA 248

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGA-ILLLLIFLAVINTAMLWLRNRFKKR 424
           G     +A P QIY W+A     F      A ++ LL  +  +N A + +RNR+++R
Sbjct: 249 GFLARFSAMPRQIYTWSAMPSPEFRYGVLAAGVVTLLAVMLSMNAAAILIRNRYQRR 305


>gi|315928837|gb|EFV08102.1| binding-protein-dependent transport system inner membrane component
           family protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 194

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 136/192 (70%)

Query: 233 EEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLP 292
           EEF+ +   + F++  INNLAS+PSI++G+LG  V IN F +PRS+ALVGGL LA+M+LP
Sbjct: 1   EEFAPQNILTHFIEVCINNLASIPSILFGLLGLGVFINLFGIPRSSALVGGLTLAIMSLP 60

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            II++T  AL++V  ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETA
Sbjct: 61  IIIVSTKAALKSVDINMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETA 120

Query: 353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           PL+ +GM+AF+ D    + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N 
Sbjct: 121 PLMIIGMIAFIPDVASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNL 180

Query: 413 AMLWLRNRFKKR 424
           + + LR  F+ +
Sbjct: 181 SAILLRKYFQGK 192


>gi|152976703|ref|YP_001376220.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           cereus subsp. cytotoxis NVH 391-98]
 gi|152025455|gb|ABS23225.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           cytotoxicus NVH 391-98]
          Length = 288

 Score =  179 bits (454), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 147/232 (63%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F I+ AS  P   GI  A+ G++  M IV+ +SF LG+ +A+YLE ++ +  F+  +  N
Sbjct: 57  FLIHFASRHPNQTGIAAALSGTILFMSIVVPVSFILGVGTALYLEHYAKQSIFTRMIALN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I  LA VPS+V+G+LG  + +  F++  S  +   L ++L++LP++++++  A+R VP  
Sbjct: 117 IQTLAGVPSVVFGLLGLTIFVYAFQLGESI-VAAALTMSLLSLPTVVVSSQEAIRMVPDG 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ G+GA+K QT++  VLP A+P ILTG  ++L+RA+GE APLL +G +AF    P+
Sbjct: 176 LLEASYGVGATKWQTMYQVVLPTALPGILTGCILALSRAIGEAAPLLVIGALAFANYIPL 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           G+ D  T  P+QI+ W +  +  F       +++LL  L ++N  +LWLRNR
Sbjct: 236 GIFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLLIMNMVVLWLRNR 287


>gi|158320153|ref|YP_001512660.1| phosphate ABC transporter, inner membrane subunit PstA
           [Alkaliphilus oremlandii OhILAs]
 gi|158140352|gb|ABW18664.1| phosphate ABC transporter, inner membrane subunit PstA
           [Alkaliphilus oremlandii OhILAs]
          Length = 299

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 147/240 (61%), Gaps = 2/240 (0%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK-GFFSSF 244
           N+ F  +  S  P+ AGI  A+VGS++ + +    S P+G+ +AIYLEE++ K  + +  
Sbjct: 59  NWDFITSMPSRFPQKAGIFSALVGSIWTIGLTALFSLPIGVGTAIYLEEYADKRTWHNKV 118

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           +Q NI+NLA VPSIVYGILG  V + FF   RS  L G L L L+ LP II++   A+++
Sbjct: 119 LQLNISNLAGVPSIVYGILGLTVFVRFFNFERSI-LSGALTLTLLILPVIIVSAQEAIKS 177

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP+S+R  +L LG +K QTV   VLP A+P ILTGS ++++RA+GE APL+ VG   +V 
Sbjct: 178 VPNSLREGSLALGVTKWQTVTGVVLPYALPGILTGSILAISRAMGEAAPLIMVGAAGYVA 237

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G  D  T  P+QI+ W +  +  F       I++L+  L   N   + LRN+++ R
Sbjct: 238 FLPRGPMDSFTVLPIQIFNWTSRPQAEFQNIASAGIIVLMFLLLSANAVAIILRNKYQNR 297


>gi|55378284|ref|YP_136134.1| phosphate ABC transporter permease [Haloarcula marismortui ATCC
           43049]
 gi|55231009|gb|AAV46428.1| phosphate ABC transporter permease protein [Haloarcula marismortui
           ATCC 43049]
          Length = 566

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 155/244 (63%), Gaps = 5/244 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK----GF 240
            ++GF  +  S     AGI  ++VGS+ M+++++  +FP+G+ +AIYLEE++      G 
Sbjct: 321 LDWGFLTSATSRTAADAGIYPSMVGSVMMIIVIVLTTFPVGVGAAIYLEEYAPSQGLMGK 380

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           F + ++ NI NLA VPS+VYG+LG A+ I   + P+ + +V GL + L+ LP +II+   
Sbjct: 381 FVTLIEINIGNLAGVPSVVYGLLGLALFIRVLQWPQGSVIVAGLAVGLLILPIVIISAQE 440

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           A+R+VP S R A+ G+GA++ QT+   VLP A+P ILTG+ ++L RA+GETAPLL +G  
Sbjct: 441 AIRSVPDSFRQASYGMGATRWQTIRQVVLPEALPGILTGTILALGRAIGETAPLLMIGAA 500

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA-ILLLLIFLAVINTAMLWLRN 419
           A V   P    D+A+  P QI+ W+++ +  F      A ++ LL  L V+N   + +RN
Sbjct: 501 ASVRLAPNSFFDVASMMPRQIFSWSSELDPAFRHGVLAAGVITLLAVLLVMNATAIVIRN 560

Query: 420 RFKK 423
           R+++
Sbjct: 561 RYQR 564


>gi|224476519|ref|YP_002634125.1| putative phosphate ABC transporter permease [Staphylococcus
           carnosus subsp. carnosus TM300]
 gi|222421126|emb|CAL27940.1| putative phosphate ABC transporter permease protein [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 309

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 157/241 (65%), Gaps = 4/241 (1%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P++AGI  A+VG+L++M+ +I +S  LG+ +AIYLEE++H   F+SF++ +
Sbjct: 69  FFTNFSSSMPQMAGIKGALVGTLWLMITIIPISIILGVGTAIYLEEYAHDNAFTSFIKIS 128

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPR----STALVGGLILALMTLPSIIIATGVALRT 304
           I+NLA VPS+V+G+LG  + +    +       + L   L ++L+ LP II+++  A+R 
Sbjct: 129 ISNLAGVPSVVFGLLGLTIFVRGMGIESLSLGKSVLAAALTMSLLILPVIIVSSQEAIRA 188

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S+R A+ GLG +K QT++  VLP A+P I+TG  +SL+RALGETAPL+ +G+   + 
Sbjct: 189 VPKSVREASYGLGGNKWQTIYKIVLPAALPGIMTGFILSLSRALGETAPLILIGIPTILL 248

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P  + D   A P+QIY WA   +  F       I++LLI L  +N   ++LRN+F K+
Sbjct: 249 RLPSSIFDQFQAMPIQIYNWAKMPQEAFQHVASAGIIVLLILLLAMNGLAIFLRNKFSKK 308

Query: 425 W 425
           +
Sbjct: 309 Y 309


>gi|229086839|ref|ZP_04219001.1| ABC transporter permease protein [Bacillus cereus Rock3-44]
 gi|228696483|gb|EEL49306.1| ABC transporter permease protein [Bacillus cereus Rock3-44]
          Length = 288

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 147/232 (63%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FFIN AS  P+ AGI  A+ G++  M IV+ +SF  G+ +A+YLE ++ +  F+  V+ N
Sbjct: 57  FFINFASRDPKQAGIAAALSGTVLFMSIVVPVSFVFGVGTALYLEHYAKRSVFTRIVELN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I  LA VPS+V+G+LG  + +   ++  S  +   L ++L+ LP++++++  A+R VP +
Sbjct: 117 IQTLAGVPSVVFGLLGLTIFVYGLQLGESI-ITAALTMSLLVLPTVVVSSQEAIRMVPGN 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ G+GA+K QT++  VLP A+P +LTG  ++L+RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGVGATKWQTMYQIVLPTALPGVLTGCVLALSRAIGEAAPLLVIGALAFANYIPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L ++N  +LWLRNR
Sbjct: 236 DMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLLIMNAIVLWLRNR 287


>gi|149178898|ref|ZP_01857476.1| phosphate ABC transporter, permease protein PstA [Planctomyces
           maris DSM 8797]
 gi|148842237|gb|EDL56622.1| phosphate ABC transporter, permease protein PstA [Planctomyces
           maris DSM 8797]
          Length = 292

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 153/243 (62%), Gaps = 3/243 (1%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            ++GF  +  S  P  AGI  A+ GS++++ +    S PLG+ +A+YLEE++ +  +   
Sbjct: 51  LSWGFIDHLPSRFPHKAGIKSALWGSIWLISLTAMFSVPLGVGAAVYLEEYAPRSRWRKL 110

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           +Q NI NLA VPSIVYGILG  + +    + RS  L G L L L+ LP II+A+  ALR 
Sbjct: 111 IQLNIANLAGVPSIVYGILGLGLFVRALSLERSV-LSGALTLTLVVLPIIILASQEALRA 169

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR +A  LGA++ QTV++ VLP ++P I+TG  +SL+RALGE APL+ VG +A+V 
Sbjct: 170 VPDSIRRSAYALGATRWQTVWYQVLPASLPGIMTGVILSLSRALGEAAPLIAVGAMAYVP 229

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK- 423
             P  +TD  TA P+QI+ W +  +  F       IL+LL+ L  +N   +++R+++ K 
Sbjct: 230 FVPEKLTDEFTALPIQIFNWTSRPQEDFHHLAAAGILVLLVVLVSMNAIAIFVRHKYGKK 289

Query: 424 -RW 425
            RW
Sbjct: 290 IRW 292


>gi|229104899|ref|ZP_04235558.1| ABC transporter permease protein [Bacillus cereus Rock3-28]
 gi|228678529|gb|EEL32747.1| ABC transporter permease protein [Bacillus cereus Rock3-28]
          Length = 288

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKIIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYQIVLPVAFPGIITGCTLAVSRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|83816144|ref|YP_446399.1| phosphate ABC transporter, permease protein PstA [Salinibacter
           ruber DSM 13855]
 gi|294508336|ref|YP_003572394.1| phosphate transport system permease protein pstA [Salinibacter
           ruber M8]
 gi|83757538|gb|ABC45651.1| phosphate ABC transporter, permease protein PstA [Salinibacter
           ruber DSM 13855]
 gi|294344664|emb|CBH25442.1| Phosphate transport system permease protein pstA [Salinibacter
           ruber M8]
          Length = 314

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 114/248 (45%), Positives = 158/248 (63%), Gaps = 5/248 (2%)

Query: 178 DGALFLDFNYGFFINGASSR-PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
            G  +LD   G FI    SR P  AGI  A+ GSL++M +   +S PLG+ASA+YLEE++
Sbjct: 67  SGTPWLD---GRFITSFPSRNPGEAGIKSALFGSLWLMGLTALISVPLGVASAVYLEEYA 123

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
             G+F   +Q NI NLA VPS+VYGILG A+ + F  + +S  L G L L+L+ LP III
Sbjct: 124 RDGWFLRLIQINIANLAGVPSVVYGILGLALFVRFAALGQSL-LAGALTLSLLILPIIII 182

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  ALR++PS IR  A  LGA++ Q ++ HVLP+A P I TG  ++L+RA+GETAPL+ 
Sbjct: 183 STQEALRSIPSGIRENAYALGATRWQVIWSHVLPMAAPGIFTGVILALSRAIGETAPLIL 242

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           +G + FV   P G  D  TA P+QI+ W A  +  F      AI++L+I L  +N   + 
Sbjct: 243 IGALTFVPFLPRGALDQFTALPIQIFNWTARPQSEFEGLAAAAIVVLMILLFTMNLTAIL 302

Query: 417 LRNRFKKR 424
           LRN F++R
Sbjct: 303 LRNYFEER 310


>gi|229019491|ref|ZP_04176311.1| ABC transporter permease protein [Bacillus cereus AH1273]
 gi|229025734|ref|ZP_04182137.1| ABC transporter permease protein [Bacillus cereus AH1272]
 gi|228735564|gb|EEL86156.1| ABC transporter permease protein [Bacillus cereus AH1272]
 gi|228741802|gb|EEL91982.1| ABC transporter permease protein [Bacillus cereus AH1273]
          Length = 286

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F   ++ N
Sbjct: 55  FFTNFASRNPKEAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKKLIELN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPSS 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A+P ILTG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEASYGLGATKWQTMYQIVLPVALPGILTGCTLAVSRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 285


>gi|229098741|ref|ZP_04229681.1| ABC transporter permease protein [Bacillus cereus Rock3-29]
 gi|229117766|ref|ZP_04247135.1| ABC transporter permease protein [Bacillus cereus Rock1-3]
 gi|228665743|gb|EEL21216.1| ABC transporter permease protein [Bacillus cereus Rock1-3]
 gi|228684820|gb|EEL38758.1| ABC transporter permease protein [Bacillus cereus Rock3-29]
          Length = 286

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 55  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSS 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEASYGLGATKWQTMYQIVLPVAFPGIITGCTLAVSRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 285


>gi|229075974|ref|ZP_04208950.1| ABC transporter permease protein [Bacillus cereus Rock4-18]
 gi|228707289|gb|EEL59486.1| ABC transporter permease protein [Bacillus cereus Rock4-18]
          Length = 288

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYQIVLPVAFPGIITGCTLAVSRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|229061963|ref|ZP_04199290.1| ABC transporter permease protein [Bacillus cereus AH603]
 gi|228717347|gb|EEL69019.1| ABC transporter permease protein [Bacillus cereus AH603]
          Length = 288

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/232 (40%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P  AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F   ++ N
Sbjct: 57  FFTNFASRNPREAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKKLIELN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S   V  L ++L+ LP++++A+  A+RTVPSS
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESIMAVA-LTMSLLVLPTVVVASQEAIRTVPSS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A+P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYQIVLPVALPGIVTGCTLAVSRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMLDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|317129721|ref|YP_004096003.1| phosphate ABC transporter inner membrane subunit PstA [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474669|gb|ADU31272.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           cellulosilyticus DSM 2522]
          Length = 307

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 165/254 (64%), Gaps = 5/254 (1%)

Query: 174 KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
           ++ +DG  ++  +  F  N  S+ PE AGI  A+VG++++M+IV  L+  LGI +AIYLE
Sbjct: 57  RIFADGLGWISID--FLTNKLSTLPERAGIFGAIVGTIWLMVIVGPLTMLLGIGTAIYLE 114

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           E++ KG   SF+Q NI NLA VPSIV+G+LG  + +  F    S  + GG+ ++L+ LP 
Sbjct: 115 EYAKKGKVHSFIQTNITNLAGVPSIVFGLLGLTIFVRMFGFGPSI-IAGGMTMSLLVLPI 173

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +++A   A+R+VP  +R A+ G+GA+K QT+ + VLP ++  ILTG  ++L+RA+GETAP
Sbjct: 174 VVVAAQEAIRSVPQHLREASYGMGATKWQTIKNIVLPASIAGILTGVILALSRAIGETAP 233

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVIN 411
           L+ +G+ A +   P GV D  T  P+QIY W  D+     + +     I++LLI L ++N
Sbjct: 234 LVALGIPALIIPIPGGVMDNFTVLPMQIYYWTIDSVLVDEYAQMAAATIIVLLIILFLMN 293

Query: 412 TAMLWLRNRFKKRW 425
           +  + +RN+F+ R+
Sbjct: 294 SIAIIIRNKFQNRF 307


>gi|292656504|ref|YP_003536401.1| putative phosphate ABC transporter permease [Haloferax volcanii
           DS2]
 gi|291372397|gb|ADE04624.1| ABC-type transport system permease protein (probable substrate
           phosphate) [Haloferax volcanii DS2]
          Length = 542

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 153/241 (63%), Gaps = 2/241 (0%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F  +  S   E AG+  A+ GS+ +M  V  LSFPLG+ +A+YLEE++    F+ F+
Sbjct: 301 DWQFLTSAHSGTAENAGLYPAIGGSILLMATVAALSFPLGVGAAVYLEEYAPDNAFTRFI 360

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
             NI+NLA VPS+VYG+LG  V + +   P  T L+GG  LAL+ LP +II++  A+R V
Sbjct: 361 DVNISNLAGVPSVVYGLLGLGVFVTYLGQPTGTVLIGGATLALLILPIVIISSREAIRAV 420

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           PS +R A+ G+GA++ QTV + VLP A P ILTG+ ++L RA+GETAPL+ +G    + +
Sbjct: 421 PSDMRQASYGMGATRWQTVKNVVLPEAFPGILTGTILALGRAIGETAPLIMIGAPNVLFN 480

Query: 366 YPVGVTDIATAFPVQIYLWAA--DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P  +T   +A P+Q+Y W++   +E  + +     +++LL  L  +N+  + LRN+F+ 
Sbjct: 481 LPTELTSKVSAMPLQVYAWSSLFASEDFYTKAVPAGVVVLLAVLLAMNSIAIVLRNKFES 540

Query: 424 R 424
            
Sbjct: 541 E 541


>gi|242373682|ref|ZP_04819256.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis M23864:W1]
 gi|242348650|gb|EES40252.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis M23864:W1]
          Length = 301

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 153/237 (64%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AG+  AV+GS+++++ +I ++  LGI +AIYLEE++    F+S V+ +
Sbjct: 66  FFTNFSSSTPADAGVKGAVIGSIWLIVSIIPITIILGIGTAIYLEEYAKDNIFTSIVKIS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPSIV+G+LG  + +    M  S  L   L ++L+ LP II+++  A+R VP S
Sbjct: 126 ISNLAGVPSIVFGLLGYTLFVGAAGMGNSV-LAAALTMSLLILPVIIVSSQEAIRAVPGS 184

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +   P 
Sbjct: 185 VREASFGLGANKWQTIRKVVLPAALPGILTGFILSLSRALGETAPLVVIGIPTILLATPS 244

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           G+ D  +A P QIY WA   +  F       I++LL+ L  +N   + LRN+F K++
Sbjct: 245 GLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLAMNAIAILLRNKFSKKY 301


>gi|289550795|ref|YP_003471699.1| Phosphate transport system permease protein PstA [Staphylococcus
           lugdunensis HKU09-01]
 gi|315658290|ref|ZP_07911162.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus lugdunensis M23590]
 gi|289180327|gb|ADC87572.1| Phosphate transport system permease protein PstA [Staphylococcus
           lugdunensis HKU09-01]
 gi|315496619|gb|EFU84942.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus lugdunensis M23590]
          Length = 306

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 152/241 (63%), Gaps = 4/241 (1%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AGI  A+VG+L++ML +I  S  LG+ +AIYLEE++ K  F+ F++  
Sbjct: 66  FFTNFSSSTPSQAGIKGALVGTLWLMLTIIPFSIILGVGTAIYLEEYAKKNPFTDFIKVC 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPR----STALVGGLILALMTLPSIIIATGVALRT 304
           I+NLA VPS+V+G+LG  + +    +      ++ L G L + L+ LP II+A   A+R 
Sbjct: 126 ISNLAGVPSVVFGLLGLTIFVRGMNIQALSLGNSILAGALTMTLLILPVIIVAAQEAIRA 185

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VPSS+R A+ GLGA+K QT+   VLP A+P ILTG  ++L+RALGETAPL+ +G+   + 
Sbjct: 186 VPSSVREASYGLGANKWQTIRKVVLPAALPGILTGFILALSRALGETAPLILIGIPTILL 245

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P  V D   A P+ IY WA   +  F       I++LL+ L ++N   ++ RN+F K+
Sbjct: 246 RLPNSVMDQFQALPMAIYNWAKLPQAEFQNVASAGIIVLLVILLLMNGLAIYFRNKFSKK 305

Query: 425 W 425
           +
Sbjct: 306 F 306


>gi|269122664|ref|YP_003310841.1| phosphate ABC transporter inner membrane subunit PstA [Sebaldella
           termitidis ATCC 33386]
 gi|268616542|gb|ACZ10910.1| phosphate ABC transporter, inner membrane subunit PstA [Sebaldella
           termitidis ATCC 33386]
          Length = 293

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 155/241 (64%), Gaps = 3/241 (1%)

Query: 186 NYGFFINGASS-RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK-GFFSS 243
           ++ F  N  S  RP+ AG+  A++GSL+++ +V  ++ P+G+ +AIYLEE+S+K     +
Sbjct: 51  SFDFLTNFPSKIRPQRAGVYPALLGSLWLVGLVGLITIPVGVGAAIYLEEYSNKKSKLYN 110

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++ NI+NLA VP+IVYG+LG A L +  K  R + L G + L+LM LP +I+++  A++
Sbjct: 111 FLEVNISNLAGVPAIVYGLLGLA-LFSRLKGFRGSILAGAVTLSLMVLPVVIVSSREAIK 169

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP  +R AA GLG ++ Q +   VLP A P I TG  +SL+RALGE APLL VG  ++V
Sbjct: 170 AVPGILREAAYGLGLTRWQMIKAVVLPYASPGIFTGIILSLSRALGEAAPLLVVGAASYV 229

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           T  P G+    TA P+QIY W+   ++ F E     I++LL+ L   NT  + LRN+++K
Sbjct: 230 TRIPNGIMSRYTALPIQIYQWSGMPKKEFQELAATGIIVLLVILLSANTLAIVLRNKYQK 289

Query: 424 R 424
            
Sbjct: 290 E 290


>gi|229174944|ref|ZP_04302464.1| ABC transporter permease protein [Bacillus cereus MM3]
 gi|228608612|gb|EEK65914.1| ABC transporter permease protein [Bacillus cereus MM3]
          Length = 286

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 55  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPSS 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEASYGLGATKWQTMYQIVLPSAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 285


>gi|326942052|gb|AEA17948.1| phosphate ABC transporter permease [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 288

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F + V+ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKNIVEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS+
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSA 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|332705973|ref|ZP_08426046.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1, membrane
           protein 2 [Lyngbya majuscula 3L]
 gi|332355233|gb|EGJ34700.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1, membrane
           protein 2 [Lyngbya majuscula 3L]
          Length = 302

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 160/249 (64%), Gaps = 8/249 (3%)

Query: 181 LFLD----FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           +FLD     N  F  +  S +P+ AGI   ++GS+++++I   +SFPLG+ +AIYLEE++
Sbjct: 52  VFLDGLPRLNGQFISSPPSRKPDQAGIFPPLIGSVWLLVITAMVSFPLGVGAAIYLEEYA 111

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA---LVGGLILALMTLPS 293
                +  ++ NI NLA+VPSI+YG+LG  V + +   P +     L G L L+L+ LP 
Sbjct: 112 TDNLLTQIIEINIANLAAVPSIIYGLLGLQVFVRWLA-PITNGRSILTGALTLSLLILPI 170

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           II+AT  +LR +P+S+R A   LGA++ Q +  H+ PLA+P ILTG+ ++L+RA+GETAP
Sbjct: 171 IIVATRESLRAIPNSLRQAGYALGATRWQVIREHIFPLALPGILTGTILALSRAIGETAP 230

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           L+ +G ++F+T  P+   D  TA P+Q+Y W +  +  F       I++L+I L V+N  
Sbjct: 231 LITIGALSFITRPPMNPQDPFTALPIQVYNWISRPQEAFHTNAAAGIVMLMIVLLVMNAG 290

Query: 414 MLWLRNRFK 422
            ++LRN+F+
Sbjct: 291 AIFLRNKFQ 299


>gi|228941433|ref|ZP_04103984.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228974364|ref|ZP_04134933.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980957|ref|ZP_04141260.1| ABC transporter permease protein [Bacillus thuringiensis Bt407]
 gi|228778748|gb|EEM27012.1| ABC transporter permease protein [Bacillus thuringiensis Bt407]
 gi|228785414|gb|EEM33424.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818214|gb|EEM64288.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 286

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F + V+ N
Sbjct: 55  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKNIVEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS+
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSA 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLLFINIFVLWLRNR 285


>gi|229169016|ref|ZP_04296732.1| ABC transporter permease protein [Bacillus cereus AH621]
 gi|228614425|gb|EEK71534.1| ABC transporter permease protein [Bacillus cereus AH621]
          Length = 248

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P  AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F   ++ N
Sbjct: 17  FFTNFASRNPREAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKKLIELN 76

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+RTVPSS
Sbjct: 77  NQTLAGVPSVVFGLLGLTIFVYALHLGESI-MAAALTMSLLVLPTVVVASQEAIRTVPSS 135

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A+P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 136 LLEASYGLGATKWQTMYQIVLPVALPGIVTGCTLAVSRAIGEAAPLLVIGALAFANYVPF 195

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 196 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 247


>gi|326204678|ref|ZP_08194534.1| phosphate ABC transporter, inner membrane subunit PstA [Clostridium
           papyrosolvens DSM 2782]
 gi|325985245|gb|EGD46085.1| phosphate ABC transporter, inner membrane subunit PstA [Clostridium
           papyrosolvens DSM 2782]
          Length = 284

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 146/235 (62%), Gaps = 1/235 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N  S  P+ AGI   + GS+Y++++ I  + P+G+ +A+YLEE++    F+ F++ N
Sbjct: 48  FFTNFPSRFPKKAGILPGIYGSVYIIVLTILFAVPIGLGTAVYLEEYAKNNRFTKFIKIN 107

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NL+  PSIVYG+LG  V +    + +S  L G L ++L+ LP +I+++  A++ VP  
Sbjct: 108 ISNLSGTPSIVYGLLGLTVFVKTLGLGKSI-LAGALTMSLVVLPIVIVSSQEAIKAVPQY 166

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R  +  LGA+K QT+   V+P A+P I TG  +S++RALGETAPL+ VG   +V+  P 
Sbjct: 167 LRHGSYALGATKWQTIRKIVIPAALPGIFTGVILSVSRALGETAPLIMVGAATYVSKLPE 226

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           G+  I TA P+QIY W    +  F +     I++LL  L   N   + LRN+++K
Sbjct: 227 GLNSIFTALPMQIYYWMGLPKEQFKDLAAAGIIVLLGILLTTNAIAIVLRNKYQK 281


>gi|229013489|ref|ZP_04170626.1| ABC transporter permease protein [Bacillus mycoides DSM 2048]
 gi|228747901|gb|EEL97767.1| ABC transporter permease protein [Bacillus mycoides DSM 2048]
          Length = 248

 Score =  176 bits (445), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P  AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F   ++ N
Sbjct: 17  FFTNFASRNPREAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKKLIELN 76

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+RTVPSS
Sbjct: 77  NQTLAGVPSVVFGLLGLTIFVYALHLGESI-MAAALTMSLLVLPTVVVASQEAIRTVPSS 135

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A+P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 136 LLEASYGLGATKWQTMYRIVLPVALPGIVTGCTLAVSRAIGEAAPLLVIGALAFANYVPF 195

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 196 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 247


>gi|220929518|ref|YP_002506427.1| phosphate ABC transporter inner membrane subunit PstA [Clostridium
           cellulolyticum H10]
 gi|219999846|gb|ACL76447.1| phosphate ABC transporter, inner membrane subunit PstA [Clostridium
           cellulolyticum H10]
          Length = 284

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/235 (38%), Positives = 146/235 (62%), Gaps = 1/235 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF +  S  P+ AGI   + GS+Y++L+ I  + P+G+ +A+YLEE++    F+ F++ N
Sbjct: 48  FFTSFPSRFPKKAGILPGIYGSVYIILLTILFAVPIGLGTAVYLEEYAKNNRFTKFIKIN 107

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NL+  PSIVYG+LG  V +    + +S  + G L ++L+ LP +I+++  A++ VP  
Sbjct: 108 ISNLSGTPSIVYGLLGLTVFVKTLGLGKSI-VAGALTMSLVVLPIVIVSSQEAIKAVPQY 166

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R  +  LGA+K QT+   V+P A+P I TG  +S++RALGETAPL+ VG   +V+  P 
Sbjct: 167 LRHGSYALGATKWQTIRKIVIPTALPGIFTGVILSVSRALGETAPLIMVGAATYVSKLPE 226

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           G+  I TA P+QIY W    +  F +     I++LL  L   N   + LRN+++K
Sbjct: 227 GLNSIFTALPLQIYYWMGLPKEQFKDLAAAGIIVLLAILLTTNAITIVLRNKYQK 281


>gi|163845862|ref|YP_001633906.1| phosphate ABC transporter inner membrane subunit PstA [Chloroflexus
           aurantiacus J-10-fl]
 gi|222523574|ref|YP_002568044.1| phosphate ABC transporter inner membrane subunit PstA [Chloroflexus
           sp. Y-400-fl]
 gi|163667151|gb|ABY33517.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chloroflexus aurantiacus J-10-fl]
 gi|222447453|gb|ACM51719.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chloroflexus sp. Y-400-fl]
          Length = 311

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/239 (43%), Positives = 156/239 (65%), Gaps = 1/239 (0%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + FF N  S  P+ AG   A+VG+LY + + I  +FPLG+A+AIYLEE++   +FS  V+
Sbjct: 74  WDFFNNFDSRFPQRAGAKAAIVGTLYTISLTILFAFPLGVAAAIYLEEYARDNWFSRLVE 133

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVP 306
            NI+NLA+VPSI+YG+LG  V   +  + RS      L LAL+ +P II+A+  ++R VP
Sbjct: 134 INISNLAAVPSIIYGLLGLQVFARWLLLGRSILTGA-LTLALLVVPIIIVASRESIRAVP 192

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            S+R A+  LGA++ QTV+H VLP ++  ILTGS ++++RA+GETAPL+ +G + FV   
Sbjct: 193 LSLRQASYALGATRWQTVWHVVLPQSIGGILTGSILAVSRAIGETAPLITIGALTFVPFL 252

Query: 367 PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           P  + DI T  P+QI+ W +  +  F       IL+LL  L  IN   ++LRNR++KR+
Sbjct: 253 PRNILDIFTVLPIQIFNWTSRPQDEFRALAAAGILVLLTILLTINALAIYLRNRYQKRY 311


>gi|298674022|ref|YP_003725772.1| phosphate ABC transporter inner membrane subunit PstA
           [Methanohalobium evestigatum Z-7303]
 gi|298287010|gb|ADI72976.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methanohalobium evestigatum Z-7303]
          Length = 283

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/240 (43%), Positives = 158/240 (65%), Gaps = 2/240 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           F+  F  N  S  PE AGI  A++GS+Y+ML+V   SFPLG+ +AIYLEE++ +    + 
Sbjct: 45  FDLAFIFNSPSRFPEEAGIYPALIGSIYLMLLVAVFSFPLGVGTAIYLEEYAGQSRIKNI 104

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI+NLA+VPSIVYG+LG A+ +    M RS  + G L L L+ LP +I+++  A++ 
Sbjct: 105 IELNISNLAAVPSIVYGLLGLALFVRALNMGRSL-IAGALTLTLLILPIVIVSSQEAIKA 163

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S+R A+ G+GA+K QT+   V+P A+P I+TG+ +SL+RA+GETAPL+ +G    + 
Sbjct: 164 VPDSLRDASYGIGATKWQTIRKIVIPEALPGIMTGTILSLSRAIGETAPLIMIGAATSMY 223

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA-ILLLLIFLAVINTAMLWLRNRFKK 423
             P G+  + +A P+QIY W    +  F E    A ILLLLI L  +N+  + +RNRF++
Sbjct: 224 SAPDGIFSLFSAMPLQIYAWVGQPQYAFQEGVASAGILLLLIVLLTMNSVAILIRNRFQR 283


>gi|228954553|ref|ZP_04116578.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229081528|ref|ZP_04214027.1| ABC transporter permease protein [Bacillus cereus Rock4-2]
 gi|228701835|gb|EEL54322.1| ABC transporter permease protein [Bacillus cereus Rock4-2]
 gi|228805210|gb|EEM51804.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 286

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 149/247 (60%), Gaps = 3/247 (1%)

Query: 174 KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
           ++   G  +L  N  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE
Sbjct: 42  QIVEKGISYLSIN--FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLE 99

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           +++ +  F   ++ N   LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP+
Sbjct: 100 QYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPT 158

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE AP
Sbjct: 159 VVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAP 218

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           LL +G +AF    P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  
Sbjct: 219 LLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIF 278

Query: 414 MLWLRNR 420
           +LWLRNR
Sbjct: 279 VLWLRNR 285


>gi|163942029|ref|YP_001646913.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           weihenstephanensis KBAB4]
 gi|163864226|gb|ABY45285.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           weihenstephanensis KBAB4]
          Length = 288

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 144/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P  AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F   ++ N
Sbjct: 57  FFTNFASRNPREAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKKLIELN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+RTVPS 
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRTVPSL 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A+P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYQIVLPVALPGIVTGCTLAVSRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|320162175|ref|YP_004175400.1| phosphate ABC transporter permease protein [Anaerolinea thermophila
           UNI-1]
 gi|319996029|dbj|BAJ64800.1| phosphate ABC transporter permease protein [Anaerolinea thermophila
           UNI-1]
          Length = 409

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 108/253 (42%), Positives = 154/253 (60%), Gaps = 13/253 (5%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK-GFFSS 243
            ++ F     ++ P++AG+  A+ GSL ++LI I  +FP+G+ +AIYLEE++ K    + 
Sbjct: 156 LSWDFLQRSMATNPDLAGVRQAIKGSLLIILITILFAFPIGVGAAIYLEEYADKRNRINR 215

Query: 244 FVQANINNLASVPSIVYGILGSAVLINF---------FKMPRS---TALVGGLILALMTL 291
            +Q NI NLA VPSI+YGILG AV +           F M      T L GGL +AL+ L
Sbjct: 216 ILQTNIENLAGVPSIIYGILGLAVFVRALAPITSGAAFGMDAGSGRTILSGGLTMALLVL 275

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +II++  ALR VP+S+R A+  +GA++ QT++HHVLP A+P ILTG+ ++++RALGET
Sbjct: 276 PILIISSQEALRAVPNSLREASFAMGATRWQTIWHHVLPYALPGILTGTILAVSRALGET 335

Query: 352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           APL+ VG  + +   P  V    TA P QIY W    +  F      AIL+LL  L  +N
Sbjct: 336 APLILVGASSLINKDPQSVFSFFTALPFQIYNWTVRPQPEFRNIAAAAILVLLAVLLSLN 395

Query: 412 TAMLWLRNRFKKR 424
              + LRNR  KR
Sbjct: 396 ATAIVLRNRLSKR 408


>gi|75759759|ref|ZP_00739838.1| Phosphate transport system permease protein pstA [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218899436|ref|YP_002447847.1| phosphate ABC transporter, permease protein [Bacillus cereus G9842]
 gi|74492757|gb|EAO55894.1| Phosphate transport system permease protein pstA [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218543509|gb|ACK95903.1| phosphate ABC transporter, permease protein [Bacillus cereus G9842]
          Length = 288

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 143/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   V+ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKKIVEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|229146855|ref|ZP_04275220.1| ABC transporter permease protein [Bacillus cereus BDRD-ST24]
 gi|228636683|gb|EEK93148.1| ABC transporter permease protein [Bacillus cereus BDRD-ST24]
          Length = 276

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 144/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 45  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKIIEIN 104

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 105 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 163

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AFV   P 
Sbjct: 164 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFVNYVPF 223

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 224 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 275


>gi|228910103|ref|ZP_04073923.1| ABC transporter permease protein [Bacillus thuringiensis IBL 200]
 gi|228849620|gb|EEM94454.1| ABC transporter permease protein [Bacillus thuringiensis IBL 200]
          Length = 286

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 143/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   V+ N
Sbjct: 55  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKKIVEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 285


>gi|218295961|ref|ZP_03496741.1| phosphate ABC transporter, inner membrane subunit PstA [Thermus
           aquaticus Y51MC23]
 gi|218243699|gb|EED10227.1| phosphate ABC transporter, inner membrane subunit PstA [Thermus
           aquaticus Y51MC23]
          Length = 401

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 143/237 (60%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F     S  P +AGIGVAV G+++++ + + ++ P+G+ +AI LEE+  +G  +  ++ N
Sbjct: 166 FLTRFPSRNPLIAGIGVAVAGTVWVLTLALLIAIPVGVGTAILLEEYLREGRLNRILEVN 225

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + NLA VPSIVYG+LG A  +    +   T L   L LAL+ +P I +    ALR VP S
Sbjct: 226 LRNLAGVPSIVYGLLGLAFFVREMGL-GPTVLAAALTLALLGIPVITVTAREALRAVPES 284

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
            R AA  LGA++ Q VF  VLP A+P ++TG  +S AR +GE APLL VG  A+V  YP 
Sbjct: 285 QRQAAFALGATRRQVVFRVVLPAALPGVVTGVILSAARLIGEAAPLLLVGAAAYVPFYPS 344

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           G     T  PVQIYLW +  +  F       IL++L+ L+ +  A L+LRNRF++ W
Sbjct: 345 GPLSEYTVIPVQIYLWVSQPQPEFARVAAAGILVMLLVLSGLYLAALYLRNRFRREW 401


>gi|229111743|ref|ZP_04241291.1| ABC transporter permease protein [Bacillus cereus Rock1-15]
 gi|229152470|ref|ZP_04280662.1| ABC transporter permease protein [Bacillus cereus m1550]
 gi|229180547|ref|ZP_04307889.1| ABC transporter permease protein [Bacillus cereus 172560W]
 gi|228602971|gb|EEK60450.1| ABC transporter permease protein [Bacillus cereus 172560W]
 gi|228631078|gb|EEK87715.1| ABC transporter permease protein [Bacillus cereus m1550]
 gi|228671737|gb|EEL27033.1| ABC transporter permease protein [Bacillus cereus Rock1-15]
          Length = 286

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 143/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 55  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKKIIEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 285


>gi|206971288|ref|ZP_03232239.1| phosphate ABC transporter, permease protein [Bacillus cereus
           AH1134]
 gi|218235298|ref|YP_002369077.1| phosphate ABC transporter, permease protein [Bacillus cereus B4264]
 gi|229047987|ref|ZP_04193563.1| ABC transporter permease protein [Bacillus cereus AH676]
 gi|206734060|gb|EDZ51231.1| phosphate ABC transporter, permease protein [Bacillus cereus
           AH1134]
 gi|218163255|gb|ACK63247.1| phosphate ABC transporter, permease protein [Bacillus cereus B4264]
 gi|228723444|gb|EEL74813.1| ABC transporter permease protein [Bacillus cereus AH676]
          Length = 288

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 143/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKKIIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|229129548|ref|ZP_04258519.1| ABC transporter permease protein [Bacillus cereus BDRD-Cer4]
 gi|296504766|ref|YP_003666466.1| phosphate ABC transporter permease [Bacillus thuringiensis BMB171]
 gi|228654153|gb|EEL10020.1| ABC transporter permease protein [Bacillus cereus BDRD-Cer4]
 gi|296325818|gb|ADH08746.1| phosphate ABC transporter permease [Bacillus thuringiensis BMB171]
          Length = 288

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 143/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKIIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|311743234|ref|ZP_07717041.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Aeromicrobium marinum DSM 15272]
 gi|311313302|gb|EFQ83212.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Aeromicrobium marinum DSM 15272]
          Length = 301

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 159/251 (63%), Gaps = 13/251 (5%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS- 236
           DGAL  ++    F       PE AG   A++GS +++     L+ PLGIA+ +YLEEF+ 
Sbjct: 61  DGALLTNYTSQVF-------PETAGARAAILGSAWVISTTALLAIPLGIAAGVYLEEFAD 113

Query: 237 HKGFFSSFVQANINNLASVPSIVYGIL--GSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++ +++ F++ NI+NLA+VP+IVYG+L  G A+ I    M R   L GG+ LAL+ LP I
Sbjct: 114 NRKWWNKFIETNISNLAAVPAIVYGMLTAGFALAIG---MERRIVLAGGIALALLILPVI 170

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           II+T  ALR VP  IR  ++ LGA+ +QTV+   LP A+P I TGS ++L+RALGE APL
Sbjct: 171 IISTREALRAVPQEIRQGSIALGATPLQTVWRQTLPSAVPGIATGSILALSRALGEAAPL 230

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           L +G + FVT  P G+    T  P+QI+ WA   +  F +    AI+L+L  L ++N   
Sbjct: 231 LLLGGLVFVTYDPNGLFSGFTTLPIQIFNWAGQPQLEFQQVASAAIILMLGLLLIMNALA 290

Query: 415 LWLRNRFKKRW 425
           +++RNRF+ RW
Sbjct: 291 IFIRNRFQNRW 301


>gi|228987518|ref|ZP_04147637.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228772250|gb|EEM20697.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 286

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 55  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPSS 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 285


>gi|229135093|ref|ZP_04263896.1| ABC transporter permease protein [Bacillus cereus BDRD-ST196]
 gi|228648381|gb|EEL04413.1| ABC transporter permease protein [Bacillus cereus BDRD-ST196]
          Length = 248

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 144/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF   AS  P  AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F   ++ N
Sbjct: 17  FFTKFASRNPREAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKKLIELN 76

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+RTVPSS
Sbjct: 77  NQTLAGVPSVVFGLLGLTIFVYALHLGESI-MAAALTMSLLVLPTVVVASQEAIRTVPSS 135

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP+A+P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 136 LLEASYGLGATKWQTMYQIVLPVALPGIVTGCTLAVSRAIGEAAPLLVIGALAFANYVPF 195

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 196 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 247


>gi|30022350|ref|NP_833981.1| phosphate ABC transporter permease [Bacillus cereus ATCC 14579]
 gi|29897907|gb|AAP11182.1| Phosphate transport system permease protein pstA [Bacillus cereus
           ATCC 14579]
          Length = 285

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 143/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 54  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKIIEIN 113

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 114 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 172

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 173 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 232

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 233 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 284


>gi|228902784|ref|ZP_04066930.1| ABC transporter permease protein [Bacillus thuringiensis IBL 4222]
 gi|228856858|gb|EEN01372.1| ABC transporter permease protein [Bacillus thuringiensis IBL 4222]
          Length = 276

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 143/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   V+ N
Sbjct: 45  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKKIVEIN 104

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 105 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 163

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 164 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 223

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 224 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 275


>gi|47567832|ref|ZP_00238540.1| phosphate transport system permease protein pstA [Bacillus cereus
           G9241]
 gi|47555509|gb|EAL13852.1| phosphate transport system permease protein pstA [Bacillus cereus
           G9241]
          Length = 288

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPSS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 287


>gi|222151443|ref|YP_002560599.1| ABC-type phosphate transport system permease component PstA
           [Macrococcus caseolyticus JCSC5402]
 gi|222120568|dbj|BAH17903.1| ABC-type phosphate transport system permease component PstA
           [Macrococcus caseolyticus JCSC5402]
          Length = 297

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 162/244 (66%), Gaps = 10/244 (4%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +S+ P  AGI  A++G+L++M+ +  ++  LG+A+AIY+EE++   FF+ FV+ N
Sbjct: 57  FFTNFSSTTPSKAGIKGALIGTLWLMMTIAPIAITLGVATAIYMEEYAKDNFFTRFVKVN 116

Query: 249 INNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           I NLASVPS+V+G+LG  +      I    + +S  L   L ++LM LP II+++  A+R
Sbjct: 117 IANLASVPSVVFGLLGLTLFVRGGGIEALSLGKSV-LAAALTMSLMILPVIIVSSQEAIR 175

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP++IR A+LGLG +K QT+ + VLP ++P ILTG+ ++L+RA+GETAPL+ +G+    
Sbjct: 176 AVPNAIREASLGLGGTKWQTITNVVLPASIPGILTGTILALSRAIGETAPLVVIGIPTIF 235

Query: 364 TDYPVGVTDIATAFPVQIYLWAA--DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P+QI+ WA    AE  FV     AI++LLI L  +N+  +++RN++
Sbjct: 236 MKTPDNIMDRFQALPMQIFTWAKLPKAEFQFVSSA--AIIVLLIILIAMNSIAIFIRNKY 293

Query: 422 KKRW 425
           +K++
Sbjct: 294 QKKF 297


>gi|229192479|ref|ZP_04319442.1| ABC transporter permease protein [Bacillus cereus ATCC 10876]
 gi|228591056|gb|EEK48912.1| ABC transporter permease protein [Bacillus cereus ATCC 10876]
          Length = 286

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 149/247 (60%), Gaps = 3/247 (1%)

Query: 174 KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
           ++   G  +L  N  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE
Sbjct: 42  QIVEKGISYLSIN--FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLE 99

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           +++ +  F   ++ N   LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP+
Sbjct: 100 QYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPT 158

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T+++++A+GE AP
Sbjct: 159 VVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISKAIGEAAP 218

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           LL +G +AF    P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  
Sbjct: 219 LLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIF 278

Query: 414 MLWLRNR 420
           +LWLRNR
Sbjct: 279 VLWLRNR 285


>gi|145592854|ref|YP_001157151.1| phosphate ABC transporter, inner membrane subunit PstA [Salinispora
           tropica CNB-440]
 gi|145302191|gb|ABP52773.1| phosphate ABC transporter, inner membrane subunit PstA [Salinispora
           tropica CNB-440]
          Length = 306

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 164/257 (63%), Gaps = 9/257 (3%)

Query: 170 KWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
           K + +LDS   L+ +   G       SR + AG+  A+VG+L+++ +V  +  P+GI SA
Sbjct: 58  KGWNRLDSR--LWTEMPTGLV-----SRLDSAGVQSALVGTLWIISLVAVICLPIGILSA 110

Query: 230 IYLEEFS-HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           IYLEE++ +  +++  ++ NI NLA VPSI++GILG  ++     +   T +   ++L+L
Sbjct: 111 IYLEEYADNTRWYNRLLELNIQNLAGVPSIIFGILGLGIIARALGLG-FTVITAAIVLSL 169

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP +IIAT  A+R VP SIR A+  LGA+K QTV   VLP A+P I TGS ++L+RA+
Sbjct: 170 LVLPVVIIATREAIRAVPQSIRHASYALGATKWQTVSRQVLPSAVPGIATGSILALSRAI 229

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           GE APL+ +G V F+T  P G+    TA P+QIY +   ++  + E   GAI+LLL  + 
Sbjct: 230 GEAAPLIVLGAVTFITFNPDGLDSGYTALPIQIYTFITRSQSEYTELAAGAIVLLLAIVL 289

Query: 409 VINTAMLWLRNRFKKRW 425
            +N+  +++RNRF+KRW
Sbjct: 290 AMNSIAIFVRNRFEKRW 306


>gi|229006612|ref|ZP_04164247.1| ABC transporter permease protein [Bacillus mycoides Rock1-4]
 gi|228754661|gb|EEM04071.1| ABC transporter permease protein [Bacillus mycoides Rock1-4]
          Length = 288

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 149/232 (64%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF+N AS  P+ AGI  A+ G++  M IV+ +SF  G+ +A+YLE ++ +  F+  V+ N
Sbjct: 57  FFMNFASRNPKQAGIAAALSGTIVFMSIVVPVSFIFGVGTALYLEHYARQSVFTRIVELN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I  LA VPS+V+G+LG  + +   ++  S  +     ++L+ LP++++++  A+R VPSS
Sbjct: 117 IQTLAGVPSVVFGLLGLTIFVYGLQLGESI-VTAAFTMSLLVLPTVVVSSQEAIRMVPSS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ G+GA+K QT++  V+P A+P ILTG  ++L+RA+GE APLL +G +AF    P+
Sbjct: 176 LLEASYGVGATKWQTMYQIVVPTALPGILTGCVLALSRAIGEAAPLLIIGALAFANYIPL 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F   +   +++LL  L +IN  +LWLRNR
Sbjct: 236 NMFDRFTVLPIQIFNWMSRPQEEFQHVSAAGMIVLLGLLLIINVVVLWLRNR 287


>gi|159036000|ref|YP_001535253.1| phosphate ABC transporter, inner membrane subunit PstA [Salinispora
           arenicola CNS-205]
 gi|157914835|gb|ABV96262.1| phosphate ABC transporter, inner membrane subunit PstA [Salinispora
           arenicola CNS-205]
          Length = 307

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 164/257 (63%), Gaps = 9/257 (3%)

Query: 170 KWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
           K + +LDS   L+ +   G       SR + AG+  A+VG+L+++ +V  +  P+GI SA
Sbjct: 59  KGWNRLDSR--LWTEMPTGLV-----SRLDTAGVQSALVGTLWIISLVAVICLPIGILSA 111

Query: 230 IYLEEFS-HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           IYLEE++ +  +++  ++ NI NLA VPSI++GILG  ++     +   T +   ++L+L
Sbjct: 112 IYLEEYADNTRWYNRLLELNIQNLAGVPSIIFGILGLGIIARALGLG-FTVITAAIVLSL 170

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP +IIAT  A+R VP SIR A+  LGA+K QTV   VLP A+P I TGS ++L+RA+
Sbjct: 171 LVLPVVIIATREAIRAVPQSIRHASYALGATKWQTVSRQVLPSAVPGIATGSILALSRAI 230

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           GE APL+ +G V F+T  P G+    TA P+QIY +   ++  + E   GAI+LLL  + 
Sbjct: 231 GEAAPLIVLGAVTFITFNPDGLDSGYTALPIQIYTFITRSQSEYTELAAGAIVLLLAIVL 290

Query: 409 VINTAMLWLRNRFKKRW 425
            +N+  +++RNRF+KRW
Sbjct: 291 AMNSIAIFVRNRFEKRW 307


>gi|228960535|ref|ZP_04122184.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228799135|gb|EEM46103.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 276

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 143/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 45  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKKIIEIN 104

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 105 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 163

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 164 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 223

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 224 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 275


>gi|49481279|ref|YP_038329.1| phosphate ABC transporter permease [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52141228|ref|YP_085600.1| phosphate ABC transporter, permease [Bacillus cereus E33L]
 gi|49332835|gb|AAT63481.1| phosphate ABC transporter, permease [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51974697|gb|AAU16247.1| phosphate ABC transporter, permease [Bacillus cereus E33L]
          Length = 288

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VP+S
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPNS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 287


>gi|228999064|ref|ZP_04158646.1| ABC transporter permease protein [Bacillus mycoides Rock3-17]
 gi|228760681|gb|EEM09645.1| ABC transporter permease protein [Bacillus mycoides Rock3-17]
          Length = 288

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 148/232 (63%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF+N AS  P+ AGI  A+ G++  M IV+ +SF  G+ +A+YLE ++ +  F+  V+ N
Sbjct: 57  FFMNFASRNPKQAGIAAALSGTIVFMSIVVPVSFIFGVGTALYLEHYARQSVFTRIVELN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I  LA VPS+V+G+LG  + +   ++  S  +     ++L+ LP++++++  A+R VPSS
Sbjct: 117 IQTLAGVPSVVFGLLGLTIFVYGLQLGESI-VTAAFTMSLLVLPTVVVSSQEAIRMVPSS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ G+GA+K QT++  V+P A+P ILTG  ++L+RA+GE APLL +G +AF    P+
Sbjct: 176 LLEASYGVGATKWQTMYQIVVPTALPGILTGCVLALSRAIGEAAPLLIIGALAFANYIPL 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 NMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLLIINVVVLWLRNR 287


>gi|228993014|ref|ZP_04152937.1| ABC transporter permease protein [Bacillus pseudomycoides DSM
           12442]
 gi|228766662|gb|EEM15302.1| ABC transporter permease protein [Bacillus pseudomycoides DSM
           12442]
          Length = 288

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 148/232 (63%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF+N AS  P+ AGI  A+ G++  M IV+ +SF  G+ +A+YLE ++ +  F+  V+ N
Sbjct: 57  FFMNFASRNPKQAGIAAALSGTIVFMSIVVPVSFIFGVGTALYLEHYARQSVFTRIVELN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I  LA VPS+V+G+LG  + +   ++  S  +     ++L+ LP++++++  A+R VPSS
Sbjct: 117 IQTLAGVPSVVFGLLGLTIFVYGLQLGESI-VTAAFTMSLLVLPTVVVSSQEAIRMVPSS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ G+GA+K QT++  V+P A+P ILTG  ++L+RA+GE APLL +G +AF    P+
Sbjct: 176 LLEASYGVGATKWQTMYQIVVPTALPGILTGCVLALSRAIGEAAPLLVIGALAFANYIPL 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 NMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLLIINVVVLWLRNR 287


>gi|228947983|ref|ZP_04110269.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228811673|gb|EEM58008.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 286

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 55  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VP+S
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPNS 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 285


>gi|118479443|ref|YP_896594.1| phosphate ABC transporter permease [Bacillus thuringiensis str. Al
           Hakam]
 gi|196034910|ref|ZP_03102317.1| phosphate ABC transporter, permease protein [Bacillus cereus W]
 gi|196041613|ref|ZP_03108905.1| phosphate ABC transporter, permease protein [Bacillus cereus
           NVH0597-99]
 gi|196046335|ref|ZP_03113561.1| phosphate ABC transporter, permease protein [Bacillus cereus
           03BB108]
 gi|218905406|ref|YP_002453240.1| phosphate ABC transporter, permease protein [Bacillus cereus AH820]
 gi|225866252|ref|YP_002751630.1| phosphate ABC transporter, permease protein [Bacillus cereus
           03BB102]
 gi|301055764|ref|YP_003793975.1| phosphate ABC transporter permease [Bacillus anthracis CI]
 gi|118418668|gb|ABK87087.1| phosphate ABC transporter membrane protein 2, PhoT family [Bacillus
           thuringiensis str. Al Hakam]
 gi|195992449|gb|EDX56410.1| phosphate ABC transporter, permease protein [Bacillus cereus W]
 gi|196022805|gb|EDX61486.1| phosphate ABC transporter, permease protein [Bacillus cereus
           03BB108]
 gi|196027601|gb|EDX66216.1| phosphate ABC transporter, permease protein [Bacillus cereus
           NVH0597-99]
 gi|218537517|gb|ACK89915.1| phosphate ABC transporter, permease protein [Bacillus cereus AH820]
 gi|225789101|gb|ACO29318.1| phosphate ABC transporter, permease protein [Bacillus cereus
           03BB102]
 gi|300377933|gb|ADK06837.1| phosphate ABC transporter, permease [Bacillus cereus biovar
           anthracis str. CI]
          Length = 288

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VP+S
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPNS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+Q++ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQVFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 287


>gi|228916903|ref|ZP_04080465.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228929314|ref|ZP_04092339.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935590|ref|ZP_04098406.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|229093339|ref|ZP_04224448.1| ABC transporter permease protein [Bacillus cereus Rock3-42]
 gi|229123808|ref|ZP_04253002.1| ABC transporter permease protein [Bacillus cereus 95/8201]
 gi|229186511|ref|ZP_04313673.1| ABC transporter permease protein [Bacillus cereus BGSC 6E1]
 gi|228596942|gb|EEK54600.1| ABC transporter permease protein [Bacillus cereus BGSC 6E1]
 gi|228659629|gb|EEL15275.1| ABC transporter permease protein [Bacillus cereus 95/8201]
 gi|228690063|gb|EEL43862.1| ABC transporter permease protein [Bacillus cereus Rock3-42]
 gi|228824128|gb|EEM69944.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830328|gb|EEM75940.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228842727|gb|EEM87813.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 286

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 55  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VP+S
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPNS 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+Q++ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQVFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 285


>gi|229071772|ref|ZP_04204987.1| ABC transporter permease protein [Bacillus cereus F65185]
 gi|228711367|gb|EEL63327.1| ABC transporter permease protein [Bacillus cereus F65185]
          Length = 286

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 148/247 (59%), Gaps = 3/247 (1%)

Query: 174 KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
           ++   G  +L  N  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE
Sbjct: 42  QIVEKGISYLSIN--FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLE 99

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           +++ +  F   ++ N   LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP+
Sbjct: 100 QYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPT 158

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +++A+  A+R+VPS +   + GLGA+K QT++  VLP A   I+TG T++++RA+GE AP
Sbjct: 159 VVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFSGIITGCTLAISRAIGEAAP 218

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           LL +G +AF    P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  
Sbjct: 219 LLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIF 278

Query: 414 MLWLRNR 420
           +LWLRNR
Sbjct: 279 VLWLRNR 285


>gi|228923021|ref|ZP_04086314.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836654|gb|EEM82002.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 288

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 142/232 (61%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   +  N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKKIIVIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPKEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287


>gi|30264342|ref|NP_846719.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. Ames]
 gi|47529789|ref|YP_021138.1| phosphate ABC transporter permease [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49187169|ref|YP_030421.1| phosphate ABC transporter permease [Bacillus anthracis str. Sterne]
 gi|65321647|ref|ZP_00394606.1| COG0581: ABC-type phosphate transport system, permease component
           [Bacillus anthracis str. A2012]
 gi|165872041|ref|ZP_02216681.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0488]
 gi|167634660|ref|ZP_02392980.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0442]
 gi|167638514|ref|ZP_02396790.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0193]
 gi|170687348|ref|ZP_02878565.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0465]
 gi|170707450|ref|ZP_02897904.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0389]
 gi|177655054|ref|ZP_02936720.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0174]
 gi|190566042|ref|ZP_03018961.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|227817046|ref|YP_002817055.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. CDC 684]
 gi|229600784|ref|YP_002868560.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0248]
 gi|254684029|ref|ZP_05147889.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. CNEVA-9066]
 gi|254736378|ref|ZP_05194084.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. Western North America USA6153]
 gi|254741415|ref|ZP_05199102.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. Kruger B]
 gi|254753948|ref|ZP_05205983.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. Vollum]
 gi|254757820|ref|ZP_05209847.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. Australia 94]
 gi|30258987|gb|AAP28205.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. Ames]
 gi|47504937|gb|AAT33613.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49181096|gb|AAT56472.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. Sterne]
 gi|164712172|gb|EDR17709.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0488]
 gi|167513362|gb|EDR88732.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0193]
 gi|167530112|gb|EDR92847.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0442]
 gi|170127694|gb|EDS96567.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0389]
 gi|170668543|gb|EDT19289.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0465]
 gi|172080315|gb|EDT65404.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0174]
 gi|190562961|gb|EDV16927.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|227006489|gb|ACP16232.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. CDC 684]
 gi|229265192|gb|ACQ46829.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A0248]
          Length = 288

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VP+S
Sbjct: 117 NQTLAGVPSVVFGLLGLTLFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPNS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+Q++ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQVFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 287


>gi|284045942|ref|YP_003396282.1| phosphate ABC transporter inner membrane subunit PstA [Conexibacter
           woesei DSM 14684]
 gi|283950163|gb|ADB52907.1| phosphate ABC transporter, inner membrane subunit PstA
           [Conexibacter woesei DSM 14684]
          Length = 312

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 152/236 (64%), Gaps = 8/236 (3%)

Query: 195 SSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FFSSFVQANINNLA 253
           S+ P  AG   A+VG+LY++  V+ L  P+GI +A+YLEE++ K  +++  ++ NI NLA
Sbjct: 80  SAIPSRAGFRPAIVGTLYLIAGVVFLVVPIGIGAAVYLEEYADKTRWWNRLIELNIQNLA 139

Query: 254 SVPSIVYGILGSAVLINFFKMPRSTALV---GGLILALMTLPSIIIATGVALRTVPSSIR 310
            VPSI+YGILG A ++   + P +   +   G L LAL+ LP++I+A+  A+R VP SIR
Sbjct: 140 GVPSIIYGILGLAFIV---RGPLNLGFILAAGSLTLALLVLPTVILASREAIRAVPPSIR 196

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
             +L LGA++ QT+   VLP ++P I+TG  ++++RA+GETAPLL VG   FVT  P   
Sbjct: 197 EGSLALGATQWQTIRRQVLPASIPGIITGVILAISRAIGETAPLLLVGAATFVTFNPSFF 256

Query: 371 T-DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           + D  TA PV I+ +A   +  F       ++++L+ L  +N   +WLRNR++++W
Sbjct: 257 SNDGYTALPVLIFNYATRPQDEFRVLASAGVIVMLVVLLAMNAFAVWLRNRYERQW 312


>gi|254721863|ref|ZP_05183652.1| phosphate ABC transporter, permease protein [Bacillus anthracis
           str. A1055]
          Length = 288

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 146/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   + ++L+ LP++++A+  A+R+VP+S
Sbjct: 117 NQTLAGVPSVVFGLLGLTLFVYALHLGESI-IAAAMTMSLLVLPTVVVASQEAIRSVPNS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+Q++ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQVFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 287


>gi|309790670|ref|ZP_07685221.1| phosphate ABC transporter, inner membrane subunit PstA
           [Oscillochloris trichoides DG6]
 gi|308227264|gb|EFO80941.1| phosphate ABC transporter, inner membrane subunit PstA
           [Oscillochloris trichoides DG6]
          Length = 440

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 143/238 (60%), Gaps = 35/238 (14%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF------- 241
           F  +  SSRPE+AG+  AV+GSL+++LI +  +FPLGI +A+YLEE++    F       
Sbjct: 170 FLTSPMSSRPELAGVRTAVMGSLWLLLITVLFAFPLGIGAALYLEEYATDKLFDERSPVG 229

Query: 242 ----------SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVG--------- 282
                     SS +Q NI NL+ VPSI+YG+LG A+ +   +   S + +G         
Sbjct: 230 RRLNAILHRGSSIIQTNIYNLSGVPSIIYGMLGLAIFVRALESFTSGSFLGATTDATANG 289

Query: 283 ------GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAI 336
                 G+ +AL+ LP +II++  A+R VP+S+R A+ GLGA++ QT++  VLP A+P I
Sbjct: 290 RTIMAAGMTMALLVLPVVIISSQEAIRAVPNSLRQASYGLGATRWQTIWKVVLPNALPGI 349

Query: 337 LTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
           LTG+ ++++RA+GETAPL+ VG   F+   P G     T  P+QIY W +   RP VE
Sbjct: 350 LTGTILAISRAIGETAPLIVVGASTFIVTDPSGPFSKFTVLPIQIYNWTS---RPQVE 404


>gi|229157882|ref|ZP_04285957.1| ABC transporter permease protein [Bacillus cereus ATCC 4342]
 gi|228625839|gb|EEK82591.1| ABC transporter permease protein [Bacillus cereus ATCC 4342]
          Length = 286

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF + AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++    F   ++ N
Sbjct: 55  FFTSFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKGSIFKKVIEIN 114

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPSS
Sbjct: 115 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPSS 173

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 174 LLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 233

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 234 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIFVLWLRNR 285


>gi|300710210|ref|YP_003736024.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halalkalicoccus jeotgali B3]
 gi|299123893|gb|ADJ14232.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halalkalicoccus jeotgali B3]
          Length = 295

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 155/246 (63%), Gaps = 3/246 (1%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           D   +LD    F  +     PE AGI  A+VGS+ +M+++  ++FPLG+ +A+YLEE++ 
Sbjct: 48  DAVGWLDLQ--FLTSPPHPLPEEAGIFPALVGSIVLMVLIALITFPLGVGAAVYLEEYAS 105

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
            G  + F+Q NI NLA VPS+VYG+LG  + +        T LV G  ++L+ LP +II+
Sbjct: 106 DGRLTQFIQLNIANLAGVPSVVYGLLGLGLFVQLINFGYGTLLVAGFTVSLLILPIVIIS 165

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
              A+R+VP S+R A+ G+GA+K QT+ + VLP ++P I+TG+ ++L RA+GETAPL+ +
Sbjct: 166 AQEAIRSVPDSLREASYGMGATKRQTIRNVVLPRSLPGIMTGTILALGRAIGETAPLIMI 225

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA-ILLLLIFLAVINTAMLW 416
           G+   V   P G+    +A P+QIY W++  +  F      A ++ LL+ L  IN+  + 
Sbjct: 226 GVPTTVFGVPNGLFAKFSAMPMQIYTWSSYPDTAFQYGVVSAGVVTLLVVLLSINSIAIL 285

Query: 417 LRNRFK 422
           +RN+++
Sbjct: 286 IRNKYQ 291


>gi|328950120|ref|YP_004367455.1| phosphate ABC transporter, inner membrane subunit PstA
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450444|gb|AEB11345.1| phosphate ABC transporter, inner membrane subunit PstA
           [Marinithermus hydrothermalis DSM 14884]
          Length = 407

 Score =  169 bits (429), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 152/244 (62%), Gaps = 3/244 (1%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           +LD +  FF   AS  P +AGI  A+VG+L++M +   +S P+G+ +AIYLEE++    +
Sbjct: 167 WLDLS--FFFRDASRTPLMAGIRAALVGTLWVMALTALISIPVGVGAAIYLEEYAPDNRW 224

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ N+ NLA VPSIVYG+LG ++ +  + +  S       +  L+ +P I+IA+  A
Sbjct: 225 TRLIEVNLRNLAGVPSIVYGVLGLSLFVRAWGLGPSVLSAALTLSLLI-MPVIVIASREA 283

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R VP+S+R AA GLGA++ Q V   VLP A+P I+TG  +S+ARA+GETAPLL VG  A
Sbjct: 284 IRAVPNSLRQAAYGLGATRWQVVSRVVLPSAVPGIVTGVILSVARAIGETAPLLLVGAAA 343

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           FV   P G     T  PVQIY W  + +  F       IL+LL  LAV+ +A  ++R RF
Sbjct: 344 FVPFLPSGPLSEYTVIPVQIYSWVTENDPEFAHVASAGILVLLAVLAVLYSAAFYVRRRF 403

Query: 422 KKRW 425
            ++W
Sbjct: 404 GRKW 407


>gi|307718242|ref|YP_003873774.1| transporter [Spirochaeta thermophila DSM 6192]
 gi|306531967|gb|ADN01501.1| transporter [Spirochaeta thermophila DSM 6192]
          Length = 300

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 154/252 (61%), Gaps = 6/252 (2%)

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           SD   +LD+   F  +  S  PE AG+G  + GS Y++++V  + FP G+ +AIYLEE++
Sbjct: 52  SDAIGWLDWQ--FLTSPPSRFPEKAGVGPVLAGSFYLIVLVGVMVFPFGVGAAIYLEEYA 109

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            +G  +  ++ NI NLA VPSIVYG+LG  V +    +P    LV GL L L  LP +I+
Sbjct: 110 REGRLTRLIETNIANLAGVPSIVYGLLGLGVFVGVMHLPIGCLLVAGLTLMLRVLPIVIV 169

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +   A+R VP S R A+LG+G ++ Q +   VLP A P I+TG  ++LA A+GETAPL+ 
Sbjct: 170 SAQEAIRAVPDSHRFASLGMGTTRWQMITSVVLPEAFPGIMTGIILALANAMGETAPLIM 229

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF--GAILLLLIFLAVINTAM 414
           VG+   +   P G+     A P+QI+ W +D  +P  +      AI++LL+ L ++N   
Sbjct: 230 VGVAHSIFTPPRGLLSAFGALPLQIFAW-SDYPKPEFQHGVVPAAIVVLLVTLMLLNGIA 288

Query: 415 LWLRNRF-KKRW 425
           ++LR+RF K+RW
Sbjct: 289 VYLRHRFSKRRW 300


>gi|22299709|ref|NP_682956.1| permease protein of phosphate ABC transporter [Thermosynechococcus
           elongatus BP-1]
 gi|22295893|dbj|BAC09718.1| permease protein of phosphate ABC transporter [Thermosynechococcus
           elongatus BP-1]
          Length = 309

 Score =  169 bits (427), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 145/251 (57%), Gaps = 14/251 (5%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ FF +  S  P  AGI  A VGSL ++L+ I ++ PLG+A+ IYLEE++ K +   F+
Sbjct: 56  NWKFFTSPPSGDPAEAGILTAWVGSLLVILVTIVVAVPLGVAAGIYLEEYAPKNWLLDFI 115

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI NLA VPSI+YG+L     +   K   S  L  G  LAL+ LP II+AT  A+R +
Sbjct: 116 EINITNLAGVPSIIYGLLALGFFVYILKWGESI-LTAGCTLALLILPVIIVATREAIRAI 174

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT- 364
           P  IR  A  +GA++ QT+  H+LP +M  ILTG  V ++RALGETAPL+ +G + F+T 
Sbjct: 175 PQGIREGAYAVGATRWQTIADHILPYSMGGILTGVIVGVSRALGETAPLVTIGALTFITF 234

Query: 365 --DYPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
             D P+           +    T  P+Q++ W +  +  F      A ++LL+    +N 
Sbjct: 235 LPDAPLKGEFPYVSFKWLWSPFTVLPIQMFNWVSRPQEEFQVNAAAAGIVLLVLTLGVNA 294

Query: 413 AMLWLRNRFKK 423
             ++LR RF+K
Sbjct: 295 MAIYLRYRFRK 305


>gi|309951512|gb|ADO95178.1| putative phosphate ABC transporter permease PstA inner membrane
           subunit [Sinorhizobium sp. M14]
          Length = 315

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 143/252 (56%), Gaps = 14/252 (5%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           +Y F     S RP  AGI  A VG+  +M +   L+ PLG+ + +YLEE++ K + +  +
Sbjct: 62  DYAFLTEFPSRRPADAGILSAWVGTCLVMFVTALLAIPLGVGAGLYLEEYARKNWMTDVI 121

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + N+ NLA VPSI+YG+L     +    + R T LV G++LAL+ LP +I+AT  A+R +
Sbjct: 122 EINVTNLAGVPSIIYGLLALGFFVYLADLGR-TVLVAGMVLALLILPIVIVATREAIRAI 180

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P +IR  A GLGA K QT++H++LP A P ILTG+ V L+RA+GETAP++ +G + F+  
Sbjct: 181 PQTIREGAFGLGADKWQTMWHYILPAARPGILTGAIVGLSRAIGETAPIITIGALTFIAF 240

Query: 366 YPVGVTDIA-------------TAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
            P    D +             T  P+Q++ W +  +  F        ++L+     +N 
Sbjct: 241 LPPAPVDASFPFINFDWLNAPFTVMPIQMFNWISRPQAAFHINAAATGVVLMFMTLGMNA 300

Query: 413 AMLWLRNRFKKR 424
             +W+R R ++ 
Sbjct: 301 VAIWIRFRLRRN 312


>gi|27467986|ref|NP_764623.1| phosphate ABC transporter [Staphylococcus epidermidis ATCC 12228]
 gi|251810816|ref|ZP_04825289.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282876176|ref|ZP_06285043.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis SK135]
 gi|293366649|ref|ZP_06613326.1| phosphate ABC superfamily ATP binding cassette transporter,
           permease protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315531|gb|AAO04665.1|AE016747_162 phosphate ABC transporter [Staphylococcus epidermidis ATCC 12228]
 gi|251805651|gb|EES58308.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281295201|gb|EFA87728.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis SK135]
 gi|291319418|gb|EFE59787.1| phosphate ABC superfamily ATP binding cassette transporter,
           permease protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329729354|gb|EGG65760.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis VCU144]
 gi|329732923|gb|EGG69268.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis VCU028]
 gi|329736953|gb|EGG73211.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis VCU045]
          Length = 301

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/237 (44%), Positives = 155/237 (65%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AGI  A+VGS++++L +I +S  LGI +AIYLEE++    F+  V+ +
Sbjct: 66  FFTNFSSSTPADAGIKGALVGSIWLILSIIPISIILGIGTAIYLEEYARDNIFTQIVKVS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPSIV+G+LG  + +    +  S  L   L ++L+ LP II+A+  A+R VPSS
Sbjct: 126 ISNLAGVPSIVFGLLGYTLFVGAAGLGNSV-LAAALTMSLLILPVIIVASQEAIRAVPSS 184

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +   P 
Sbjct: 185 VREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVMIGIPTILLATPS 244

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           G+ D  +A P QIY WA   +  F       I++LL+ L ++NT  + LRN+F K++
Sbjct: 245 GLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLLMNTVAILLRNKFSKKF 301


>gi|261408695|ref|YP_003244936.1| phosphate ABC transporter inner membrane subunit PstA
           [Paenibacillus sp. Y412MC10]
 gi|329929177|ref|ZP_08282963.1| phosphate ABC transporter, permease protein PstA [Paenibacillus sp.
           HGF5]
 gi|261285158|gb|ACX67129.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus sp. Y412MC10]
 gi|328936854|gb|EGG33289.1| phosphate ABC transporter, permease protein PstA [Paenibacillus sp.
           HGF5]
          Length = 291

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 148/235 (62%), Gaps = 1/235 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F N  S   + AG+   +VG++Y++L++  LSF LG+ +AI+LEE++ +  +   +Q N
Sbjct: 56  LFTNFPSRIADKAGLKSPIVGTIYLLLLMAPLSFVLGVGAAIFLEEYAGRSRWVRLIQLN 115

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+ LA VPSI+YGILG A+ +    + RS  L G L + L+ LP II+A   ALR VP +
Sbjct: 116 ISTLAGVPSIIYGILGLAIFVRGMNLGRSL-LSGVLTMTLLVLPIIIVAAQEALRAVPKN 174

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
            R A+  LGA+K QTV   VLP A+P I+TG  ++L+RA+GETAPL+ +G + +V   P 
Sbjct: 175 RRDASYALGATKWQTVSSAVLPSAIPGIMTGVILALSRAIGETAPLIMIGALTYVAFLPE 234

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            + D  T  P+QI+ W +     F E     I+LLLI L ++N A +W+RN++ K
Sbjct: 235 NLLDSFTVMPIQIFNWVSRPSEAFHELAASGIILLLIMLFIMNIAAVWIRNKYSK 289


>gi|42783396|ref|NP_980643.1| phosphate ABC transporter, permease protein [Bacillus cereus ATCC
           10987]
 gi|206978001|ref|ZP_03238887.1| phosphate ABC transporter, permease protein [Bacillus cereus
           H3081.97]
 gi|217961761|ref|YP_002340331.1| phosphate ABC transporter, permease protein [Bacillus cereus AH187]
 gi|222097715|ref|YP_002531772.1| phosphate ABC transporter , permease protein [Bacillus cereus Q1]
 gi|229141006|ref|ZP_04269549.1| ABC transporter permease protein [Bacillus cereus BDRD-ST26]
 gi|42739324|gb|AAS43251.1| phosphate ABC transporter, permease protein [Bacillus cereus ATCC
           10987]
 gi|206743801|gb|EDZ55222.1| phosphate ABC transporter, permease protein [Bacillus cereus
           H3081.97]
 gi|217065548|gb|ACJ79798.1| phosphate ABC transporter, permease protein [Bacillus cereus AH187]
 gi|221241773|gb|ACM14483.1| phosphate ABC transporter, permease protein [Bacillus cereus Q1]
 gi|228642439|gb|EEK98727.1| ABC transporter permease protein [Bacillus cereus BDRD-ST26]
          Length = 288

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI LSF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPLSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VP S
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPRS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYQVVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIVVLWLRNR 287


>gi|315648813|ref|ZP_07901908.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus vortex V453]
 gi|315275781|gb|EFU39133.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus vortex V453]
          Length = 291

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 148/235 (62%), Gaps = 1/235 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F N  S   + AG+   +VG++Y++L++  LSF LG+ +AI+LEE++ +  +   +Q N
Sbjct: 56  LFTNFPSRIADKAGLKSPIVGTIYLLLLMAPLSFILGVGAAIFLEEYAGRSRWVRLIQLN 115

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+ LA VPSI+YGILG A+ +    + RS  L G L + L+ LP II+A   ALR VP +
Sbjct: 116 ISTLAGVPSIIYGILGLAIFVRGMNLGRSL-LSGVLTMTLLVLPIIIVAAQEALRAVPKN 174

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
            R A+  LGA+K QTV   VLP A+P I+TG  ++L+RA+GETAPL+ +G + +V   P 
Sbjct: 175 RRDASYALGATKWQTVSSAVLPSAIPGIMTGVILALSRAIGETAPLIMIGALTYVAFLPE 234

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            + D  T  P+QI+ W +     F E     I+LLLI L ++N A +W+RN++ K
Sbjct: 235 NLLDSFTVMPIQIFNWVSRPSEAFHELAASGIILLLIMLFIMNIAAVWIRNKYSK 289


>gi|229198397|ref|ZP_04325103.1| ABC transporter permease protein [Bacillus cereus m1293]
 gi|228585097|gb|EEK43209.1| ABC transporter permease protein [Bacillus cereus m1293]
          Length = 288

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI LSF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIAAALSGTILFMSIVIPLSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VP S
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPRS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYQVVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIVVLWLRNR 287


>gi|11498954|ref|NP_070187.1| phosphate ABC transporter, permease protein (pstA) [Archaeoglobus
           fulgidus DSM 4304]
 gi|2649217|gb|AAB89888.1| phosphate ABC transporter, permease protein (pstA) [Archaeoglobus
           fulgidus DSM 4304]
          Length = 283

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 96/249 (38%), Positives = 153/249 (61%), Gaps = 5/249 (2%)

Query: 178 DGALFLDFNYGFFINGASSR-PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           + A +LD     F+    SR PE AGI  ++VGS+  + +V  +  PLG+ +AIYLEE++
Sbjct: 36  EAAAWLDLQ---FLTSPPSRFPEKAGIFPSLVGSIMAIALVGVMVLPLGVGAAIYLEEYA 92

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI+NLA+VPSIVYG+LG  + ++   +     LVG L L L+ LP +I+
Sbjct: 93  RKNWLTKLIEINISNLAAVPSIVYGLLGLGLFVSTLGLKPGIVLVGSLTLTLLVLPIVIV 152

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           A   +LR VP S+R A+L +GA+K QTV   VLP ++P I+TG  ++L+RA+GETAPL+ 
Sbjct: 153 AAQESLRAVPFSLREASLAVGATKWQTVKSVVLPSSLPGIMTGVILALSRAIGETAPLIM 212

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVER-TFGAILLLLIFLAVINTAML 415
           +G+       P  +    +A P+ I++W    +  F+      AI++LL  +  +N   +
Sbjct: 213 IGVATATFTAPKDIFSTYSALPMLIFMWTDMPKEEFLHGLAPAAIVVLLAIMLSMNAFAV 272

Query: 416 WLRNRFKKR 424
           +LRN+F +R
Sbjct: 273 YLRNKFARR 281


>gi|324328176|gb|ADY23436.1| phosphate ABC transporter, permease protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 288

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 145/232 (62%), Gaps = 1/232 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI LSF  G+ +A+YLE+++ +  F   ++ N
Sbjct: 57  FFTNFASRNPKEAGIVAALSGTILFMSIVIPLSFIFGVGTALYLEQYAKESIFKKVIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VP S
Sbjct: 117 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-IAAALTMSLLVLPTVVVASQEAIRSVPRS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +  A+ GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 176 LLEASYGLGATKWQTMYQVVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 235

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            + D  T  P+QI+ W +  +  F       +++LL  L +IN  +LWLRNR
Sbjct: 236 SMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLLINIVVLWLRNR 287


>gi|166363667|ref|YP_001655940.1| phosphate transport system permease protein [Microcystis aeruginosa
           NIES-843]
 gi|166086040|dbj|BAG00748.1| phosphate transport system permease protein [Microcystis aeruginosa
           NIES-843]
          Length = 296

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 153/238 (64%), Gaps = 8/238 (3%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GF     S  PE  GI  A++GS Y+ +IV+ ++ P+G+ SA+YLEE++ K ++++ ++ 
Sbjct: 61  GFLTETPSRFPERGGIRPAIIGSFYLGIIVLLVAVPIGVGSALYLEEYAPKTWWTALIEV 120

Query: 248 NINNLASVPSIVYGILGSAV---LINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           NI NLA VPSIVYG+LG AV   L+NF      T + G L LAL++LP II+    A+R 
Sbjct: 121 NIGNLAGVPSIVYGLLGLAVFNYLLNF----GPTLISGALTLALLSLPVIIVTAREAIRA 176

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S+R A+ GLG++K QT+ HHVLP A+P ILTG  +S++RA+G+ A L+ VG V+F+T
Sbjct: 177 VPDSLRQASYGLGSTKWQTIQHHVLPYAVPGILTGVIISVSRAIGDAASLMVVGAVSFLT 236

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             P G+     A P+QI+ +    E  F      AI++L++ +  +N   ++LR R+ 
Sbjct: 237 FDP-GLFQRFMALPIQIFSYITRPEPGFANAAAAAIIVLILLILALNAIAIYLRQRYS 293


>gi|315186295|gb|EFU20056.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Spirochaeta thermophila DSM 6578]
          Length = 300

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 152/252 (60%), Gaps = 6/252 (2%)

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           SD   +LD+   F  +  S  PE AG+G  + GS Y++++V  + FP G+ +AIYLEE++
Sbjct: 52  SDAIGWLDWQ--FLTSPPSRFPEKAGVGPVLAGSFYLIVLVGLMVFPFGVGAAIYLEEYA 109

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            +G     ++ NI NLA VPSIVYG+LG  V +    +P    LV  L L L  LP +I+
Sbjct: 110 KEGRLKRLIETNIANLAGVPSIVYGLLGLGVFVGVMHLPIGCLLVASLTLMLRVLPIVIV 169

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +   A+R VP S R A+LG+G ++ Q +   VLP A P I+TG  ++LA A+GETAPL+ 
Sbjct: 170 SAQEAIRAVPDSHRFASLGMGTTRWQMITSVVLPEAFPGIMTGIILALANAMGETAPLIM 229

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF--GAILLLLIFLAVINTAM 414
           VG+   +   P G+     A P+QI+ W +D  +P  +      AI++LL+ L ++N   
Sbjct: 230 VGVAHSIFTPPRGLLSAFGALPLQIFAW-SDYPKPEFQHGVVPAAIVVLLVTLMLLNGIA 288

Query: 415 LWLRNRF-KKRW 425
           ++LR+RF K+RW
Sbjct: 289 VYLRHRFSKRRW 300


>gi|205373992|ref|ZP_03226792.1| ABC transporter permease [Bacillus coahuilensis m4-4]
          Length = 214

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 142/215 (66%), Gaps = 1/215 (0%)

Query: 211 LYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN 270
           +++M +V  +SF LG+ +A+YLEE++ +   ++F+Q NI+NLA VPS+V+G+LG  + + 
Sbjct: 1   MWLMAVVAPVSFILGVGTALYLEEYAKQNKINNFIQVNISNLAGVPSVVFGLLGLTIFVR 60

Query: 271 FFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLP 330
            F    S  L  GL LALM LP II+A+  A+R+V   +R A+ G+GA+K QT+   VLP
Sbjct: 61  VFAFGTSV-LAAGLTLALMILPVIIVASQEAIRSVSGELRDASFGMGATKWQTIIRVVLP 119

Query: 331 LAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAER 390
            A+P ILTG+ ++++RA+GETAPL+ +G+  F+   P  V D  TA P+QIY W    + 
Sbjct: 120 SAIPGILTGTILAVSRAIGETAPLVVIGIPTFLAFLPGSVLDTFTALPMQIYNWTGRPQA 179

Query: 391 PFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            F +     I++LL  L ++N   +++RN+F +R+
Sbjct: 180 EFQDLAAAGIIVLLALLILMNAIAVFIRNKFSQRY 214


>gi|57866923|ref|YP_188536.1| phosphate ABC transporter permease [Staphylococcus epidermidis
           RP62A]
 gi|242242665|ref|ZP_04797110.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis W23144]
 gi|57637581|gb|AAW54369.1| phosphate ABC transporter, permease protein [Staphylococcus
           epidermidis RP62A]
 gi|242233801|gb|EES36113.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis W23144]
 gi|319401328|gb|EFV89539.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis FRI909]
          Length = 301

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 154/237 (64%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AGI  A+VGS++++L +I +S  LGI +AIYLEE++    F+  V+ +
Sbjct: 66  FFTNFSSSTPADAGIKGALVGSIWLILSIIPISIILGIGTAIYLEEYARDNIFTQIVKVS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPSIV+G+LG  + +    +  S  L   L ++L+ LP II+A+  A+R VPSS
Sbjct: 126 ISNLAGVPSIVFGLLGYTLFVGAAGLGNSV-LAAALTMSLLILPVIIVASQEAIRAVPSS 184

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +   P 
Sbjct: 185 VREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVMIGIPTILLATPS 244

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           G+ D  +A P QIY WA   +  F       I++LL+ L ++N   + LRN+F K++
Sbjct: 245 GLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLLMNAIAILLRNKFSKKF 301


>gi|296121742|ref|YP_003629520.1| phosphate ABC transporter inner membrane subunit PstA [Planctomyces
           limnophilus DSM 3776]
 gi|296014082|gb|ADG67321.1| phosphate ABC transporter, inner membrane subunit PstA
           [Planctomyces limnophilus DSM 3776]
          Length = 339

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 104/275 (37%), Positives = 156/275 (56%), Gaps = 38/275 (13%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F ++     P  AGI   +VG+ +++L+   LS PLG+ +AIYLEE+S     + F+Q N
Sbjct: 65  FLVSMPRRNPADAGILPGIVGTFWLILLTAILSVPLGVGAAIYLEEYSKPTLLTKFIQLN 124

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRS-------------------TALVGGLILALM 289
           I NLA VPSIVYGILG    +  F + +S                   T + G L LAL+
Sbjct: 125 IANLAGVPSIVYGILGFTAFVRMFGLAKSEYLINLGIGSLQLTLPFGRTVISGALTLALL 184

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           +LP +IIA+  ALR+VP S+R A+L LGA+K QT++H VLP A+P ++TG  ++++RA+G
Sbjct: 185 SLPVVIIASQEALRSVPPSLRHASLALGATKWQTIWHQVLPSALPGMMTGVILAMSRAIG 244

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIA-----------------TAFPVQIYLWAADAERPF 392
           ETAPL+ +G   ++T  P  +  ++                 T  P+QIY W  +A+  F
Sbjct: 245 ETAPLVAIGAATYITFTPGRLNSVSEAITRPDKLAQVPFDSFTTIPMQIYGWINEAKPEF 304

Query: 393 VERTFGAILLLLIFLAVINTAMLWLRNRFKK--RW 425
                 AIL+LL+ L + N   +++R  F+K  RW
Sbjct: 305 QHVAAAAILVLLVILLISNGLAIFIRQHFQKKVRW 339


>gi|300868509|ref|ZP_07113128.1| phosphate ABC transporter permease (modular protein) [Oscillatoria
           sp. PCC 6506]
 gi|300333498|emb|CBN58316.1| phosphate ABC transporter permease (modular protein) [Oscillatoria
           sp. PCC 6506]
          Length = 638

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 157/259 (60%), Gaps = 8/259 (3%)

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
           F  +  DG  F   ++ F    +S +PE +GI  A++G+ +++ +    + P+G+ +AIY
Sbjct: 382 FFDIGIDG--FFRLDWEFITTFSSRKPEDSGIYAALIGTFWLLGLTAIFATPIGVGAAIY 439

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF--FKMPRSTALVGGLILALM 289
           LEE+     FS F++ NI NLA++PSI+YG+LG  V ++   F    S+ L   L L+++
Sbjct: 440 LEEYIPDNIFSQFLEINIANLAAMPSIIYGLLGLGVFVHALGFFTGESSILSASLTLSVI 499

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
            LP +IIAT  ALRTVP S+R A    G ++ Q +F+ VLP ++P ILTG+ +SL+ A+G
Sbjct: 500 ILPLLIIATRSALRTVPYSLREAGYATGMTRWQVLFYIVLPSSLPGILTGTLLSLSGAIG 559

Query: 350 ETAPLLFVGMVAFVTDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLI 405
           ETAPLL +G  AF+T  P     G+    T+ PVQI+ W +  +  F E    AI++L+ 
Sbjct: 560 ETAPLLAIGASAFITFTPPLSLEGLRSPFTSLPVQIFNWVSRPQADFQENAAAAIIVLIG 619

Query: 406 FLAVINTAMLWLRNRFKKR 424
            L ++N A + LR   +++
Sbjct: 620 ILFLMNFAAIILRENNREK 638



 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 111/233 (47%), Gaps = 15/233 (6%)

Query: 202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYG 261
           GI V   G+L    I +  + P+G+ +AIYL E++ +      ++ ++  LA +P++VYG
Sbjct: 84  GIMVLASGTLLTTAIAMTFAMPIGLLAAIYLSEYAPQTV-RYILKPSLETLAGIPTVVYG 142

Query: 262 ILGSAVLINFFK-----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
                 +    +     +   + L  GL+  +M +P I   +  A+ +VP+  R  A  L
Sbjct: 143 YFALLFVTPLLQKIIPNLAGFSPLSAGLVTGVMIVPIISSLSEDAINSVPNKFREGAYAL 202

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGET-APLLFVGMVAFVTDYPVGVTDIAT 375
           G +K + +   VLP+A P I+   T++ +R+LGET    +  G     T  P+      T
Sbjct: 203 GLTKREVITKIVLPIAFPGIIASFTLAASRSLGETLIASIAAGQTPQFTLNPLEPVSTMT 262

Query: 376 AFPVQIYLWAADAERPFVERTFGAILL--LLIFLAVINTAML--WLRNRFKKR 424
           AF +Q+ L     + PF    F  I    ++IFL  +   +L  WL   ++ +
Sbjct: 263 AFIIQLSL----GDVPFNSLEFHIIFTVGMVIFLLTLTLNILSYWLVRNYRNQ 311


>gi|253732022|ref|ZP_04866187.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253724263|gb|EES92992.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
          Length = 305

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 156/246 (63%), Gaps = 6/246 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N  FF N +SS P +AG+  A++GSL++ML +I L   LGI +AIYLEE++    F+ F
Sbjct: 61  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLLIILGIGTAIYLEEYAKNNKFTQF 120

Query: 245 VQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTALVGGLILALMTLPSIIIATG 299
           V+ +I+NLA VPS+V+GILG  +      I   KM  S  L   L + L+ LP II+++ 
Sbjct: 121 VKISISNLAGVPSVVFGILGYTLFVGGAGIEALKMGNSI-LAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKRW 425
           +F K++
Sbjct: 300 KFSKKF 305


>gi|110640185|ref|YP_680395.1| phosphate ABC transporter permease [Cytophaga hutchinsonii ATCC
           33406]
 gi|110282866|gb|ABG61052.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Cytophaga hutchinsonii ATCC 33406]
          Length = 290

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 161/248 (64%), Gaps = 3/248 (1%)

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           SDG   +D    F ++ +S + + AGI  A+ G+L++M +   ++FP+GI + IYLEE++
Sbjct: 43  SDGFSRIDLK--FLMDSSSRKAKNAGIYAALGGTLWIMALTTLIAFPIGIGAGIYLEEYN 100

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            KG  S+ ++ NI+NLA +PSI+YG+LG  +      M   TA+ G L L+L+ LP II+
Sbjct: 101 TKGRMSNLLEINISNLAGIPSIIYGLLGLEIFSRTL-MLGDTAITGALTLSLLILPIIIV 159

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  AL+TVP ++R A+L LGA+K QT+++ +LP ++P I+TG+ ++++RA+GETAPL+ 
Sbjct: 160 STREALKTVPYNLREASLALGATKWQTIWYQILPASIPGIVTGAILAISRAIGETAPLIV 219

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           +G   ++T  P    +  T  P+QI+ W    +  F      AI++LL    ++N A ++
Sbjct: 220 IGAATYITSVPSWPNESFTVLPIQIFYWIGKPQHDFQVNAAAAIIILLAITFIMNGAAVY 279

Query: 417 LRNRFKKR 424
           LR R++K+
Sbjct: 280 LRYRWQKK 287


>gi|55980230|ref|YP_143527.1| phosphate ABC transporter permease [Thermus thermophilus HB8]
 gi|55771643|dbj|BAD70084.1| probable phosphate ABC transporter, permease protein [Thermus
           thermophilus HB8]
          Length = 291

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 157/274 (57%), Gaps = 11/274 (4%)

Query: 162 HRMSDY-------QWKWFQKLDSDGA-LFLD--FNYGFFINGASSRPEVAGIGVAVVGSL 211
            R++D+       +W+  +    +G  L L+   +  F     S  P  AGIGVA+ G++
Sbjct: 19  ERVADFSLLEGLRRWEELKAGLGEGERLVLNPWLDQSFLTRTPSRSPLTAGIGVAIWGTI 78

Query: 212 YMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF 271
           +++ + + ++ P+GI +AI LEE+  +G  +  ++ N+ NLA VPSIVYG+LG A+ +  
Sbjct: 79  WVLSLALLIAIPVGIGTAILLEEYLREGTLNRILEVNLRNLAGVPSIVYGLLGLAIFVRE 138

Query: 272 FKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPL 331
             +   T L   L L L+ +P I++    +LR VP S+R AA  LGA++ Q VF  V+P 
Sbjct: 139 MGL-GPTILSAALTLGLLGIPVIVVTARESLRAVPESLRQAAFALGATRRQVVFRVVVPA 197

Query: 332 AMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERP 391
           A+P ++TG  +S AR +GE APLL VG  A+V  YP G     T  PVQIYLW +     
Sbjct: 198 ALPGMVTGVILSAARLIGEAAPLLLVGAAAYVPFYPTGPLSEYTVIPVQIYLWVSMNIPE 257

Query: 392 FVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           F       IL++L+ L+ +    L+LRNRF++ W
Sbjct: 258 FARVAAAGILVMLLVLSGLYFLALYLRNRFRREW 291


>gi|159030674|emb|CAO88344.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 307

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 150/252 (59%), Gaps = 16/252 (6%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF +  S  PE AGI  A VG+L +ML+   ++ PLGIA+ IYLEE+S K + S+ ++ N
Sbjct: 57  FFTSFPSRHPEEAGILSAWVGTLLVMLVTALIAIPLGIAAGIYLEEYSKKNWLSAIIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + NLA VPSI+YG+L   + +  F + +S  +  GL LAL+ LP +I+ T  A+R +P+S
Sbjct: 117 VTNLAGVPSIIYGLLALGLFVYQFNLGQSI-IAAGLTLALLILPVVIVTTREAIRAIPNS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVAFVTD 365
           +R AA  +GAS+ Q V  H+LP +  +ILTG  + L+RA+GETAP++ +G    +AF+ D
Sbjct: 176 LREAAYAVGASRWQVVADHILPYSFGSILTGVIIGLSRAIGETAPVITIGALTFIAFLPD 235

Query: 366 YPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            P+           +    T  P+Q++ W +  E  F      A  +L++    +N   +
Sbjct: 236 APLQANFPFINFNWLKAPFTVMPIQMFNWVSRPEPEFEVNAAAAGTVLIVMTLGMNAVAI 295

Query: 416 WLRNRFKK--RW 425
           +LR RF+K  +W
Sbjct: 296 YLRYRFRKGIKW 307


>gi|254468475|ref|ZP_05081881.1| phosphate ABC transporter, permease protein PstA [beta
           proteobacterium KB13]
 gi|207087285|gb|EDZ64568.1| phosphate ABC transporter, permease protein PstA [beta
           proteobacterium KB13]
          Length = 312

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/262 (37%), Positives = 153/262 (58%), Gaps = 20/262 (7%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DG  +   N  FF N  S +PE AGI  A VGS  ++++   ++ P+G+AS IYLEE++ 
Sbjct: 53  DG--YPKMNLEFFSNFPSRKPEGAGILSAWVGSALVLIVTFFVAVPMGVASGIYLEEYAK 110

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           KG+F+  ++ N+ NLA VPSI+YG+L   + +  F + +S  L  GL L+L+ LP +I++
Sbjct: 111 KGWFADLIEINVANLAGVPSIIYGLLALGLFVYEFGLGQSI-LTAGLTLSLLMLPIVIVS 169

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  A+R +P  IR AA  +GA+K Q   HHVL  AM  +LTG  + +ARA+GETAP++ +
Sbjct: 170 TREAIRAIPVHIREAAYAVGATKWQVTLHHVLQYAMGGVLTGIIIGMARAIGETAPVITI 229

Query: 358 GMVAFVTDYPVG-VTDIA------------TAFPVQIYLWAADAERPF--VERTFGAILL 402
           G + F+   P   VTD+A            T  P+Q++ W +  E  F       GA+++
Sbjct: 230 GALTFIAFLPPSPVTDVAPFFNFAWLEAGFTVLPIQMFNWISRPEHAFHINAAATGAVII 289

Query: 403 LLIFLAVINTAMLWLRNRFKKR 424
           +L  L  +N   + LR   +K+
Sbjct: 290 ILTLL--MNGIAIKLRYSIRKK 309


>gi|309390010|gb|ADO77890.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Halanaerobium praevalens DSM 2228]
          Length = 283

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 86/210 (40%), Positives = 137/210 (65%), Gaps = 3/210 (1%)

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           S G + LD+   FF    S  P  AGI   + G++Y++ ++I ++F +G A+AIYLEE++
Sbjct: 39  SKGIIMLDWE--FFTRFDSRFPAKAGIKAGLFGTIYVIGLMIPITFSVGTATAIYLEEYA 96

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            +   +  ++ NI NLA +PSI+YG+LG  V + +  M RS  L G L L+L+ LP +I+
Sbjct: 97  PENKLTDLIKLNIANLAGIPSIIYGMLGLGVFVRYLNMGRSV-LAGALTLSLLVLPVVIV 155

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +   +L++VP S+R+A+  LGA+   TV+  VLP A+P+ILTG  ++++RA+GETAPL+ 
Sbjct: 156 SAQESLKSVPDSLRNASYALGANHWHTVYRVVLPSALPSILTGFILAISRAIGETAPLIM 215

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAA 386
           +G + FV   P G+ D  T  P+QI+ W +
Sbjct: 216 MGALTFVMFTPQGIMDSFTVIPIQIFNWTS 245


>gi|30249003|ref|NP_841073.1| phosphate permease component of ATP-dependent phosphate uptake
           system [Nitrosomonas europaea ATCC 19718]
 gi|30138620|emb|CAD84911.1| Phosphate permease component of ATP-dependent phosphate uptake
           system [Nitrosomonas europaea ATCC 19718]
          Length = 311

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 95/266 (35%), Positives = 151/266 (56%), Gaps = 20/266 (7%)

Query: 179 GALFLD----FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
           G++ +D      + FF +  S +PE AGI  A VG+  +ML+    + PLG+A+ +YLEE
Sbjct: 47  GSMVIDGMPRLTWEFFTSFPSRKPEAAGILSAWVGTTLIMLVTAAAAVPLGVAAGVYLEE 106

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++ K   +  ++ N+ NLA VPSI+YG+L   + +    + +S  L  GL LAL+ LP +
Sbjct: 107 YAPKNLITEIIEINVTNLAGVPSIIYGLLALGLFVYQLGLGQSI-LSAGLTLALLILPIV 165

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I+AT  A+R++P SIR  A  LGA+K QTV  HVLP +   ILTG  + LARA+GETAP+
Sbjct: 166 IVATREAIRSIPVSIREGAYALGATKWQTVSDHVLPYSAAGILTGVIIGLARAIGETAPI 225

Query: 355 LFVGMVAFVTDYPVG-------------VTDIATAFPVQIYLWAADAERPFVERTFGAIL 401
           + +G + F+   P               + +  T  P+Q++ W +  +  F      A L
Sbjct: 226 ITIGALTFIAFLPPSPIQDQFPFVSFQWLMEPFTVMPIQMFNWISRPQEAFQHNAAAAGL 285

Query: 402 LLLIFLAVINTAMLWLRNRFKK--RW 425
           +L++   ++N   ++LR R +K  +W
Sbjct: 286 VLVVMTLLMNGLAIYLRYRLRKNIKW 311


>gi|257058930|ref|YP_003136818.1| phosphate ABC transporter inner membrane subunit PstA [Cyanothece
           sp. PCC 8802]
 gi|256589096|gb|ACU99982.1| phosphate ABC transporter, inner membrane subunit PstA [Cyanothece
           sp. PCC 8802]
          Length = 311

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 147/252 (58%), Gaps = 16/252 (6%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF++  S + E AGI  A VGS  +ML+ +  + PLG+AS IYLEE+S K + S  ++ N
Sbjct: 61  FFLSFPSRKAEEAGILSAWVGSGLIMLVTMIAAIPLGVASGIYLEEYSKKNWLSDIIEIN 120

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA VPSI+YG+L   + +  F + RS  L  GL LAL+ LP II+ T  ALR++P S
Sbjct: 121 ITNLAGVPSIIYGLLALGLFVYQFNLGRSM-LSAGLTLALLILPVIIVTTREALRSIPRS 179

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVAFVTD 365
           +R AA  +GASK Q V  H+LP ++ +ILTG  + ++RA+GETAPL+ +G    +AF+ D
Sbjct: 180 LREAAYAVGASKWQVVSQHILPYSLGSILTGIIIGISRAIGETAPLITIGALTFIAFLPD 239

Query: 366 YPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            P+           +    T  P+Q++ W +     F      A  +L+     +N   +
Sbjct: 240 PPIKGEFPFISFAWLFTEYTVMPIQMFNWVSRPNAEFHINAAAAGTVLIAMTVFMNALAI 299

Query: 416 WLRNRFKK--RW 425
           +LR R +K  +W
Sbjct: 300 YLRYRLRKGVKW 311


>gi|289582018|ref|YP_003480484.1| phosphate ABC transporter inner membrane subunit PstA [Natrialba
           magadii ATCC 43099]
 gi|289531571|gb|ADD05922.1| phosphate ABC transporter, inner membrane subunit PstA [Natrialba
           magadii ATCC 43099]
          Length = 306

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/260 (38%), Positives = 158/260 (60%), Gaps = 7/260 (2%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFING-ASSRPEVAGIGVAVVGSLYMMLIVIGLSF 222
           ++D  W+ +Q       +  D + G ++   +SSR E AG G +++ SL++M +   L+F
Sbjct: 44  IADVVWESYQAF-----VTFDIDLGNYLTATSSSRAERAGFGASILASLWLMALTAVLAF 98

Query: 223 PLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVG 282
            + +  AIYL E++ +   +  ++AN+ NLA VPSIVYG+L  A+++N   +  S  L G
Sbjct: 99  FIAVGCAIYLVEYAPENRVTRLIEANLANLAGVPSIVYGLLVLALIVNDAGLG-SVILAG 157

Query: 283 GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV 342
            + LAL+ +P II+A+  ++R VPSS+R  +  +GA+K QT+   VLP AMP ILTG+ +
Sbjct: 158 AIALALLIVPIIIVASIESIRAVPSSVRDGSYAMGATKWQTIRQVVLPKAMPGILTGTIL 217

Query: 343 SLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILL 402
           +LARA+GETAPL+ VG +   T YP G     +A P QIY W   A+R F       I++
Sbjct: 218 ALARAIGETAPLIMVGTMLHATRYPSGPLSSFSAMPTQIYNWTYQADRMFNGLAALGIVV 277

Query: 403 LLIFLAVINTAMLWLRNRFK 422
           LL+FL  +     +LR R++
Sbjct: 278 LLLFLVAMYALAGYLRKRYE 297


>gi|224367369|ref|YP_002601532.1| PstA2 [Desulfobacterium autotrophicum HRM2]
 gi|223690085|gb|ACN13368.1| PstA2 [Desulfobacterium autotrophicum HRM2]
          Length = 284

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 92/226 (40%), Positives = 135/226 (59%), Gaps = 3/226 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   +VG+L +M + + ++ P+G+ASAIYL E++ +G F   ++  INNLA VPS+V+
Sbjct: 57  GGIFPCIVGTLCLMGVALVVALPVGVASAIYLNEYAAQGRFVRIIRLGINNLAGVPSVVF 116

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A      KM  S  + GGL L LMTLP II  +  AL++VP + R A+LGLGA+K
Sbjct: 117 GLFGLAFFCIVLKMGVSV-IAGGLTLGLMTLPVIIGTSEEALKSVPKTYREASLGLGATK 175

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT++  VLP A P I+TG  + L+RA GETAP+++ G V F  + P  + D   A P  
Sbjct: 176 WQTIYRVVLPSAFPGIITGGILGLSRAAGETAPIMYTGAVFFTPELPGSLFDEVMALPYH 235

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A         R   +G  L+L+  +  +N   + LR R +K+
Sbjct: 236 IYVLATAGTNIATTRPLQYGTALVLIALIFGMNLGAILLRTRIRKK 281


>gi|218245882|ref|YP_002371253.1| phosphate ABC transporter inner membrane subunit PstA [Cyanothece
           sp. PCC 8801]
 gi|218166360|gb|ACK65097.1| phosphate ABC transporter, inner membrane subunit PstA [Cyanothece
           sp. PCC 8801]
          Length = 311

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 146/252 (57%), Gaps = 16/252 (6%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF++  S + E AGI  A VGS  +ML+ +  + PLG+AS IYLEE+S K + S  ++ N
Sbjct: 61  FFLSFPSRKAEEAGILSAWVGSGLIMLVTMIAAIPLGVASGIYLEEYSKKNWLSDIIEIN 120

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA VPSI+YG+L   + +    + RS  L  GL LAL+ LP II+ T  ALR++P S
Sbjct: 121 ITNLAGVPSIIYGLLALGLFVYQLNLGRSM-LSAGLTLALLILPVIIVTTREALRSIPRS 179

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVAFVTD 365
           +R AA  +GASK Q V  H+LP ++ +ILTG  + ++RA+GETAPL+ +G    +AF+ D
Sbjct: 180 LREAAYAVGASKWQVVSQHILPYSLGSILTGIIIGISRAIGETAPLITIGALTFIAFLPD 239

Query: 366 YPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            P+           +    T  P+Q++ W +     F      A  +L+     +N   +
Sbjct: 240 PPIKGEFPFISFAWLFTEYTVMPIQMFNWVSRPNAEFHINAAAAGTVLIAMTVFMNALAI 299

Query: 416 WLRNRFKK--RW 425
           +LR R +K  +W
Sbjct: 300 YLRYRLRKGVKW 311


>gi|56478172|ref|YP_159761.1| phosphate ABC transporter, permease protein [Aromatoleum aromaticum
           EbN1]
 gi|56314215|emb|CAI08860.1| Phosphate ABC transporter, permease protein [Aromatoleum aromaticum
           EbN1]
          Length = 307

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 142/248 (57%), Gaps = 14/248 (5%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF +  S R   AGI  A VGS+ +ML+    + PLG+A+ +YLEE++ + F +  ++ N
Sbjct: 57  FFTSFPSRRAGQAGILSAWVGSVLVMLVTAVSAVPLGVAAGVYLEEYATRSFVTDLIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + NLA VPSIVYG+L   V +  F   +S  L  GL L L+ LP +I+AT  A+R++P  
Sbjct: 117 VTNLAGVPSIVYGLLALGVFVYAFGFGQSI-LSAGLTLGLLILPVVIVATREAIRSIPQH 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVAFVTD 365
           IR  A  LGA++ Q    H++P +MP ILTG  + ++RA+GETAP++ +G    +AF+ +
Sbjct: 176 IREGAYALGATRWQVTRDHIVPYSMPGILTGVIIGMSRAIGETAPVITIGALTFIAFLPE 235

Query: 366 YPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            P+G          +    T  P+Q++ W +  E  F +    A  +L++    +N   +
Sbjct: 236 SPIGPEFPWVNFEWLKSGFTVMPIQMFNWTSRPEEAFQQNAAAAGFVLVLMTLAMNAISI 295

Query: 416 WLRNRFKK 423
           W+R   +K
Sbjct: 296 WIRYHLRK 303


>gi|228476156|ref|ZP_04060864.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           hominis SK119]
 gi|314936467|ref|ZP_07843814.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           hominis subsp. hominis C80]
 gi|228269979|gb|EEK11459.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           hominis SK119]
 gi|313655086|gb|EFS18831.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           hominis subsp. hominis C80]
          Length = 306

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 147/229 (64%), Gaps = 4/229 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
           AGI  A+ G+L++M+ +I +S  LG+ +AIYLEE++    F+SFV+  I+NLA VPSIV+
Sbjct: 78  AGIKGALAGTLWLMITIIPISIILGVGTAIYLEEYARDNMFTSFVKICISNLAGVPSIVF 137

Query: 261 GILGSAVLINFFKMPR----STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
           G+LG  + +    +      +T +   L ++L+ LP II+++  A+R VP+S+R A+ GL
Sbjct: 138 GLLGLTLFVRGAGIESLSLGNTVIAAALTMSLLILPIIIVSSQEAIRAVPNSVREASYGL 197

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATA 376
           G +K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+       P G+  + TA
Sbjct: 198 GGNKWQTIRKVVLPAALPGILTGFILSLSRALGETAPLILIGIPTIFLAVPSGLFSMFTA 257

Query: 377 FPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P QIY WA   +  F       I++LL+ L ++N   ++LRN+F +++
Sbjct: 258 LPTQIYTWAKMPQAEFQNVASAGIIVLLVILLLMNGLAIFLRNKFSRKY 306


>gi|42741696|gb|AAS45094.1| phosphate permease [Alcaligenes faecalis]
          Length = 319

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 153/260 (58%), Gaps = 16/260 (6%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           DGA  + F+  F  +  S +PE AGI  A VG+  +M++   L+ PLG+ + +YLEE++ 
Sbjct: 59  DGAARISFD--FLTSFPSRKPEAAGILSAWVGTTLVMIVTAFLAIPLGVLAGLYLEEYAP 116

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K +F++ ++ NI+NLA VPSI+YG+L   + +  F + + T  V G +LAL+ LP II++
Sbjct: 117 KNWFTTLIEVNISNLAGVPSIIYGLLALGLFVYMFDLGQ-TVFVAGAVLALLILPVIIVS 175

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  A+R++P  I+  A G+GA K QT+  ++LP A P ILTG+ V L+RA+GETAP++ +
Sbjct: 176 TREAVRSIPQVIKEGAYGMGADKWQTMTGYILPAARPGILTGAIVGLSRAIGETAPVITI 235

Query: 358 GMVAFVT---------DYPVGVTDIA----TAFPVQIYLWAADAERPFVERTFGAILLLL 404
           G + ++          D+P    D      T  P+Q++ W +  +  F        L+L+
Sbjct: 236 GALTYIAFLPTFPFQGDFPYLNFDWLNSPFTVMPIQMFNWLSRPQTEFHVNAAATGLILI 295

Query: 405 IFLAVINTAMLWLRNRFKKR 424
               V+N   + +R + ++R
Sbjct: 296 GMTVVMNLIAIVIRFKLRRR 315


>gi|218513935|ref|ZP_03510775.1| phosphate ABC transporter, permease protein [Rhizobium etli 8C-3]
          Length = 206

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 116/183 (63%), Gaps = 2/183 (1%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEFSE  +DP 
Sbjct: 24  IKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDPS 83

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R AS MLS +A   LR  ++ DP
Sbjct: 84  NKRATDPSVLIAANYPVLLRDAIVKQLNINASSKPDVRDASAMLSKSAPIQLRDMVVADP 143

Query: 131 SLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
           SLIGKTV VSLLA ANIDSA KG   L       +++D Q  W  +L + GAL   FN G
Sbjct: 144 SLIGKTVNVSLLADANIDSANKGQIDLSVDEKNRKVNDKQVTWMNQLKASGALQKQFNTG 203

Query: 189 FFI 191
            F+
Sbjct: 204 LFV 206


>gi|239945782|ref|ZP_04697719.1| phosphate ABC transporter, inner membrane subunit PstA
           [Streptomyces roseosporus NRRL 15998]
 gi|239992253|ref|ZP_04712917.1| phosphate ABC transporter, inner membrane subunit PstA
           [Streptomyces roseosporus NRRL 11379]
 gi|291449240|ref|ZP_06588630.1| phosphate ABC transporter [Streptomyces roseosporus NRRL 15998]
 gi|291352187|gb|EFE79091.1| phosphate ABC transporter [Streptomyces roseosporus NRRL 15998]
          Length = 302

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/229 (40%), Positives = 143/229 (62%), Gaps = 2/229 (0%)

Query: 198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH-KGFFSSFVQANINNLASVP 256
           P   G   A++G+++++        P GI +AIYLEE++    +++  ++ NI NLA+VP
Sbjct: 75  PTQGGAQSAIMGTVWVIGFTAVYCLPTGILTAIYLEEYADPDKWWNRAIEINIQNLAAVP 134

Query: 257 SIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
           SIVYGILG  ++       + T L   L L+L+ LP +II++  A+R VP SIR A+L L
Sbjct: 135 SIVYGILGLGIISRGLGFGQ-TVLTASLTLSLLVLPVVIISSREAIRAVPQSIRQASLAL 193

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATA 376
           GA++ QT++  VLP A+P + TGS ++L+RA+GE APLL +G + F+T  P GV    T 
Sbjct: 194 GATQWQTIWRQVLPAAVPGMATGSILALSRAIGEAAPLLLLGGLTFITFNPSGVQSQFTV 253

Query: 377 FPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P+QI+ W + +   FV     AI++LL  L  +N+  +WLRNR+ + W
Sbjct: 254 LPIQIFNWISQSRAEFVSLASAAIVILLAILLAMNSVAIWLRNRYSRTW 302


>gi|307151019|ref|YP_003886403.1| phosphate ABC transporter inner membrane subunit PstA [Cyanothece
           sp. PCC 7822]
 gi|306981247|gb|ADN13128.1| phosphate ABC transporter, inner membrane subunit PstA [Cyanothece
           sp. PCC 7822]
          Length = 298

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 91/236 (38%), Positives = 146/236 (61%), Gaps = 2/236 (0%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GF I   S  P+  GI  A+V S+ + ++VI ++ P+G+ +A+YLEE++ +  +++ ++ 
Sbjct: 65  GFLIETPSRFPDQGGIRPAIVSSILLGIVVILVAVPIGVGAALYLEEYAPRNGWTAIIEI 124

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI+NLA VPSIVYG+LG  V  N+        + G L L+L++LP II+    A+R VP 
Sbjct: 125 NISNLAGVPSIVYGLLGLGVF-NYLLGFGPVLISGALTLSLLSLPVIIVTAREAIRAVPD 183

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           S+R+A+ GLG +K QT+ +HV+P A+P ILTG  +S++RA+G+ A L+ VG V F+T  P
Sbjct: 184 SLRNASYGLGITKWQTLSNHVIPYAIPGILTGVIISVSRAIGDAASLIVVGAVGFLTFNP 243

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            G+     A P+QIY +    E  F       I+ L+  +  +N   +++R RF +
Sbjct: 244 -GLFQRFMALPIQIYSYITRPEPGFANAAAATIIALIALVLALNGVAIYIRQRFSR 298


>gi|332705022|ref|ZP_08425107.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1, membrane
           protein 2 [Lyngbya majuscula 3L]
 gi|332356199|gb|EGJ35654.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1, membrane
           protein 2 [Lyngbya majuscula 3L]
          Length = 320

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 145/265 (54%), Gaps = 29/265 (10%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF +  S R E AGI  A VG+  +ML+    + P+G+AS IYLEE+S K   + F++ N
Sbjct: 57  FFTSFPSRRAEKAGIMSAWVGTSLVMLVTALAAVPIGVASGIYLEEYSRKNLLADFIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + NLA VPSIVYG+L   + +    + RS  L  GL LAL+ LP +I+ T  ALR +P+ 
Sbjct: 117 VTNLAGVPSIVYGLLALGLFVYELNLGRSI-LSAGLTLALLILPVVIVTTREALRAIPNH 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV---TD 365
           +R AA  LGASK Q ++ HVLP +  +ILTG  + L+RA+GETAP++ +G + F+    D
Sbjct: 176 LREAAYALGASKWQMIWDHVLPYSFGSILTGVIIGLSRAIGETAPVVTIGALVFIRFLPD 235

Query: 366 YPVG-----------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILL 402
            P+                        V    T  P+Q++ W +  ER F      A  +
Sbjct: 236 SPLNSAFPYIPFQGEFPYLNLQQLFAWVQAEFTVMPIQMFTWVSRPERAFEANAAAAGTV 295

Query: 403 LLIFLAVINTAMLWLRNRFKK--RW 425
           L+     +N   ++LR RF+K  +W
Sbjct: 296 LIAMTLAMNGIAIYLRYRFRKGLKW 320


>gi|51891900|ref|YP_074591.1| phosphate ABC transporter permease protein [Symbiobacterium
           thermophilum IAM 14863]
 gi|51855589|dbj|BAD39747.1| phosphate ABC transporter permease protein [Symbiobacterium
           thermophilum IAM 14863]
          Length = 283

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 145/246 (58%), Gaps = 8/246 (3%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH-------K 238
           ++ F  + AS   +  GI   +VGS Y++++    + P+G+A+A++LE ++        +
Sbjct: 36  SWSFLTSHASRFADRTGILAPLVGSFYVIVLTAAFALPVGVATAVFLEFYAEGDRPSPLR 95

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
              + F++ NI+NLA VPSIVYG+ G A  + + +  RS      L LALM LP II+ T
Sbjct: 96  QSLTQFLKLNIDNLAGVPSIVYGLFGLAFFVRWMQFGRSILAAA-LTLALMVLPVIIVNT 154

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             A+R VP S+   A  LGASK Q +F  +LP A+  ILT + +S++RALGE+APLL VG
Sbjct: 155 REAIRAVPPSLAHGAYALGASKTQVIFTVILPAALGGILTATILSVSRALGESAPLLAVG 214

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
              +VT  P    D  T  PVQIY WA   ++ F E     IL+LL  L  +N   +WLR
Sbjct: 215 AWVYVTSLPRTPLDSFTVLPVQIYYWAGMPQKAFQEVASAGILVLLALLLSLNGIAIWLR 274

Query: 419 NRFKKR 424
           N+++K+
Sbjct: 275 NKYQKK 280


>gi|319892601|ref|YP_004149476.1| Phosphate transport system permease protein PstA [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317162297|gb|ADV05840.1| Phosphate transport system permease protein PstA [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323464359|gb|ADX76512.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           pseudintermedius ED99]
          Length = 293

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 154/237 (64%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS    AG+  A++G+L++M+ +I ++  LG+ SAIYLEE++    F+ F++ N
Sbjct: 58  FFTNFSSSSASSAGVKGALIGTLWLMMTLIPIALVLGVGSAIYLEEYAKDNAFTKFIRVN 117

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLASVPSIVYG+LG+ + +   ++  S      L LAL+ LP II+A+  A+R+VP S
Sbjct: 118 ISNLASVPSIVYGLLGATIFVALLQLGNSVIAAA-LTLALLILPVIIVASQEAIRSVPQS 176

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           ++ A+ GLGA+K QT+   VLP A+P I+TG  ++++RA+GETAPL+ +G+   +   P 
Sbjct: 177 VKEASYGLGANKWQTIQQVVLPAAIPGIITGVILAISRAIGETAPLVAIGIPTILLRTPN 236

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            + D     P+QIY WA      F   +  AI++LL  L ++NT  + +RN++  ++
Sbjct: 237 SILDSFQTLPLQIYDWARKPGIDFQALSSAAIIVLLAILLILNTIAVIIRNKYSNKY 293


>gi|75906272|ref|YP_320568.1| phosphate ABC transporter permease [Anabaena variabilis ATCC 29413]
 gi|75699997|gb|ABA19673.1| phosphate ABC transporter membrane protein 2, PhoT family [Anabaena
           variabilis ATCC 29413]
          Length = 299

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 147/237 (62%), Gaps = 2/237 (0%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GF     S  P+  GI  A++ S+ + L+VI ++ P+G+ +A+YLEE++ K ++++ ++ 
Sbjct: 65  GFLTETPSRFPDEGGIRPAIISSILLGLVVIFVTVPIGVGAALYLEEYAPKVWWTAIIEI 124

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI+NLA VPSIVYG+LG  V  N+        + G L L+L++LP II+ +  A+R VP 
Sbjct: 125 NISNLAGVPSIVYGLLGLGVF-NYLLGFGPALISGALTLSLLSLPVIIVTSREAIRAVPD 183

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           S+R+A+ GLG +K QT+  HV+P A+P ILTG  +S++RA+G+ A L+ VG V F+T  P
Sbjct: 184 SLRNASYGLGVTKWQTIRSHVIPYAIPGILTGVIISVSRAIGDAASLIVVGAVGFLTFDP 243

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            G+     A P+QIY +    E  F       I+ LL  + ++N   +++R RF  R
Sbjct: 244 -GLFQRFMALPIQIYSYITRPEPGFASAAAATIIALLSLILLLNGVAIYIRQRFSLR 299


>gi|42523160|ref|NP_968540.1| phosphate ABC transporter, permease protein [Bdellovibrio
           bacteriovorus HD100]
 gi|39575365|emb|CAE79533.1| phosphate ABC transporter, permease protein [Bdellovibrio
           bacteriovorus HD100]
          Length = 305

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 146/252 (57%), Gaps = 14/252 (5%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  FF+N  S   E AGI  A VGS  +ML     + PLGIA+ +YLEE+S K + S  +
Sbjct: 52  NAEFFVNFPSRFAEKAGILSAWVGSFLIMLTTAFCAIPLGIAAGVYLEEYSKKNWVSQII 111

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI NLA +PSI YG++   + +   K+ +S    G L L L+ LP II+ T  A+R++
Sbjct: 112 ELNIINLAGIPSITYGLMALGLFVYKLKLGQSILTAG-LTLGLLVLPIIIVTTREAIRSI 170

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P++IR A+  +GASK QT+ +H+LP +   ILTG  +SL+RA+GETAPL+ +G + F+  
Sbjct: 171 PNTIREASYAMGASKWQTIRYHILPYSSGGILTGVIISLSRAIGETAPLITIGALTFIAF 230

Query: 366 YPVG-------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
            P               + D  T  P+Q++ W +  +  F        ++LL+   ++N 
Sbjct: 231 LPTPPIDGQFPYVNFTWLMDPFTVMPIQMFNWLSRPQPEFHVNAAATGVVLLVMTLIMNG 290

Query: 413 AMLWLRNRFKKR 424
             ++LR+RF+K+
Sbjct: 291 GAIYLRSRFRKK 302


>gi|284165752|ref|YP_003404031.1| phosphate ABC transporter inner membrane protein [Haloterrigena
           turkmenica DSM 5511]
 gi|284015407|gb|ADB61358.1| phosphate ABC transporter, inner membrane subunit PstA
           [Haloterrigena turkmenica DSM 5511]
          Length = 296

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 154/251 (61%), Gaps = 9/251 (3%)

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           D   +LD+   F  N     P  AG   A+VGS+ +ML++  ++FPLG+ +AIYLEE++ 
Sbjct: 50  DAVGWLDWQ--FLTNPPHPDPFQAGFLPAIVGSIAIMLVIALVTFPLGVGAAIYLEEYAG 107

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
            G+ + F+Q NI NLA VPS+VYG+LG  + +  F +   + L     +AL+ LP +II+
Sbjct: 108 DGYLTKFIQLNIANLAGVPSVVYGLLGLGLFVGLFSIGYGSVLAAAFTIALLILPIVIIS 167

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
              A+R+VP S R A+ G+GA+K QT+ + VLP AMP I+TG+ ++L RA+GETAPL+ +
Sbjct: 168 AQEAIRSVPDSQRQASYGMGATKWQTIRNVVLPRAMPGIMTGTILALGRAIGETAPLIMI 227

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAI----LLLLIFLAVINTA 413
                V   P G     +A P+QIY WA+    P  E  +G +    + LL+ L  IN+ 
Sbjct: 228 AAPTTVFGLPNGPFSKVSAMPLQIYNWAS---YPQTEFQYGVVAAGVVTLLVVLLTINSI 284

Query: 414 MLWLRNRFKKR 424
            + +RNR+++R
Sbjct: 285 AIVIRNRYQQR 295


>gi|298505211|gb|ADI83934.1| phosphate ABC transporter, membrane protein PstA [Geobacter
           sulfurreducens KN400]
          Length = 306

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 154/266 (57%), Gaps = 16/266 (6%)

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
           F +L +DGA  L  +  FF +  S  PE AGI  A VG++ +ML+   ++ PLG+A+ +Y
Sbjct: 41  FAQLVADGAPRLKPH--FFTSFPSRFPEEAGILSAWVGTILVMLVTAFVAVPLGVAAGVY 98

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           LEE++ K + ++ ++ N+ NLA VPSIV+G+L   + +      +S  L  GL LAL+ L
Sbjct: 99  LEEYAPKNWLTAIIEINVTNLAGVPSIVFGLLALGLFVYQLNFGQSI-LSAGLTLALLIL 157

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I+AT  +LR VP SIR AA  LGA++ Q V +HVLP +   ILTG  + L+RA+GET
Sbjct: 158 PIVIVATRESLRAVPGSIREAAYALGATRWQMVSNHVLPYSSSGILTGVIIGLSRAIGET 217

Query: 352 APLLFVG---MVAFVTDYPVG----------VTDIATAFPVQIYLWAADAERPFVERTFG 398
           AP++ +G    +AF+   PV           + D  T  P+Q++ W +  E  F      
Sbjct: 218 APVITIGALTFIAFLPHSPVSGQFPFISFEWLKDPFTVMPIQMFNWTSRPEEEFQLNAAA 277

Query: 399 AILLLLIFLAVINTAMLWLRNRFKKR 424
           A ++LL     +N   ++LR   +K+
Sbjct: 278 AGVVLLAMTLAMNAVAIFLRYHIRKK 303


>gi|223043190|ref|ZP_03613237.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           capitis SK14]
 gi|314933565|ref|ZP_07840930.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           caprae C87]
 gi|222443401|gb|EEE49499.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           capitis SK14]
 gi|313653715|gb|EFS17472.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           caprae C87]
          Length = 301

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 152/237 (64%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AGI  A+VGS+++++ +I ++  LGI +AIYLEE++    F+S V+ +
Sbjct: 66  FFTNFSSSTPADAGIKGALVGSIWLIVTIIPITIILGIGTAIYLEEYAKDNIFTSIVKIS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPSIV+G+LG  + +    M  S      L ++L+ LP II+++  A+R VP S
Sbjct: 126 ISNLAGVPSIVFGLLGYTLFVGAAGMGNSVLAAA-LAMSLLILPVIIVSSQEAIRAVPGS 184

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +   P 
Sbjct: 185 VREASFGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVVIGIPTILLATPS 244

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           G+ D  +A P QIY WA   +  F       I++LLI L  +N   + LRN+F K++
Sbjct: 245 GLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLIILLAMNAVAILLRNKFSKKY 301


>gi|39996199|ref|NP_952150.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Geobacter sulfurreducens PCA]
 gi|39982964|gb|AAR34423.1| phosphate ABC transporter, permease protein [Geobacter
           sulfurreducens PCA]
          Length = 306

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 154/266 (57%), Gaps = 16/266 (6%)

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
           F +L +DGA  L  +  FF +  S  PE AGI  A VG++ +ML+   ++ PLG+A+ +Y
Sbjct: 41  FAQLVADGAPRLKPH--FFTSFPSRFPEEAGILSAWVGTILVMLVTAFVAVPLGVAAGVY 98

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           LEE++ K + ++ ++ N+ NLA VPSIV+G+L   + +      +S  L  GL LAL+ L
Sbjct: 99  LEEYAPKNWLTAIIEINVTNLAGVPSIVFGLLALGLFVYQLNFGQSI-LSAGLTLALLIL 157

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I+AT  +LR VP SIR AA  LGA++ Q V +HVLP +   ILTG  + L+RA+GET
Sbjct: 158 PIVIVATRESLRAVPGSIREAAYALGATRWQMVSNHVLPYSSSGILTGVIIGLSRAIGET 217

Query: 352 APLLFVG---MVAFVTDYPVG----------VTDIATAFPVQIYLWAADAERPFVERTFG 398
           AP++ +G    +AF+   P+           + D  T  P+Q++ W +  E  F      
Sbjct: 218 APVITIGALTFIAFLPHSPISGQFPFISFEWLKDPFTVMPIQMFNWTSRPEEEFQLNAAA 277

Query: 399 AILLLLIFLAVINTAMLWLRNRFKKR 424
           A ++LL     +N   ++LR   +K+
Sbjct: 278 AGVVLLAMTLAMNAVAIFLRYHIRKK 303


>gi|325108977|ref|YP_004270045.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Planctomyces brasiliensis DSM 5305]
 gi|324969245|gb|ADY60023.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Planctomyces brasiliensis DSM 5305]
          Length = 347

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 150/276 (54%), Gaps = 41/276 (14%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F     S +PE +G+   + GSL++M++    S P+G+ +A+YLEE+S    F+ F++ N
Sbjct: 70  FLTEHMSRKPEQSGMIAGIWGSLWLMVMTGFFSIPIGVGAAVYLEEYSKPNRFTRFIRLN 129

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL----------------- 291
           I NLA VPSIV+GILG  V    F +  +   V GL L +  L                 
Sbjct: 130 IANLAGVPSIVFGILGLTVFSRMFGL-FADGAVRGLPLGIGVLYIPLPFGKTLLSGSLTL 188

Query: 292 -----PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR 346
                P +IIA+  ALR+VP SIR AAL LGA+K QT++H VLP ++P I+TG  ++L+R
Sbjct: 189 SLLILPIVIIASQEALRSVPQSIRHAALALGATKWQTIWHQVLPASLPGIMTGVILALSR 248

Query: 347 ALGETAPLLFVGMVAFVTDYPVGVTDIA-----------------TAFPVQIYLWAADAE 389
           A+GETAPL+ +G   ++   P G+  +                  TA P+QIY W +   
Sbjct: 249 AIGETAPLIVIGAATYIRFNPGGMERVTDYFTTPQTLLSVPSSQFTAMPLQIYEWVSHQP 308

Query: 390 RP-FVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            P F      AI++LL  L ++N   +++R+ F KR
Sbjct: 309 NPEFKNVAAAAIVVLLAILLLMNGLAVYIRHHFSKR 344


>gi|284166705|ref|YP_003404984.1| phosphate ABC transporter inner membrane protein [Haloterrigena
           turkmenica DSM 5511]
 gi|284016360|gb|ADB62311.1| phosphate ABC transporter, inner membrane subunit PstA
           [Haloterrigena turkmenica DSM 5511]
          Length = 587

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 143/240 (59%), Gaps = 5/240 (2%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK----GFFSSF 244
           F    ASS    AG    +VGS+ ++  V  +SF LG+ SA++LEE++      G  +  
Sbjct: 348 FVTGSASSTARDAGFYPPIVGSVMIIAFVALVSFVLGVGSAVFLEEYASDSGITGAITRV 407

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           +Q NI NLA+VPS+VYG+LG  + IN   +     +   L L+L+ LP  II+   A+R+
Sbjct: 408 IQINIANLAAVPSVVYGLLGLGLFINLLGLGMGAIVTAVLTLSLLILPITIISAQEAIRS 467

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP  +R+ +  +GA++ QT  + VLP A P ILTG+ ++L RA+GETAPL+ +G+     
Sbjct: 468 VPDDLRNGSYAMGATRWQTTRNVVLPEAFPGILTGTILALGRAIGETAPLIIIGVPHLTY 527

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV-INTAMLWLRNRFKK 423
             P G+ D A+A P+QIY+W+  A   F      A ++ L+F+ + +N   + LRNRF++
Sbjct: 528 SPPNGIWDKASAMPLQIYVWSHSAIGEFRYGVLAAGVVTLLFVLIGMNATAIILRNRFER 587


>gi|325971508|ref|YP_004247699.1| phosphate ABC transporter inner membrane subunit PstA [Spirochaeta
           sp. Buddy]
 gi|324026746|gb|ADY13505.1| phosphate ABC transporter, inner membrane subunit PstA [Spirochaeta
           sp. Buddy]
          Length = 419

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 152/255 (59%), Gaps = 15/255 (5%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
             + F +   S+ P  AGI  A++GSL+++LI    +FP+G+ SA+YL+E++     S  
Sbjct: 160 LTFDFLVADQSANPLYAGIRTALLGSLWIILITFLFAFPIGVGSAVYLQEYAPDTKVSRI 219

Query: 245 VQANINNLASVPSIVYGILGSAVLI---------NFFKMPRSTALVGGLILALMTL---- 291
           +Q NI NL++VPSI+YG+LG AV +         +FF     +   G  IL+        
Sbjct: 220 LQLNIFNLSAVPSIIYGLLGLAVFVRAMEGFTSGSFFSRVADSTANGRTILSGGLTLGLL 279

Query: 292 --PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
             P III T  AL+ VP ++R ++ G+GA+K QT++  VLP+++  ILTG+ ++L+RALG
Sbjct: 280 VLPIIIINTQEALKAVPDTLRMSSYGIGATKWQTIWGQVLPVSIDRILTGTILALSRALG 339

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           ETAPL+ +G   F++  P G+    T  P+QIY W+A  +  +      AI+ LLI L  
Sbjct: 340 ETAPLVVIGASTFISVDPSGIFSKFTTLPIQIYQWSARPQGAYRNVAGAAIIALLILLMA 399

Query: 410 INTAMLWLRNRFKKR 424
           +N++ + LR++  K+
Sbjct: 400 LNSSAIILRDKLSKK 414


>gi|158333403|ref|YP_001514575.1| phosphate ABC transporter permease PstA [Acaryochloris marina
           MBIC11017]
 gi|158303644|gb|ABW25261.1| phosphate ABC transporter, permease protein PstA [Acaryochloris
           marina MBIC11017]
          Length = 311

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 160/254 (62%), Gaps = 8/254 (3%)

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           SDGA  L  +  F  +  S +   AG+  A++G+++++ I   ++FP+G+ S I+LEEF+
Sbjct: 58  SDGASSLSVD--FLTSPPSRKAAKAGLWPALMGTVWLLCITAAVAFPIGVGSGIFLEEFA 115

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK--MPRSTALVGGLILALMTLPSI 294
               F+  ++ N+ NLA+VPSIVYG+LG  V ++  +     S+ L GGL LAL+ LP I
Sbjct: 116 PDNLFTRIIEINVGNLAAVPSIVYGLLGLTVFVDIMRPITGGSSVLAGGLTLALLILPII 175

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I++T  ALR VPSS+R     LGA++ Q +   V P ++P ILTG+ ++L+RA+GETAP+
Sbjct: 176 IVSTREALRAVPSSLRQGGFALGATRWQVIRDLVFPQSLPGILTGTILALSRAIGETAPI 235

Query: 355 LFVGMVAFVTDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
           L VG   ++   P     G+    TA P+QIY+W A A++ F     G I++LL+ L ++
Sbjct: 236 LVVGAAGYIAFAPPLSLEGLQSDFTALPIQIYVWIARAQKSFEPIAAGGIIILLVVLLLM 295

Query: 411 NTAMLWLRNRFKKR 424
           NT  + LRN+F+ +
Sbjct: 296 NTTAILLRNKFQNQ 309


>gi|73662672|ref|YP_301453.1| phosphate ABC transporter permease [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72495187|dbj|BAE18508.1| ABC-type phosphate transport system permease component
           [Staphylococcus saprophyticus subsp. saprophyticus ATCC
           15305]
          Length = 305

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 89/230 (38%), Positives = 149/230 (64%), Gaps = 4/230 (1%)

Query: 200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIV 259
           +AGI  A++G++++M+ +I +S  LG+ +AIYLEE++    F+SF++ +I+NLA VPS+V
Sbjct: 76  MAGIKGALIGTVWLMITIIPISIILGVGTAIYLEEYAKDNAFTSFIKVSISNLAGVPSVV 135

Query: 260 YGILGSAVLINFFKMPR----STALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALG 315
           +G+LG  + +    +      ++ L   L ++L+ LP II+A+  A+R VP+S+R A+ G
Sbjct: 136 FGLLGLTIFVRGMGIESLALGNSILAAALTMSLLILPVIIVASQEAIRAVPNSVREASYG 195

Query: 316 LGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIAT 375
           LG +K QT+   VLP A+P ILTG  ++L+RALGETAPL+ +G+   +   P  + D   
Sbjct: 196 LGGNKWQTIRRVVLPAAIPGILTGFILALSRALGETAPLILIGIPTVLLQLPSSIFDQFQ 255

Query: 376 AFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           A P+ IY WA   +  F       I++LL+ L ++N   ++LRN++ K++
Sbjct: 256 ALPMAIYNWAKLPQAEFQNVASAGIIVLLVILLLMNAIAIFLRNKYSKKF 305


>gi|186684856|ref|YP_001868052.1| phosphate ABC transporter inner membrane subunit PstA [Nostoc
           punctiforme PCC 73102]
 gi|186467308|gb|ACC83109.1| phosphate ABC transporter, inner membrane subunit PstA [Nostoc
           punctiforme PCC 73102]
          Length = 299

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 147/237 (62%), Gaps = 2/237 (0%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GF     S  P+  GI  A++ S+ +  +VI ++ P+G+ +A+YLEE++ K ++++ ++ 
Sbjct: 65  GFLTETPSRFPDQGGIRPAIISSVLLGTVVILVTVPIGVGAALYLEEYAPKAWWTAIIEI 124

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI+NLA VPSIVYG+LG  V  N+        + G L L+L++LP II+    A+R VP 
Sbjct: 125 NISNLAGVPSIVYGLLGLGVF-NYLLGFGPALISGALTLSLLSLPVIIVTAREAIRAVPD 183

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           S+R+A+ GLG +K +T+  HVLP A+P ILTG  +S++RA+G+ A L+ VG V F+T  P
Sbjct: 184 SLRNASYGLGVTKWRTISSHVLPYAIPGILTGVIISVSRAIGDAASLIVVGAVGFLTFDP 243

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            G+     A P+QIY +    E  F +     I+ LL+ + V+N   +++R RF  R
Sbjct: 244 -GLFQRFMALPIQIYSYITRPEPGFADAAAATIIALLLLILVLNGVAIYIRQRFSIR 299


>gi|217968824|ref|YP_002354058.1| phosphate ABC transporter inner membrane subunit PstA [Thauera sp.
           MZ1T]
 gi|217506151|gb|ACK53162.1| phosphate ABC transporter, inner membrane subunit PstA [Thauera sp.
           MZ1T]
          Length = 307

 Score =  153 bits (386), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 140/251 (55%), Gaps = 14/251 (5%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  FF +  S R   AGI  A VGSL +ML+    + PLG+A+ +YLEE++ K   +  +
Sbjct: 54  NPDFFTSFPSRRAANAGILSAWVGSLLVMLVTALSAVPLGVAAGVYLEEYAPKNLVTDII 113

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + N+ NLA VPSIVYG+L   V +  F   +S    G  +  L+ LP II+AT  ALR +
Sbjct: 114 EINVTNLAGVPSIVYGLLALGVFVYMFGFGQSVLTAGLTLGLLI-LPVIIVATREALRAI 172

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P  +R  A G GA++ Q V  H++P A P I+TG  + L+RA+GETAP++ +G + F+  
Sbjct: 173 PVHVREGAYGCGATQWQVVSDHLVPYATPGIMTGVIIGLSRAIGETAPIITIGALTFIAF 232

Query: 366 YPVG-VTDIA------------TAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
            P   ++  A            T  P+Q++ W +  E  F +    A L+L++   ++N 
Sbjct: 233 LPASPISSTAPFINFDWLWSGFTVMPIQMFNWTSRPEEAFQQNAAAAGLILVLMTLLMNA 292

Query: 413 AMLWLRNRFKK 423
             +WLR R +K
Sbjct: 293 LAIWLRYRLRK 303


>gi|257093587|ref|YP_003167228.1| phosphate ABC transporter inner membrane subunit PstA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046111|gb|ACV35299.1| phosphate ABC transporter, inner membrane subunit PstA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 318

 Score =  152 bits (384), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 149/256 (58%), Gaps = 14/256 (5%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           F   ++ FF +  S R   AGI  A VG++ +ML+   ++ PLG+ + IYLEE++ K   
Sbjct: 61  FPHLSWDFFTSFPSRRAASAGILSAWVGTILVMLVTAVVAVPLGVGAGIYLEEYAPKNLL 120

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ N+ NLA VPSI+YG+L  A+ +  F + +S A  G L LAL+ LP +I+AT  A
Sbjct: 121 TDIIEINVTNLAGVPSIIYGLLALALFVYQFGLGQSIAAAG-LTLALLILPVVIVATREA 179

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG--- 358
           +RT+P  IR  A   GA+K Q V HH++P ++P I+TG  + LARA+GETAP++ +G   
Sbjct: 180 IRTIPQQIREGAYACGATKWQVVAHHIVPYSLPGIMTGVIIGLARAIGETAPIITIGALT 239

Query: 359 MVAFVTDYPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
            +AF+   P G          +T   T  P+Q++ W +  E  F      A L+L++   
Sbjct: 240 FIAFLPPSPFGNPGHLISFDWLTAPFTVMPIQMFNWISRPEAAFQANAAAAGLVLVVMTL 299

Query: 409 VINTAMLWLRNRFKKR 424
            +N   +W+R  F+KR
Sbjct: 300 SMNAIAIWIRYHFRKR 315


>gi|302342496|ref|YP_003807025.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfarculus baarsii DSM 2075]
 gi|301639109|gb|ADK84431.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfarculus baarsii DSM 2075]
          Length = 290

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/228 (38%), Positives = 136/228 (59%), Gaps = 7/228 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+LY+ +  I +S PLG+A+AIYL E++  G     V+  I NLA VPS+V+
Sbjct: 63  GGIFPAIVGTLYLTIGAIVVSLPLGVAAAIYLSEYARDGRLLQIVRLGIQNLAGVPSVVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ + FF M  S  L G L L L+ LP++I A+  ALR VP + R A+L LGA++
Sbjct: 123 GLFGLALFVGFFGMGISM-LAGSLTLGLLVLPTVIGASEEALRQVPPTFREASLALGATR 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            +T++  VLP A+P ILTGS ++L RA GETAP++F  +  +    P        A P  
Sbjct: 182 WETIYKVVLPAALPGILTGSILALGRAAGETAPIMFTAVTFYTLHLPTSPLHEVMALPYH 241

Query: 381 IYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ A       +E+T    +G +L+L+  +  ++   + +R R +K+
Sbjct: 242 VYVLATAGTH--IEQTRPLQYGTVLVLIALVLGLSLVAVIIRTRMRKK 287


>gi|228967337|ref|ZP_04128372.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228792372|gb|EEM39939.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 237

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 124/194 (63%), Gaps = 1/194 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F   V+ N
Sbjct: 45  FFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKKIVEIN 104

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA VPS+V+G+LG  + +    +  S  +   L ++L+ LP++++A+  A+R+VPS 
Sbjct: 105 NQTLAGVPSVVFGLLGLTIFVYALHLGESI-VAAALTMSLLVLPTVVVASQEAIRSVPSV 163

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF    P 
Sbjct: 164 LLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFANYVPF 223

Query: 369 GVTDIATAFPVQIY 382
            + D  T  P+QI+
Sbjct: 224 SMFDRFTVLPIQIF 237


>gi|237712827|ref|ZP_04543308.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262408816|ref|ZP_06085361.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_22]
 gi|294648190|ref|ZP_06725730.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           ovatus SD CC 2a]
 gi|294810768|ref|ZP_06769416.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           xylanisolvens SD CC 1b]
 gi|229447155|gb|EEO52946.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262353027|gb|EEZ02122.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_22]
 gi|292636465|gb|EFF54943.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           ovatus SD CC 2a]
 gi|294442101|gb|EFG10920.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           xylanisolvens SD CC 1b]
          Length = 291

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 133/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P G+ D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTGIFDQCMALPYH 241

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +      +A+ P     +G  L+L++ +  +N     LR  F+KR
Sbjct: 242 LYVISTSGTDMEAQLPL---AYGTALVLIMIILFVNLLANALRKYFEKR 287


>gi|298484080|ref|ZP_07002248.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           D22]
 gi|298269761|gb|EFI11354.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           D22]
          Length = 291

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 133/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P G+ D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTGIFDQCMALPYH 241

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +      +A+ P     +G  L+L++ +  +N     LR  F+KR
Sbjct: 242 LYVISTSGTDMEAQLPL---AYGTALVLIMIILFVNLLANALRKYFEKR 287


>gi|297583766|ref|YP_003699546.1| phosphate ABC transporter inner membrane subunit PstA [Bacillus
           selenitireducens MLS10]
 gi|297142223|gb|ADH98980.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           selenitireducens MLS10]
          Length = 285

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 89/229 (38%), Positives = 140/229 (61%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+  + + +S P+GI +AIYL E++ +G F   ++ +I NLA VPSIVY
Sbjct: 57  GGIWPALVGTFYVASLTVLISVPVGIGAAIYLNEYARQGKFVRLIRLSIRNLAGVPSIVY 116

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+  +F ++     +   + LA+M LP +I A+  AL++VP+S R   L LGA+K
Sbjct: 117 GLFGLAIFASFLRIGVGL-ITAAITLAIMVLPWVITASEEALKSVPASFREGGLALGATK 175

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A+P ++TGS + LARA GETAP++  G   +  + P  +TD   A P  
Sbjct: 176 WQTIRQLVLPSAVPGMMTGSILGLARAAGETAPIILTGAAYYSRNLPTELTDSFMALPYH 235

Query: 381 IYLWA-----ADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ A     A A RP     +G  L+L++ + ++N + + +RNRF+ R
Sbjct: 236 LYILATQHAQASAVRPI---AYGTALVLIMLVILLNLSAILIRNRFRNR 281


>gi|302391643|ref|YP_003827463.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Acetohalobium arabaticum DSM 5501]
 gi|302203720|gb|ADL12398.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Acetohalobium arabaticum DSM 5501]
          Length = 283

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 137/243 (56%), Gaps = 11/243 (4%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+GF            GI  A+VG+  + LI   ++ PLGI +AIYL E++++G  +  +
Sbjct: 42  NWGFITEAPKQGMTAGGIWPAIVGTFLVTLITAAVAIPLGIFAAIYLNEYANQGKITRLI 101

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + +I NLA VPSIVYG+ G A  +N   +  S  L  GL L LMTLP  I A+  AL+ V
Sbjct: 102 RMSIRNLAGVPSIVYGLFGLAFFVNILGLGTSV-LSAGLTLGLMTLPVTITASEEALKAV 160

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R  AL LGASK  ++  +VLP A+P ILTG+ + LARA GETAP+LF G   F+  
Sbjct: 161 PDAYRQGALALGASKWYSIRTNVLPHAIPGILTGTILGLARAAGETAPILFTGAAFFLPF 220

Query: 366 YPVGVTDIATAFPVQIYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAML---WL 417
            P  ++    A P  +Y+ A         RP    T  A++L+ + LA+   A+L   WL
Sbjct: 221 LPKSLSSQFMALPYHLYIMATQHHDIAQVRPLAYGT--ALVLITLVLAMNLIAILLRFWL 278

Query: 418 RNR 420
           R +
Sbjct: 279 RKK 281


>gi|283780574|ref|YP_003371329.1| phosphate ABC transporter, inner membrane subunit PstA [Pirellula
           staleyi DSM 6068]
 gi|283439027|gb|ADB17469.1| phosphate ABC transporter, inner membrane subunit PstA [Pirellula
           staleyi DSM 6068]
          Length = 318

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 157/265 (59%), Gaps = 18/265 (6%)

Query: 174 KLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLE 233
            L  DG  +   N  F  N  S + E AGI  A VGS  ++++ +  + PLGIA+A+YLE
Sbjct: 55  DLIHDG--YSSLNLDFLRNFPSRKAERAGILSASVGSFAIIVVTLVTAVPLGIAAAVYLE 112

Query: 234 EFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPS 293
           E++ K F ++ ++ NI+NLA VPSI+YG++   +L+  F + R   LVGGL LA + LP 
Sbjct: 113 EYAPKNFITTLIEINISNLAGVPSIIYGLMALGILVYQFNLGRCI-LVGGLTLATLVLPI 171

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +I++T  A+R +P++IR AA   GA+K Q + +H++P ++  I TG+ ++++RALGETAP
Sbjct: 172 VIVSTREAIRAIPAAIREAAYAAGATKWQVIRYHLIPYSIGGIATGTIIAMSRALGETAP 231

Query: 354 LLFVG---MVAFVTDYPVGVTDIA-----------TAFPVQIYLWAADAERPFVERTFGA 399
           L+ +G    VAF+   P+  +++            T  P+Q++ W +     F  R    
Sbjct: 232 LITIGALSYVAFIPPSPI-TSELPFISFKWLFSGFTVMPIQMFNWVSRPTADFHARAAAT 290

Query: 400 ILLLLIFLAVINTAMLWLRNRFKKR 424
            L+L+ F   +N   +++R + +++
Sbjct: 291 GLVLIFFTLSMNAIAIYVRYQMRRK 315


>gi|71909176|ref|YP_286763.1| phosphate ABC transporter permease [Dechloromonas aromatica RCB]
 gi|71848797|gb|AAZ48293.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Dechloromonas aromatica RCB]
          Length = 312

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 147/255 (57%), Gaps = 19/255 (7%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N AS     AGI  A VGSL +ML+    + P+G+A+ +YLEE++ + + +  ++ N
Sbjct: 59  FFTNFASRHAGQAGILSAWVGSLLVMLVTALAAVPIGVAAGVYLEEYAKRNWITEIIEIN 118

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA+VPSIVYG+L   + +  F   +S  L  GL LAL+ LP +I++T  A+R +P+ 
Sbjct: 119 ITNLAAVPSIVYGLLALGIFVYQFGFGQSI-LSAGLTLALLILPIVIVSTREAIRAIPAM 177

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT---- 364
           IR  ++ +GA++ QT  +H++P AMP ILTG  + LARA+GETAP++ +G + F+     
Sbjct: 178 IREGSMAVGATRWQTCRYHIIPYAMPGILTGVIIGLARAIGETAPIITIGALTFIAFLPP 237

Query: 365 -DYPVGVTDIA-----------TAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
             Y  G   +            T  P+QI+ W +  +  F      A  +L++ +  +N 
Sbjct: 238 VPYTTGADGVTAGLFDWVMSPFTVMPIQIFNWTSRPDPAFEVNAAAAGFVLMVMVLSMNG 297

Query: 413 AMLWLRNRFKK--RW 425
             +WLR + +K  +W
Sbjct: 298 IAIWLRYKMRKNIKW 312


>gi|56751673|ref|YP_172374.1| phosphate ABC transporter permease [Synechococcus elongatus PCC
           6301]
 gi|81301251|ref|YP_401459.1| phosphate ABC transporter permease [Synechococcus elongatus PCC
           7942]
 gi|56686632|dbj|BAD79854.1| ABC-type phosphate transport system permease protein [Synechococcus
           elongatus PCC 6301]
 gi|81170132|gb|ABB58472.1| Phosphate transport system permease protein 2 [Synechococcus
           elongatus PCC 7942]
          Length = 303

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 89/242 (36%), Positives = 142/242 (58%), Gaps = 2/242 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N+ F  +  S RP  AGI  A VG++Y + +V  + FPLG+ + IYLEEF+   +F+  
Sbjct: 61  LNWDFLTSFPSRRPSSAGILSAWVGTVYSIFLVGLIGFPLGVGAGIYLEEFAPDNWFTRL 120

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFK--MPRSTALVGGLILALMTLPSIIIATGVAL 302
           V+ N+NNLA VP+I+YG+LG  + +          + L G L LAL+ LP +I++T  +L
Sbjct: 121 VEINVNNLAGVPAIIYGLLGLELFVRIASPVTGGRSLLSGSLTLALLILPIVIVSTRESL 180

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP S R A   LGA++ Q V   ++P A   ILTG+ + ++RA+GE APL+ +G + F
Sbjct: 181 RAVPDSTRQAGFALGATRWQVVRTIIVPEAASGILTGTILGISRAIGEAAPLITIGALTF 240

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           ++  P  +    T  P+QI+ W +  +  F      AI++LL  L  +N+  + +RN+ +
Sbjct: 241 ISFLPDNLQSPFTVLPIQIFNWVSRPQAEFQNLAAAAIIVLLAILLTMNSIAIVIRNKLQ 300

Query: 423 KR 424
            +
Sbjct: 301 VK 302


>gi|85859335|ref|YP_461537.1| phosphate ABC transporter permease [Syntrophus aciditrophicus SB]
 gi|85722426|gb|ABC77369.1| ABC-type phosphate transport system, permease component [Syntrophus
           aciditrophicus SB]
          Length = 291

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 136/246 (55%), Gaps = 9/246 (3%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ F  +         GI  A++G+LY+ L  I ++ PLGIASA+YL E++ +G     +
Sbjct: 49  NWEFLTSPPRDSMTRGGIMPAILGTLYLTLGAITVALPLGIASAVYLTEYARQGLIIRII 108

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +  +N LA +PS+V+G+ G    + F +   S  L G L L  + LP+II A+  AL+ V
Sbjct: 109 RLGVNCLAGIPSVVFGLFGLGFFVVFLQF-GSCILSGALTLGFLVLPTIIGASEEALKAV 167

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R A+L LG SK +T+   VLP A+P ILTGS + + RA GETAP++F     F   
Sbjct: 168 PQTFREASLALGVSKWRTISRIVLPNALPGILTGSILGIGRAAGETAPIMFTAAAFFTAK 227

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRNRF 421
            P  + D   A P  IY+ A    R  +E T    FG  L+L+  +  I+   + +R+R 
Sbjct: 228 LPSSIFDEVMALPYHIYVLATAGTR--IEETRPLQFGTALVLMALVLGIDLFAIIIRSRM 285

Query: 422 --KKRW 425
             KKRW
Sbjct: 286 RKKKRW 291


>gi|46200026|ref|YP_005693.1| phosphate transport system permease protein pstA [Thermus
           thermophilus HB27]
 gi|46197653|gb|AAS82066.1| phosphate transport system permease protein pstA [Thermus
           thermophilus HB27]
          Length = 401

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 142/237 (59%), Gaps = 1/237 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F     S  P  AGIGVA+ G+++++ + +  + P+G+ +AI LEE+  +G  S  ++ N
Sbjct: 166 FLTRPPSRSPLTAGIGVAIWGTVWVLSLALLFAIPVGVGTAILLEEYLREGRLSRILEVN 225

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + NLA VPSIVYG+LG A+ +    +  S      L L L+ +P I++    ALR VP S
Sbjct: 226 LRNLAGVPSIVYGLLGLALFVRGMGLGPSVLAAA-LTLGLLGVPVIVVTAREALRAVPDS 284

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R AA  LGA++ Q VF  V+P A+P ++TG  +S AR +GE APLL VG  A+V  +P 
Sbjct: 285 LRQAAFALGATRRQVVFRVVVPAALPGMVTGVILSAARLMGEAAPLLLVGAAAYVPFFPS 344

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           G     T  PVQIYLW +  +  F       IL++L+ L+V+    L+LRNRF++ W
Sbjct: 345 GPLSQYTVVPVQIYLWISQNQPEFARVAAAGILVMLLLLSVLYLMALYLRNRFRREW 401


>gi|298528290|ref|ZP_07015694.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511942|gb|EFI35844.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 285

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 91/229 (39%), Positives = 131/229 (57%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   +VG++Y+ L  I ++FPLG+ +AIYL EFS  G ++  ++  I NLA VPS+VY
Sbjct: 60  GGIWPCIVGTVYISLGSILVAFPLGVGTAIYLNEFSGGGRWTRIIRMGIINLAGVPSVVY 119

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A  + +  M  S  L G L L    LP II +   ALR VP S R A+L LGA+K
Sbjct: 120 GLFGLAFFVLYLNMGVSL-LAGSLTLGAFILPLIIGSAEEALRNVPQSYREASLALGATK 178

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QTV+  VLP A+P++LTG  + ++RA GETAP++F   V +    P  + D   A P  
Sbjct: 179 WQTVYRMVLPAALPSMLTGMILGVSRAAGETAPIMFTAAVFYTGKIPSSIFDEIMAMPYH 238

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A      D  RP     +G  L L+  +  +N   + +RN+ ++R
Sbjct: 239 IYVLATAGVNIDQTRPL---QYGTALTLMFLVLGLNLVAILVRNKLQRR 284


>gi|237718415|ref|ZP_04548896.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|293371418|ref|ZP_06617849.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           ovatus SD CMC 3f]
 gi|299149070|ref|ZP_07042132.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           3_1_23]
 gi|229452348|gb|EEO58139.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|292633615|gb|EFF52173.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           ovatus SD CMC 3f]
 gi|298513831|gb|EFI37718.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           3_1_23]
          Length = 291

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGRLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P G+ D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTGILDQCMALPYH 241

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +      +A+ P     +G  L+L++ + ++N     LR  F+KR
Sbjct: 242 LYVISTSGTDMEAQLPL---AYGTALVLIMIILLVNLLANALRKYFEKR 287


>gi|325300706|ref|YP_004260623.1| phosphate ABC transporter, inner membrane subunit PstA [Bacteroides
           salanitronis DSM 18170]
 gi|324320259|gb|ADY38150.1| phosphate ABC transporter, inner membrane subunit PstA [Bacteroides
           salanitronis DSM 18170]
          Length = 294

 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 87/245 (35%), Positives = 134/245 (54%), Gaps = 7/245 (2%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ F     +      GI  A+VG+ Y+M+     SFP+G+ S IY+ E++ KG   +F+
Sbjct: 51  NWDFLTQAPTDGMTKGGILPAIVGTFYLMIGSAVFSFPVGVMSGIYMNEYAPKGKMVNFI 110

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +   NNLA +PSIV+G+ G A  +N+     S  + G L L L+ LP +I  T  A + +
Sbjct: 111 RTMTNNLAGIPSIVFGLFGMAFFVNYLDFGDSI-IAGSLTLGLLALPIVIRTTEEAFKDI 169

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P+S R  +L LGA+K QT++  +LP+AMP I+TG  +SL R  GETAP+LF     F+  
Sbjct: 170 PNSYREGSLALGATKAQTIWKVLLPMAMPRIITGLILSLGRVSGETAPILFTCAAYFLPK 229

Query: 366 YPVGVTDIATAFPVQIYLWAA-----DAERPFVERT-FGAILLLLIFLAVINTAMLWLRN 419
            P  + D   A P  +Y+ A      +A+ P    T F  I+++LI   + N    +  N
Sbjct: 230 LPESIFDQCMALPYHLYVIATSGTDIEAQTPIAYGTAFVLIVIVLIMNLLANNIRKYFEN 289

Query: 420 RFKKR 424
           + K +
Sbjct: 290 KLKSK 294


>gi|224535456|ref|ZP_03675995.1| hypothetical protein BACCELL_00319 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522922|gb|EEF92027.1| hypothetical protein BACCELL_00319 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 232

 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 134/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG+   F++   NNL+ +PSIV+
Sbjct: 4   GGIWPAIVGTFYLMIGSALFAFPVGVMSGIYMNEYAPKGWIVRFIRMMTNNLSGIPSIVF 63

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P ++R  +  LGA+K
Sbjct: 64  GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDTLREGSRALGATK 122

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+AMP ++TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 123 LQTIWHVILPMAMPNVITGLILALGRVSGETAPILFTCAAYFLPQLPTSILDQCMALPYH 182

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +      +A+ P     +G  L+L+I +  +N     LR  F+K+
Sbjct: 183 LYVISTSGTDMEAQLPL---AYGTALVLIIIILFVNLLANALRKYFEKK 228


>gi|260173872|ref|ZP_05760284.1| putative ABC transporter permease protein [Bacteroides sp. D2]
 gi|315922135|ref|ZP_07918375.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313696010|gb|EFS32845.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 291

 Score =  149 bits (377), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGRLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P G+ D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTGILDQCMALPYH 241

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +      +A+ P     +G  L+L++ + ++N     LR  F+KR
Sbjct: 242 LYVISTSGTDMEAQLPL---AYGTALVLIMIILLVNLLANALRKYFEKR 287


>gi|119485720|ref|ZP_01619995.1| phosphate ABC transporter, permease protein [Lyngbya sp. PCC 8106]
 gi|119457045|gb|EAW38172.1| phosphate ABC transporter, permease protein [Lyngbya sp. PCC 8106]
          Length = 307

 Score =  149 bits (376), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 95/252 (37%), Positives = 146/252 (57%), Gaps = 16/252 (6%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF +  S +PE AGI  A VG+  +ML+   +S PLG+AS IYLEE+S K + +  ++ N
Sbjct: 57  FFFSFPSRKPEQAGILSAWVGTTLVMLVTAIISVPLGVASGIYLEEYSRKNWIADLIEIN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA VPSIVYG+L   + +    +  S    G L LAL+ LP +I+ T  ALR +P+S
Sbjct: 117 ITNLAGVPSIVYGLLALGLFVYILNLGESVLAAG-LTLALLILPIVIVTTREALRAIPNS 175

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVAFVTD 365
           +R AA  LGASK Q ++ H+LP +  +ILTG  + L+RA+G+TAP++ +G    +AF+ D
Sbjct: 176 LREAAYALGASKWQMIWDHILPYSAGSILTGVIIGLSRAIGQTAPVITIGALTFIAFLPD 235

Query: 366 YPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            P            +    T  P+Q++ W +  E  F      A  +L++    +N   +
Sbjct: 236 APFKGEFPFISFAWLKAPFTVMPIQMFNWVSRPEAEFTVNAAAAGTVLIMMTLTMNALAV 295

Query: 416 WLRNRFKK--RW 425
           +LR +F++  +W
Sbjct: 296 YLRYQFRRGIKW 307


>gi|303248512|ref|ZP_07334770.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio fructosovorans JJ]
 gi|302490132|gb|EFL50052.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio fructosovorans JJ]
          Length = 292

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 89/229 (38%), Positives = 135/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G++Y+ L  + ++FPLG+ASA+YL E++  G     ++  INNLA VPS+V+
Sbjct: 67  GGILPCILGTIYLSLGTMAVAFPLGVASAVYLNEYATPGRTLRLIRLGINNLAGVPSVVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A  + FF +  S  L G L L+++ LP II     AL++VP + R A+LGLGA+K
Sbjct: 127 GLFGLAFFVTFFGLGVSL-LSGILTLSILVLPVIIGTAEEALKSVPQTYREASLGLGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP AMP +LTG+ + L+RA GETA ++F   V F    P  +TD   A P  
Sbjct: 186 WQTIRLVVLPAAMPGMLTGAILGLSRAAGETAAIMFTAAVFFTPYLPTHLTDSVMALPYH 245

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A      D  RP     +G  L+L++ +  +N   +  R + +K+
Sbjct: 246 IYVLATAGTEIDKTRPL---QYGTALVLIVLVLGMNLGAILYRAKLQKK 291


>gi|239908521|ref|YP_002955263.1| putative phosphate transport system permease protein PstA
           [Desulfovibrio magneticus RS-1]
 gi|239798388|dbj|BAH77377.1| putative phosphate transport system permease protein PstA
           [Desulfovibrio magneticus RS-1]
          Length = 292

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 134/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G++Y+ L  + ++FPLG+ASA+YL E++  G     ++  INNLA VPS+V+
Sbjct: 67  GGILPCILGTIYLSLGTMCVAFPLGVASAVYLNEYARPGRTLRLIRLGINNLAGVPSVVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A  + FF +  S  L G L L+++ LP II     AL++VP + R A+LGLGA+K
Sbjct: 127 GLFGLAFFVTFFGLGVSL-LSGILTLSILVLPVIIGTAEEALKSVPQTYREASLGLGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP AMP +LTG+ + L+R  GETA ++F   V F    P  +TD   A P  
Sbjct: 186 WQTIRLVVLPAAMPGMLTGAILGLSRVAGETAAIMFTASVFFTPYLPTNITDSVMALPYH 245

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A      D  RP     +G  L+L++ +  +N   +  R + +K+
Sbjct: 246 IYVLATAGTDIDKTRPL---QYGTALVLIVLVLGMNLGAILYRAKLQKK 291


>gi|160882650|ref|ZP_02063653.1| hypothetical protein BACOVA_00603 [Bacteroides ovatus ATCC 8483]
 gi|156111965|gb|EDO13710.1| hypothetical protein BACOVA_00603 [Bacteroides ovatus ATCC 8483]
          Length = 291

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGRSVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P G+ D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTGILDQCMALPYH 241

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +      +A+ P     +G  L+L++ + ++N     LR  F+KR
Sbjct: 242 LYVISTSGTDMEAQLPL---AYGTALVLIMIILLVNLLANALRKYFEKR 287


>gi|160915027|ref|ZP_02077240.1| hypothetical protein EUBDOL_01035 [Eubacterium dolichum DSM 3991]
 gi|158432826|gb|EDP11115.1| hypothetical protein EUBDOL_01035 [Eubacterium dolichum DSM 3991]
          Length = 415

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 143/226 (63%), Gaps = 6/226 (2%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  +++ +LY++++ + +S PLGIA+AIYL E++ K   + ++++ +  L+ VPSI++
Sbjct: 190 GGIRGSILATLYLIVVALLVSLPLGIAAAIYLREYASKNKLTGWIRSAVEMLSGVPSIIF 249

Query: 261 GILGSAVL---INFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLG 317
           G++G  VL      F    +  L+GGL LA++ LP+II ++  AL  VP S+R A+L LG
Sbjct: 250 GLMGVTVLFPITQLFGATTTNILLGGLTLAVILLPTIIRSSEEALIVVPQSLRDASLSLG 309

Query: 318 ASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAF 377
           AS+ QT+F  VLP A+P ILTG  +S+ R +GE+A L++  M  +V D P  ++   T+ 
Sbjct: 310 ASRSQTIFKVVLPNAIPGILTGVLLSIGRVIGESAALIYT-MGTYVNDAPQLLSQ-GTSL 367

Query: 378 PVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            V IY   + +E+P  E      +++L+F+ ++N ++ W+  RF K
Sbjct: 368 AVHIYNIMS-SEQPNFELACAISIVILVFVLILNISIKWISRRFHK 412


>gi|301059408|ref|ZP_07200330.1| phosphate ABC transporter, permease protein PstA [delta
           proteobacterium NaphS2]
 gi|300446489|gb|EFK10332.1| phosphate ABC transporter, permease protein PstA [delta
           proteobacterium NaphS2]
          Length = 292

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 135/252 (53%), Gaps = 32/252 (12%)

Query: 172 FQKLDSDGALFLDFNYGFFINGAS---------------------SRPEV-----AGIGV 205
           F++  + GA+F  F     INGA+                     ++P V      GI  
Sbjct: 12  FRRRFTQGAMFGFFRIAAVINGAALLVVVYFLVARGWRAINWTFLTQPPVDSMTKGGILP 71

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
            +VG+L + +  I ++ P+G+ASAIYL E++  G     ++  INNLA VPS+V+G+ G 
Sbjct: 72  CIVGTLCLSVGAIVVALPIGVASAIYLNEYARPGRIVRIIRLGINNLAGVPSVVFGLFGL 131

Query: 266 AVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVF 325
           A  + +  M  S  L G L L  MTLP II +T  ALR VP + R A+LGLGA+K QT+ 
Sbjct: 132 AFFVVYLDMGVSI-LAGSLTLGAMTLPVIIGSTEEALRGVPDTYREASLGLGATKWQTIR 190

Query: 326 HHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWA 385
             VLP A+P ILTG+ + L+RA GETAP++F   V F    P  + D   A P  IY+ A
Sbjct: 191 SVVLPAALPGILTGTILGLSRAAGETAPIMFTAAVFFTPSLPTSIFDEIMALPYHIYVLA 250

Query: 386 A-----DAERPF 392
                 +A RP 
Sbjct: 251 TAGTEIEATRPL 262


>gi|15789692|ref|NP_279516.1| phosphate ABC transporter permease [Halobacterium sp. NRC-1]
 gi|169235406|ref|YP_001688606.1| phosphate ABC transporter permease [Halobacterium salinarum R1]
 gi|10580060|gb|AAG18996.1| phosphate ABC transporter permease [Halobacterium sp. NRC-1]
 gi|167726472|emb|CAP13257.1| ABC-type transport system permease protein (probable substrate
           phosphate) [Halobacterium salinarum R1]
          Length = 566

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 148/241 (61%), Gaps = 2/241 (0%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F  +  S+  E AG   ++ GS+ +ML V  L+FP+G+ +AIYLEE++   + +  +
Sbjct: 325 DWAFLTSAHSTNAESAGFYPSIGGSILLMLSVAVLAFPVGVGAAIYLEEYAPDNWLTRVI 384

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
             NI+NLA VPS+VYG+LG  + +     P  T L+GG  L L+ LP III+   A+R+V
Sbjct: 385 DVNISNLAGVPSVVYGLLGFGLFVTHLNRPAGTVLIGGATLGLLILPIIIISAREAIRSV 444

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R+A+ G+GA+K QTV + VLP +   ILTG+ ++L RA+GETAPL+ +G       
Sbjct: 445 PEAQRAASDGMGATKWQTVRNVVLPRSFSGILTGTILALGRAIGETAPLIMIGAPTIKFS 504

Query: 366 YPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P  V++  TA P+Q+Y W++    P  + +     +++L+  L  +N+  + LRN+++ 
Sbjct: 505 LPTQVSETVTAMPLQVYAWSSLYATPDFYTKVVPAGVVVLVTVLLAMNSVAIVLRNKYQS 564

Query: 424 R 424
            
Sbjct: 565 H 565


>gi|171058339|ref|YP_001790688.1| phosphate ABC transporter inner membrane subunit PstA [Leptothrix
           cholodnii SP-6]
 gi|170775784|gb|ACB33923.1| phosphate ABC transporter, inner membrane subunit PstA [Leptothrix
           cholodnii SP-6]
          Length = 306

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 139/250 (55%), Gaps = 14/250 (5%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF +  S R   AGI  A VGS+ +M +   ++ P+GIA A+YLEE++ K +F+  ++ N
Sbjct: 58  FFTSFPSRRAGQAGILSAWVGSILVMGVTALVAVPVGIAGAVYLEEYARKNWFTDVIEIN 117

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA VPSI+YG+L   + +  F + +S    G  +  L+ LP +I  T  ALR++P  
Sbjct: 118 ITNLAGVPSIIYGLLALGLFVYTFGLGQSILTAGLTLALLI-LPIVITTTREALRSIPQH 176

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP- 367
           +R  A   GAS+ Q V  H+LP + P ILTG  + L+RA+GETAP++ +G + F+   P 
Sbjct: 177 VREGAYACGASQYQVVSQHLLPYSTPGILTGVIIGLSRAIGETAPIITIGALTFIAFLPP 236

Query: 368 ------VGVTDIA----TAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
                 VG  D      T  P+QI+ W +  +  F +    A  +L+     +N   +WL
Sbjct: 237 VPFTEGVGAFDWLFSPFTVMPIQIFNWTSRPDPAFHQNAAAASFVLVFMTLGMNALAIWL 296

Query: 418 RNRFKK--RW 425
           R R +K  +W
Sbjct: 297 RYRLRKNIKW 306


>gi|283853671|ref|ZP_06370903.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio sp. FW1012B]
 gi|283570942|gb|EFC18970.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio sp. FW1012B]
          Length = 292

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 147/286 (51%), Gaps = 22/286 (7%)

Query: 157 SPANVHRMSDYQWKWF--QKLDSDGALFL-----------DFNYGFFINGASSRPEVAGI 203
           S A  HR     W  F    L +  AL L             ++ F            GI
Sbjct: 10  SLARRHRTQKIMWGVFGLSSLVNMAALLLICGFLLIKGLPAISWSFLTEMPRDSMTAGGI 69

Query: 204 GVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGIL 263
              ++G++Y+ L  + ++FPLG+ASA+YL E++  G     ++  INNLA VPS+V+G+ 
Sbjct: 70  LPCILGTIYLSLGTMAVAFPLGVASAVYLNEYATPGRTLRLIRLGINNLAGVPSVVFGLF 129

Query: 264 GSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQT 323
           G A  + FF +  S  L G L L+++ LP II     AL+ VP + R A+LGLGA+K QT
Sbjct: 130 GLAFFVTFFGLGVSL-LSGILTLSILVLPVIIGTAEEALKAVPQTYREASLGLGATKWQT 188

Query: 324 VFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYL 383
           +   VLP AMP +LTG+ + L+R  GETA ++F   V F    P  +TD   A P  IY+
Sbjct: 189 IRLVVLPAAMPGMLTGAILGLSRVAGETAAIMFTAAVFFTPYLPTNLTDSVMALPYHIYV 248

Query: 384 WAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            A      D  RP     +G  L+L++ +  +N   +  R + +K+
Sbjct: 249 LATAGTDIDKTRPL---QYGTALVLIVLVLGMNLGAILYRAKLQKK 291


>gi|308273631|emb|CBX30233.1| hypothetical protein N47_D30420 [uncultured Desulfobacterium sp.]
          Length = 307

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 94/231 (40%), Positives = 138/231 (59%), Gaps = 13/231 (5%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G+L + +  I ++ P+G+ASAIYL E++  G     ++ +I+NLA VPS+V+
Sbjct: 81  GGILPCIIGTLCLGIGSIIVALPIGVASAIYLNEYASPGRILRLIRLSISNLAGVPSVVF 140

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A  + + KM  S  L G L LA +TLP II +T  AL++VP + R A+L LGA++
Sbjct: 141 GLFGFAFFVIYLKMGVSI-LAGVLTLASLTLPVIIGSTEEALKSVPDTYREASLALGATR 199

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT++  VLP A+P  LTG+ + L+RA GETAP++F   V F    PV V D   A P  
Sbjct: 200 WQTIYRVVLPAALPGTLTGAILGLSRAAGETAPVMFTAAVFFTPGLPVSVFDKIMAMPYH 259

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVIN-TAMLW---LRNRFK 422
           IY+ A      +A RP     +G  LLL+  +  +N  A++W   LR R K
Sbjct: 260 IYVLATAGTNIEATRPL---QYGTSLLLIAMVLGMNLVAIVWRSVLRKRMK 307


>gi|253999567|ref|YP_003051630.1| phosphate ABC transporter inner membrane subunit PstA [Methylovorus
           sp. SIP3-4]
 gi|313201602|ref|YP_004040260.1| phosphate ABC transporter inner membrane subunit psta [Methylovorus
           sp. MP688]
 gi|253986246|gb|ACT51103.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methylovorus sp. SIP3-4]
 gi|312440918|gb|ADQ85024.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methylovorus sp. MP688]
          Length = 312

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 146/269 (54%), Gaps = 18/269 (6%)

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
           F  L  DG  +  F + F     S R   AG+  A +GSL +M++    + P+G+A+ +Y
Sbjct: 47  FVDLVMDG--YPRFTFEFLSEYPSRRAAHAGLLSAWIGSLLVMIVTFLSAVPMGVAAGLY 104

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           LEE++ K +FS  ++ N+ NLA VPSIVYG+L   + +    + +S    G  +  L+ L
Sbjct: 105 LEEYAPKNWFSDLIEINVTNLAGVPSIVYGLLALGLFVYILDLGQSILTAGLTLGLLI-L 163

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I+AT  A+R +P +IR AA  +GA+K Q V HHVL  +   ILTG  + +ARALGET
Sbjct: 164 PVVIVATREAVRGIPVAIREAAYAVGATKWQVVLHHVLHYSFGGILTGVIIGMARALGET 223

Query: 352 APLLFVGMVAFVTDYPVG-VTDIA------------TAFPVQIYLWAADAERPFVERTFG 398
           APL+ +G + F+   P   +TD              T  P+Q++ W +  +  F      
Sbjct: 224 APLITIGALTFIAFLPPSPITDTPPFLNFEWLSSGFTVMPIQMFNWLSRPDHAFHMNAAA 283

Query: 399 AILLLLIFLAVINTAMLWLRNRFKK--RW 425
              L+++   ++N   +WLR R +K  +W
Sbjct: 284 TGALIIVVTLLMNGTAIWLRYRIRKNIKW 312


>gi|315426898|dbj|BAJ48518.1| phosphate ABC transporter permease [Candidatus Caldiarchaeum
           subterraneum]
          Length = 224

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 136/219 (62%), Gaps = 1/219 (0%)

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A +GS + + +   +S PLGIASA+YL E+S       F++ N+ NLA VPSI++G++G 
Sbjct: 4   AFLGSFWTVSLSALVSIPLGIASALYLTEWSSHRRLRRFLEFNMANLAGVPSIIFGLVGL 63

Query: 266 AVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVF 325
           ++L     + RS  + G   L +MTLP + ++   A+++VP +++  A  LGA+K+Q   
Sbjct: 64  SILTYGLGLGRSI-IAGAFTLGIMTLPLVTVSAAEAIKSVPEALKHGAYALGATKLQVTR 122

Query: 326 HHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWA 385
           H +LP ++P ++TG+ ++++RA+GE AP+L +  + F+   P  V D  T  P+QI+ W 
Sbjct: 123 HIILPRSLPMMMTGAILAISRAIGEAAPILVISGLLFIRTDPTSVFDRFTVMPLQIFNWV 182

Query: 386 ADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +  +  F E +  AI++LL  L + N A + +R R+++R
Sbjct: 183 SRPQPAFQELSSAAIIVLLALLMMFNAAAIAIRYRYQRR 221


>gi|312888611|ref|ZP_07748180.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
 gi|311298925|gb|EFQ76025.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
          Length = 281

 Score =  146 bits (369), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 136/230 (59%), Gaps = 11/230 (4%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ + LI   ++ P GI  AIYL E++   + +  ++A+I NLA VPSI+Y
Sbjct: 56  GGILPAITGTVLLTLITALVAAPFGICCAIYLNEYAANTWLTRLIRASIRNLAGVPSIIY 115

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +    M  S  L  GL L L++LP III T  ALR +P S+R AAL LGA+K
Sbjct: 116 GLFGLALFVQGLSMGTSL-LPAGLTLGLLSLPYIIITTEEALRRIPGSMREAALALGATK 174

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIA-TAFPV 379
            +++   VLP A+P +LTG  ++L+RA GETAP+LF G VAF  + P G  +    A P 
Sbjct: 175 FESIRDVVLPSALPGMLTGLVLTLSRAAGETAPILFTG-VAFYINKPAGYLNQEFMALPY 233

Query: 380 QIYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +Y+ A   +     RP     +G  L+L+I + ++N +  ++R +  K 
Sbjct: 234 HLYMLATQHQDIEQVRPL---AYGTALVLIIVVFLLNLSAFYIRYKHSKH 280


>gi|255693908|ref|ZP_05417583.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           finegoldii DSM 17565]
 gi|260620273|gb|EEX43144.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           finegoldii DSM 17565]
          Length = 291

 Score =  146 bits (368), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 82/229 (35%), Positives = 133/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPHLPASILDQCMALPYH 241

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +      +A+ P     +G  L+L++ + ++N     LR  F+KR
Sbjct: 242 LYVISTSGTDMEAQLPL---AYGTALVLIMIILLVNLLANALRKYFEKR 287


>gi|325983293|ref|YP_004295695.1| phosphate ABC transporter, inner membrane subunit PstA
           [Nitrosomonas sp. AL212]
 gi|325532812|gb|ADZ27533.1| phosphate ABC transporter, inner membrane subunit PstA
           [Nitrosomonas sp. AL212]
          Length = 308

 Score =  145 bits (367), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 146/256 (57%), Gaps = 16/256 (6%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            ++ FF +  S RPE AGI  A VG+  +ML+    + PLGI S IYLEE++ +   +  
Sbjct: 54  LSWEFFTSFPSRRPESAGILSAWVGTTLVMLVTAVAAVPLGIGSGIYLEEYAPRNLLTEI 113

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ N+ NLA VPSI+YG+L   + +    + +S    G L LAL+ LP +I+AT  A+R+
Sbjct: 114 IEINVTNLAGVPSIIYGLLALGLFVYQLGIGQSILAAG-LALALLILPVVIVATREAIRS 172

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVA 361
           +P +IR  A  LGA+K QTV  H+LP +   ILTG  + LARA+GETAP++ +G    +A
Sbjct: 173 IPITIREGAYALGATKWQTVSDHLLPYSAAGILTGIIIGLARAIGETAPIITIGALTFIA 232

Query: 362 FVTDYPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           F+   PV           +T   T  P+Q++ W +  E  F      A L+L++    +N
Sbjct: 233 FLPPSPVKNEFPFVSFEWLTAPFTVMPIQMFNWVSRPEEAFQLNAAAAGLVLVVMTLAMN 292

Query: 412 TAMLWLRNRFKK--RW 425
              ++LR R +K  +W
Sbjct: 293 GLAIYLRYRMRKNIKW 308


>gi|326802092|ref|YP_004319911.1| phosphate ABC transporter inner membrane subunit PstA
           [Sphingobacterium sp. 21]
 gi|326552856|gb|ADZ81241.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sphingobacterium sp. 21]
          Length = 281

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 144/262 (54%), Gaps = 29/262 (11%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           W +   L +DG            NG        GI  A++G++ + LI   ++ P GI  
Sbjct: 41  WDFVSTLPTDG----------MTNG--------GILPAIIGTVMLTLITAVVAAPFGIGC 82

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYL E++   +F+  ++A+I NLA VPSI+YG+ G A+ +    M  S  L  G  L L
Sbjct: 83  AIYLNEYAPNTWFTRLIRASIRNLAGVPSIIYGLFGLALFVQGLNMGTSL-LSAGFTLGL 141

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           ++LP II  T  ALR +P+S R  ALG+GA++ +++   VLP A+P ILTG  ++L+RA 
Sbjct: 142 LSLPYIITTTEEALRRIPASTREGALGVGATQFESIRDMVLPSALPGILTGMVLALSRAA 201

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIA-TAFPVQIYLWAADAE-----RPFVERTFGAILL 402
           GETAP+LF G VAF  + P G  +    A P  +Y+ +   +     RP     +G  L+
Sbjct: 202 GETAPILFTG-VAFYINNPTGYLNQEFMALPYHLYMLSTQHQAIEEVRPLA---YGTALI 257

Query: 403 LLIFLAVINTAMLWLRNRFKKR 424
           L++ + ++N+   ++R +  K 
Sbjct: 258 LIMVVFILNSIAFYIRYKHSKN 279


>gi|126660070|ref|ZP_01731191.1| Phosphate permease component of ATP-dependent phosphate uptake
           system [Cyanothece sp. CCY0110]
 gi|126618667|gb|EAZ89415.1| Phosphate permease component of ATP-dependent phosphate uptake
           system [Cyanothece sp. CCY0110]
          Length = 317

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 149/265 (56%), Gaps = 29/265 (10%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF++  S + E AGI  A VG+  +ML+    + P+GIAS IYLEE++ K + S+ ++ N
Sbjct: 54  FFVSFPSRKAEQAGILSAWVGTSLIMLVTACAAVPIGIASGIYLEEYARKNWLSAIIEIN 113

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + NLA VPSIVYG+L   + +  F++ +S    G  +  L+ LP +I+ T  A+R +P S
Sbjct: 114 VTNLAGVPSIVYGLLALGLFVYQFQLGQSVLTAGLTLALLI-LPVVIVTTREAIRAIPIS 172

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD--- 365
           +R A+  +GA+K QT++ H+LP ++ +ILTG  + LARA+GETAP++ +G + F+     
Sbjct: 173 LREASYAVGATKWQTIWDHILPYSLGSILTGIIIGLARAIGETAPVITIGALTFIAFLPE 232

Query: 366 ---------YPVGVTDIA--------------TAFPVQIYLWAADAERPFVERTFGAILL 402
                    +P+ +T                 T  P+Q++ W +  E+ F      A  +
Sbjct: 233 SPFNNEFPFFPLEMTFPFFNFQQFFAWLNAPFTVLPIQMFTWVSRPEQDFQVNAAAAGTV 292

Query: 403 LLIFLAVINTAMLWLRNRFKK--RW 425
           LL+    IN   ++LR R ++  +W
Sbjct: 293 LLMMTLGINGIAIYLRYRLRQGIKW 317


>gi|172036080|ref|YP_001802581.1| phosphate ABC transporter permease [Cyanothece sp. ATCC 51142]
 gi|171697534|gb|ACB50515.1| phosphate ABC transporter, permease protein [Cyanothece sp. ATCC
           51142]
          Length = 317

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 148/265 (55%), Gaps = 29/265 (10%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF++  S + E AGI  A VG+  +M +   ++ PLGIAS +YLEE++ K + S+ ++ N
Sbjct: 54  FFVSFPSRKAEQAGILSAWVGTSLVMFVTACVAIPLGIASGVYLEEYARKNWLSAIIEIN 113

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + NLA VPSIVYG+L   + +  F++ +S    G  +  L+ LP +I+ T  A+R +P S
Sbjct: 114 VTNLAGVPSIVYGLLALGLFVYQFQLGQSVLTAGLTLALLI-LPVVIVTTREAIRAIPIS 172

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV----- 363
           +R A+  +GA+K QTV+ H+LP +  +ILTG  + LARA+G+TAPL+ +G + F+     
Sbjct: 173 LREASYAVGATKWQTVWDHILPYSSGSILTGIIIGLARAIGQTAPLITIGALTFIAFLPE 232

Query: 364 ----TDYPVGVTDIA-----------------TAFPVQIYLWAADAERPFVERTFGAILL 402
                ++P    ++                  T  P+Q++ W +  E+ F      A  +
Sbjct: 233 SPLNNEFPFLPLEMTFPFFNFQQFFAWLNAPFTVLPIQMFTWVSRPEQEFQVNAAAAGTV 292

Query: 403 LLIFLAVINTAMLWLRNRFKK--RW 425
           LLI    IN   ++LR R ++  +W
Sbjct: 293 LLIMTLGINGIAIYLRYRLRQGIKW 317


>gi|323699485|ref|ZP_08111397.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio sp. ND132]
 gi|323459417|gb|EGB15282.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio desulfuricans ND132]
          Length = 310

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 136/233 (58%), Gaps = 12/233 (5%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   +VG+ Y+ L  + L+ PLG+A+AIYL E++  G F   V+  INNLA VPS+V+
Sbjct: 79  GGIFPCIVGTFYLSLGSMALALPLGVAAAIYLHEYAAPGPFMRVVRLCINNLAGVPSVVF 138

Query: 261 GILGSAVLI-----NFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALG 315
           G+ G A  +         M  S A  G + LA++ LP II  +  ALR+VP++ R A+LG
Sbjct: 139 GLFGMAFFVAGRDLGGLGMGVSIA-SGCMTLAVLILPVIIGTSEEALRSVPNTYREASLG 197

Query: 316 LGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIAT 375
           LGA+K QT+F  VLP AMP +LTGS +S++RA GETA ++F    ++    P  + D   
Sbjct: 198 LGATKWQTIFKVVLPSAMPGVLTGSILSISRAAGETAAIMFTAAASYNPTLPGSIFDEVM 257

Query: 376 AFPVQIYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRNRFKKR 424
           A P QIY  +  +  P  E T    +G  L+L+  +  +N   + LR+  +K+
Sbjct: 258 ALPYQIYSLSVSSTDP--EATLPLQYGTSLVLVALVLGMNLVAIMLRSHLRKK 308


>gi|300868506|ref|ZP_07113125.1| Phosphate ABC transporter, permease protein [Oscillatoria sp. PCC
           6506]
 gi|300333495|emb|CBN58313.1| Phosphate ABC transporter, permease protein [Oscillatoria sp. PCC
           6506]
          Length = 307

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 142/251 (56%), Gaps = 14/251 (5%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ FF +  S R   AGI  A VGS  +M +    + PLGIAS IYLEE++ K + +  +
Sbjct: 54  SWQFFTSFPSRRAGEAGILSAWVGSTLVMFVTGLAAVPLGIASGIYLEEYARKNWIADLI 113

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + N+ NLA VPSIVYG+L   + +    + +S    G  +  L+ LP +I+ T  A+R +
Sbjct: 114 EINVTNLAGVPSIVYGLLALGLFVYKLNLGQSILTAGLTLALLI-LPVVIVTTREAIRAI 172

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVAF 362
           P+SIR AA  +GASK Q +++H+LP +  +I+TG  V L+RA+GETAPL+ +G    +AF
Sbjct: 173 PNSIREAAYAVGASKWQMIWNHILPYSAGSIMTGVIVGLSRAIGETAPLITIGALTFIAF 232

Query: 363 VTDYPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           + D P            +    T  P+Q++ W +  +  F      A L+L+     +N 
Sbjct: 233 LPDSPFQAEFPFFSFKWLMSPFTIMPIQMFNWVSRPQAEFQINAAAAGLVLMAMTLAMNA 292

Query: 413 AMLWLRNRFKK 423
             ++LR RF+K
Sbjct: 293 LAIYLRYRFRK 303


>gi|317484886|ref|ZP_07943776.1| phosphate ABC transporter [Bilophila wadsworthia 3_1_6]
 gi|316923868|gb|EFV45064.1| phosphate ABC transporter [Bilophila wadsworthia 3_1_6]
          Length = 291

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 135/228 (59%), Gaps = 7/228 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+   +VG+  +    + ++FPLG+ASA+YL E+  KG ++ +++  I+NLA VPS+V+
Sbjct: 66  GGVWPCIVGTFLLAFGAMLIAFPLGVASAVYLHEYGGKGRYTRYLRLGISNLAGVPSVVF 125

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A  + F  M  S  L G L LA++TLP II  T  ALR VP + R A+L LGA++
Sbjct: 126 GLFGLAFFVTFLGMGVSL-LAGVLTLAVLTLPVIINTTEEALRQVPDAWREASLALGATR 184

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A+P +LTG+ + LARA GETA ++F   V +    P  V     + P  
Sbjct: 185 SQTIARVVLPAAVPGMLTGAILGLARAAGETAAIMFTAAVFYTPKMPDSVFSAVMSLPYH 244

Query: 381 IYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ A       +E+T    +G  L+LL+ +  +N   + +R+R +++
Sbjct: 245 MYVLATAGTE--IEKTRPLQYGTALILLVLVLGMNLIAIIIRDRMQRK 290


>gi|253997059|ref|YP_003049123.1| phosphate ABC transporter inner membrane subunit PstA
           [Methylotenera mobilis JLW8]
 gi|253983738|gb|ACT48596.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methylotenera mobilis JLW8]
          Length = 315

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 146/252 (57%), Gaps = 16/252 (6%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F+ +  S R   AG+  A+VGS  +ML+    + P+G+ +AIYLEE++ K +FS  ++ N
Sbjct: 65  FYTDFPSRRASSAGLLSALVGSSLVMLVTFLSAVPVGVMAAIYLEEYAPKNWFSDLIEIN 124

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           ++NLA+VPSI+YG+L   + +    + +S  +  GL L L+ LP +I+AT  ++R++P +
Sbjct: 125 VSNLAAVPSIIYGLLALGLFVYILDLGQSI-VTAGLTLGLLILPVVIVATRESIRSIPIA 183

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR AA  +GA+K Q V+ HV+  +   ILTG  + +ARA+GETAP++ +G + F+   P 
Sbjct: 184 IREAAYAVGATKWQVVYDHVIKYSFGGILTGVIIGMARAIGETAPIITIGALTFIAFLPP 243

Query: 369 G-VTDIA------------TAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
             VT  A            T  P+Q++ W +     F      A +++++   ++N   +
Sbjct: 244 SPVTTTAPFLNFEWLSSGFTVLPIQMFSWLSRPSEAFHVNAAAAGVIIILVTLIMNGFAI 303

Query: 416 WLRNRFKK--RW 425
            +R + +K  +W
Sbjct: 304 RMRYKMRKNIKW 315


>gi|327400758|ref|YP_004341597.1| phosphate ABC transporter inner membrane subunit PstA
           [Archaeoglobus veneficus SNP6]
 gi|327316266|gb|AEA46882.1| phosphate ABC transporter, inner membrane subunit PstA
           [Archaeoglobus veneficus SNP6]
          Length = 280

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/228 (35%), Positives = 130/228 (57%), Gaps = 4/228 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G++Y+ ++    S PLG+ +AI+L E++  G     ++  I NLA VPS+VY
Sbjct: 54  GGIFPAILGTIYVTVMTAVFSIPLGVGAAIFLNEYARAGRTVRLIKMAIRNLAGVPSVVY 113

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A  + FF    S  +   L LA+MTLP +I ++  AL+ VP+  R A+  LGA+K
Sbjct: 114 GLFGLAAFVYFFGFGESI-IAASLTLAVMTLPWVITSSEEALKGVPNDFRLASYALGATK 172

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+ + +LP A+P +LTG+ + LARA+GETAPLLF G V ++   P    D   + P  
Sbjct: 173 WQTIKNAILPYALPGVLTGAIIGLARAMGETAPLLFTGAVFYIRRLPNSPFDRFMSLPYH 232

Query: 381 IYLWAADAERP---FVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            Y+ A     P           +L+ ++F+ + +  ++  R R  +RW
Sbjct: 233 TYVLATQHASPYAKTYAAATATVLIAIVFIMIASATIIRYRYRKARRW 280


>gi|153808290|ref|ZP_01960958.1| hypothetical protein BACCAC_02578 [Bacteroides caccae ATCC 43185]
 gi|149129193|gb|EDM20409.1| hypothetical protein BACCAC_02578 [Bacteroides caccae ATCC 43185]
          Length = 291

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 112/183 (61%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P G+ D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTGILDQCMALPYH 241

Query: 381 IYL 383
           +Y+
Sbjct: 242 LYV 244


>gi|255010350|ref|ZP_05282476.1| phosphate transport system permease protein [Bacteroides fragilis
           3_1_12]
 gi|313148150|ref|ZP_07810343.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313136917|gb|EFR54277.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 291

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 131/229 (57%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M      +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMTGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMDFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTSILDQCMALPYH 241

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +      +A+ P     +G  L+L+  + ++N     LR  F+K+
Sbjct: 242 LYVISTSGTDMEAQLPL---AYGTALVLIAIILLVNLLANALRKYFEKK 287


>gi|222478939|ref|YP_002565176.1| phosphate ABC transporter, inner membrane subunit PstA [Halorubrum
           lacusprofundi ATCC 49239]
 gi|222451841|gb|ACM56106.1| phosphate ABC transporter, inner membrane subunit PstA [Halorubrum
           lacusprofundi ATCC 49239]
          Length = 588

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 142/245 (57%), Gaps = 7/245 (2%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK----GF 240
            + G+     SS    AG+  A+VGS+ ++ +V  LSF LG+ ++++LEE+       G 
Sbjct: 343 LDAGYVTEAPSSTAIEAGLYPAIVGSVIIIALVAVLSFVLGVGTSVFLEEYMPGSGILGS 402

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            +  +Q NI NLA++PS+VYG+LG  +  N       TA+   L L+L+ LP  II+   
Sbjct: 403 LTRLLQVNIANLAAIPSVVYGLLGLGLFANLLGFGLGTAVTASLTLSLLILPITIISAQE 462

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           A+R+VP  +R  +  +GA++ QT  + VLP A P ILTG+ ++L RA+GETAPL+ +G  
Sbjct: 463 AIRSVPDDLRRGSDAMGATRWQTTKNVVLPEAFPGILTGTILALGRAIGETAPLIMIGAA 522

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWA--ADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
             V   P  +    +A P+QIY WA    AE  +     G I LL+I + +  TA+L LR
Sbjct: 523 TTVFSAPDSLFSRFSAMPMQIYAWANFPQAEFRYGVVAAGVITLLIILVGMNGTAIL-LR 581

Query: 419 NRFKK 423
           NR ++
Sbjct: 582 NRAER 586


>gi|289580175|ref|YP_003478641.1| phosphate ABC transporter inner membrane subunit PstA [Natrialba
           magadii ATCC 43099]
 gi|289529728|gb|ADD04079.1| phosphate ABC transporter, inner membrane subunit PstA [Natrialba
           magadii ATCC 43099]
          Length = 337

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 148/246 (60%), Gaps = 11/246 (4%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           ++  NYG    G        G+   ++GS+Y++++    +  LG+ +AIYLEE++     
Sbjct: 99  YVPSNYGELATGP------GGMYPMIIGSIYLIIMTAIFTLFLGVGAAIYLEEYAPDSNL 152

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F++ANI+NLA VPSIVYG+LG AV +   +   ++ + G L L L+ LP +I+ +  +
Sbjct: 153 TRFIEANISNLAGVPSIVYGLLGLAVFVRAMQT-GASLIAGALTLTLLILPIVIVQSQES 211

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR VP S+R A+ G GA+K QT+ + VLP A+P I+TG  +SL+RA+GETAP+L VG  A
Sbjct: 212 LRAVPDSMRQASYGAGATKWQTIRNVVLPEAVPGIMTGIILSLSRAIGETAPILMVG-AA 270

Query: 362 FVTDYPVGVTDIATAF---PVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
                P  +TD   +F   P+QIY WA   E  F       I++LL  L ++N   + +R
Sbjct: 271 TTMFTPPDLTDPTGSFGAMPMQIYEWAKMPEAEFQHVAAAGIVVLLTILLLMNAVAILIR 330

Query: 419 NRFKKR 424
           N++ KR
Sbjct: 331 NKYDKR 336


>gi|220932988|ref|YP_002509896.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halothermothrix orenii H 168]
 gi|219994298|gb|ACL70901.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halothermothrix orenii H 168]
          Length = 284

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 91/223 (40%), Positives = 129/223 (57%), Gaps = 9/223 (4%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+ +I   +S PLG+ +AIYL E++ KG  +  ++  I NL+ VPSIV+
Sbjct: 56  GGIFPAIVGTFYVTVITALVSVPLGMFAAIYLNEYARKGILTRVIRMAIRNLSGVPSIVF 115

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +       S  L  GL L LMTLP  I A+  AL+TVP S R  AL LGA+K
Sbjct: 116 GLFGVALFVQGMGFGTSI-LSAGLTLGLMTLPITITASEEALKTVPRSYREGALALGATK 174

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            Q++  +VLP A+P +LTGS + LARA GETAP+LF G   F+   P  +     A P  
Sbjct: 175 WQSIKTNVLPAAIPGMLTGSILGLARAAGETAPILFTGAAFFLPFLPDSLFSQFMALPYH 234

Query: 381 IYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAMLWLR 418
           +Y+ A         RP     +G  ++L+  + VIN A + +R
Sbjct: 235 LYILATQHHAIAKVRPL---AYGTAMVLITLVLVINLAAIIIR 274


>gi|167630153|ref|YP_001680652.1| phosphate abc transporter, permease protein psta [Heliobacterium
           modesticaldum Ice1]
 gi|167592893|gb|ABZ84641.1| phosphate abc transporter, permease protein psta [Heliobacterium
           modesticaldum Ice1]
          Length = 281

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 86/223 (38%), Positives = 128/223 (57%), Gaps = 1/223 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y++L  I  + P+G+ +A+YL E++ + + +  ++  + NLA VPS+V+
Sbjct: 56  GGIFPAIVGTFYLVLATILFALPVGVMTAVYLVEYARESWATRIIRLAVVNLAGVPSVVF 115

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G    + F     S  L G L LALM LP II  T  ALR VP+  R A+L LGA+K
Sbjct: 116 GLFGLGFFVLFLDFGVSI-LSGSLTLALMILPVIITTTEEALRAVPNGYREASLALGATK 174

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+   VLP AMP ILTGS + +ARA GETAP+L      F+   P  V D   A P  
Sbjct: 175 LQTILLIVLPNAMPGILTGSILGVARAAGETAPILLTAAAFFLPRLPSSVFDQVMALPYH 234

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +Y+ A        +  +G   +L+I +  +N   + LR+ F++
Sbjct: 235 LYVIATQVPNADPKIPYGTATVLMILVLGLNLVAILLRSYFRR 277


>gi|194333775|ref|YP_002015635.1| phosphate ABC transporter inner membrane subunit PstA
           [Prosthecochloris aestuarii DSM 271]
 gi|194311593|gb|ACF45988.1| phosphate ABC transporter, inner membrane subunit PstA
           [Prosthecochloris aestuarii DSM 271]
          Length = 449

 Score =  143 bits (360), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 136/456 (29%), Positives = 220/456 (48%), Gaps = 52/456 (11%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALW-QTHIS----LPIEFSE 64
           N+  R I +  F    V +++++ + L+ +L  IV+ GI A++ Q  I     +  EF  
Sbjct: 2   NIGTRKILDRSFTAMGVTSIVLMAMALLAVLVPIVNGGIKAVFFQATIEHRKLMYNEFGR 61

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY---- 120
              D  +++      + +AD    +R+ L   L+  D+    +   S   S  ++Y    
Sbjct: 62  GDADEIERQ------IRQADS---IREPLFAILANFDAELETMDDVSLKRSYRSKYNQVR 112

Query: 121 -HLRKTLM-----TDPSLI----GKT-------VEVSLLASANIDSALKGYLYSPANVHR 163
            HL   L      T+P L+    GKT       V   LL     DS+    +     V R
Sbjct: 113 NHLHDLLGPLPGDTEPLLLRFQYGKTRWAQAEEVLHDLLFVTKWDSSNPNVMAKKYFVPR 172

Query: 164 MSDYQWKWFQKLDSDGALFLD--------FNYGFFINGASSRPEVAGIGVAVVGSLYMML 215
           + D+Q      L +     LD        F +GF  + A       GI   + G+ ++ +
Sbjct: 173 VDDFQGTALAPLFAYVETHLDEMLLPQRTFYWGFLTDKALDAHIFGGISAEIRGTFFLAI 232

Query: 216 IVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMP 275
             +  +FPLG+ +AIY  E++   F +S +++  + LA VPSIV+G+ G A  IN  K+ 
Sbjct: 233 GAMLFAFPLGVIAAIYFTEYAKDNFLTSMLRSANSTLAGVPSIVFGLFGLAFFINTLKVS 292

Query: 276 RS-TALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMP 334
            S + L G L LA+M LP+II A   A+ +VP + R A+LGLGA+K +T+   +LP A+P
Sbjct: 293 ESKSVLAGSLTLAIMILPTIIRAAEEAILSVPKTYREASLGLGATKWRTIVTVILPAALP 352

Query: 335 AILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI----ATAFPVQIYLWAADAER 390
            I+TG  +SL RA GETAP++F   V+      VG+ D+      A    IY  A++ E 
Sbjct: 353 GIMTGGIISLGRAAGETAPIIFTAAVS--VGATVGLADVFSQPTPALSWNIYNLASEHEA 410

Query: 391 PFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
               R   +G +L L+  + ++N + + LR R  K+
Sbjct: 411 ANEIRHVQYGMVLALISIVLLLNMSAILLRARISKK 446


>gi|189467050|ref|ZP_03015835.1| hypothetical protein BACINT_03433 [Bacteroides intestinalis DSM
           17393]
 gi|189435314|gb|EDV04299.1| hypothetical protein BACINT_03433 [Bacteroides intestinalis DSM
           17393]
          Length = 286

 Score =  142 bits (359), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 119/201 (59%), Gaps = 6/201 (2%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG+   F++   NNL+ +PSIV+
Sbjct: 58  GGIFPAIVGTFYLMIGSALFAFPVGVMSGIYMNEYAPKGWVVRFIRMMTNNLSGIPSIVF 117

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P ++R  +  LGA+K
Sbjct: 118 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDTLREGSRALGATK 176

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H VLP+AMP ++TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 177 LQTIWHVVLPMAMPNVITGLILALGRVSGETAPILFTCAAYFLPQLPTSILDQCMALPYH 236

Query: 381 IYLWAA-----DAERPFVERT 396
           +Y+ +      DA+ P    T
Sbjct: 237 LYVISTSGTDMDAQLPLAYGT 257


>gi|82702216|ref|YP_411782.1| phosphate ABC transporter permease [Nitrosospira multiformis ATCC
           25196]
 gi|82410281|gb|ABB74390.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Nitrosospira multiformis ATCC 25196]
          Length = 310

 Score =  142 bits (359), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 87/256 (33%), Positives = 139/256 (54%), Gaps = 16/256 (6%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            ++ FF +  S RPE AGI  A VG+  +M++    + PLG+ + IYLEE++ K   +  
Sbjct: 56  LSWDFFTSFPSRRPESAGILSAWVGTTLVMIVTAAAAVPLGVGAGIYLEEYAPKNILTEI 115

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ N+ NLA VPSI+YG+L  ++ ++     +S    G  +  L+    +I+AT  A+R 
Sbjct: 116 IEINVTNLAGVPSIIYGLLALSLFVHQLGFGQSILSAGLALALLILP-IVIVATREAIRA 174

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P +IR  A  LGA+K QTV  H+LP +   ILTG  + LARA+GETAP++ +G + F+ 
Sbjct: 175 IPVTIREGAYALGATKWQTVSDHLLPYSAAGILTGIIIGLARAIGETAPIITIGALTFIA 234

Query: 365 DYPVG-------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
             P               +    T  P+Q++ W +  E  F      A L+L+I    +N
Sbjct: 235 FLPPSPFKEEFPYISFEWLMAPFTVMPIQMFNWVSRPEEAFQMNAAAAGLVLVIMTLTMN 294

Query: 412 TAMLWLRNRFKK--RW 425
              ++LR R +K  +W
Sbjct: 295 ALAIYLRYRMRKNLKW 310


>gi|218779279|ref|YP_002430597.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfatibacillum alkenivorans AK-01]
 gi|218760663|gb|ACL03129.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfatibacillum alkenivorans AK-01]
          Length = 310

 Score =  142 bits (359), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 92/244 (37%), Positives = 135/244 (55%), Gaps = 9/244 (3%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ F            GI   +VG+L + L  + ++FP+G+ASAIYL E++  G     +
Sbjct: 69  NWEFLTTAPYDSMTKGGILPCIVGTLCLGLGAMVVAFPIGVASAIYLNEYARPGKVLRII 128

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +  INNLA VPS+V+G+ G A  + + +M  S      L LA M+LP II A+  AL++V
Sbjct: 129 RLGINNLAGVPSVVFGLFGLAFFVIYLEMGVSLLAGA-LTLAAMSLPVIIGASEEALKSV 187

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R A+LGLGA+K QT++  VLP AMP ILTG  + L+RA GE AP++F   V F   
Sbjct: 188 PDTYREASLGLGATKWQTIYRVVLPAAMPGILTGGILGLSRAAGELAPVMFTAAVYFAPK 247

Query: 366 YPVGVTDIATAFPVQIYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            P          P  IY+ A      +A RP     +G+ L+L++ +  +N A +  R R
Sbjct: 248 LPSSPFSEVMTLPYHIYVLATAGTEIEATRPL---QYGSALVLIVLVLGMNLAAIIYRAR 304

Query: 421 FKKR 424
            + R
Sbjct: 305 LRNR 308


>gi|193212579|ref|YP_001998532.1| phosphate ABC transporter inner membrane subunit PstA
           [Chlorobaculum parvum NCIB 8327]
 gi|193086056|gb|ACF11332.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chlorobaculum parvum NCIB 8327]
          Length = 448

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 160/304 (52%), Gaps = 23/304 (7%)

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           ++P +I K  +VS  A     S +K + Y   N+ +M   +W  +              +
Sbjct: 158 SNPDVIAKPYDVSRAAEFEGTSLVKLFSYVEENLDKMMLPEWTVY--------------W 203

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GF  + +       GI   + G++++ +  +  +FPLG+ +A+Y  E++  GF +S +++
Sbjct: 204 GFITDKSIDAHFFGGIWPEIQGTIFLAIGAMVFAFPLGVIAAVYFTEYAKDGFLTSMLRS 263

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGLILALMTLPSIIIATGVALRTVP 306
             + LA VPSIV+G+ G A  IN   +  S + L G L LA+M LP+II A   A+  VP
Sbjct: 264 ANSTLAGVPSIVFGLFGLAFFINTLHVSHSKSVLAGSLTLAIMILPTIIRAAEEAILAVP 323

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            + + A+LGLG++K  T+   +LP A+P ILTG  +SL RA GETAP++F   V+     
Sbjct: 324 KTYKEASLGLGSTKWNTIVTVILPAALPGILTGGVISLGRAAGETAPIIFTAAVS--VGA 381

Query: 367 PVGVTDI----ATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNR 420
            +G+ D+      A    IY  A++ E     R   +G +L L+  + ++N + + LR R
Sbjct: 382 AIGLGDVLNSPTPALSWNIYNLASEHEAAAEIRHVQYGMVLSLVTIVLLLNLSAIILRAR 441

Query: 421 FKKR 424
             K+
Sbjct: 442 ISKK 445


>gi|118594573|ref|ZP_01551920.1| phosphate ABC transporter, permease protein [Methylophilales
           bacterium HTCC2181]
 gi|118440351|gb|EAV46978.1| phosphate ABC transporter, permease protein [Methylophilales
           bacterium HTCC2181]
          Length = 314

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/266 (34%), Positives = 143/266 (53%), Gaps = 16/266 (6%)

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
           F  L  DG  +  F   FF N  S R   AGI  A VGS  ++L+   ++ PLGIA+ IY
Sbjct: 49  FLDLVLDG--YPKFTLDFFTNFPSRRAARAGILSAWVGSSLVLLVTFFVAVPLGIAAGIY 106

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           LEE++ K + S  ++ N++NLA VPSI+YG+L   + +  F + +S    G  +  LM L
Sbjct: 107 LEEYAKKNWISDIIEINVSNLAGVPSIIYGLLALGLFVYSFGLGQSILTAGLTLALLM-L 165

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I++T  A+R +P  IR AA  +GA+K Q V HHV+  +   ILTG  + +ARA+GET
Sbjct: 166 PIVIVSTREAIRAIPIHIREAAYAVGATKWQVVLHHVVQYSYGGILTGVIIGMARAIGET 225

Query: 352 APLLFVGMVAFVTDYPVGVTDIA-------------TAFPVQIYLWAADAERPFVERTFG 398
           AP++ +G + F+   P     I              T  P+Q++ W +  +  F      
Sbjct: 226 APVITIGALTFIAFLPPSPVSIDPPFLNFAWLNAGFTVLPIQMFNWISRPQHAFHINAAA 285

Query: 399 AILLLLIFLAVINTAMLWLRNRFKKR 424
              +++I  A++N   + LR   +K+
Sbjct: 286 TGAVIIILTAMMNGFAIKLRYNVRKK 311


>gi|114330264|ref|YP_746486.1| phosphate ABC transporter, inner membrane subunit PstA
           [Nitrosomonas eutropha C91]
 gi|114307278|gb|ABI58521.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Nitrosomonas eutropha C91]
          Length = 308

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/253 (35%), Positives = 147/253 (58%), Gaps = 14/253 (5%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
             + FF +  S +PE+AGI  A VG+  +ML+    + PLG+A+ +YLEE++ K F +  
Sbjct: 54  LTWEFFTSFPSRKPEIAGILSAWVGTTLVMLVTAAAAVPLGVAAGVYLEEYAPKNFITEI 113

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ N+ NLA VPSI+YG+L   + +    + +S    G L LAL+ LP +I+AT  A+R+
Sbjct: 114 IEINVTNLAGVPSIIYGLLALGLFVYQLGLGQSILAAG-LTLALLILPIVIVATREAIRS 172

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVA 361
           +P +IR  A  LGA+K QTV  HV+P +   ILTG  + LARA+GETAP++ +G    +A
Sbjct: 173 IPVTIREGAYALGATKWQTVADHVVPYSAAGILTGIIIGLARAIGETAPIITIGALTFIA 232

Query: 362 FVTDYPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           F+   PV           + +  T  P+Q++ W +  +  F      A L+L++   ++N
Sbjct: 233 FLPPSPVQDQFPFLSFEWLMEPFTVMPIQMFNWISRPQEAFQHNAAAAGLVLVLMTLLMN 292

Query: 412 TAMLWLRNRFKKR 424
              ++LR   +K+
Sbjct: 293 GLAIYLRYHLRKK 305


>gi|257386426|ref|YP_003176199.1| phosphate ABC transporter inner membrane subunit PstA
           [Halomicrobium mukohataei DSM 12286]
 gi|257168733|gb|ACV46492.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halomicrobium mukohataei DSM 12286]
          Length = 540

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 140/228 (61%), Gaps = 5/228 (2%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF----FSSFVQANINNLASVP 256
           AG+   +VGS+ ++  +  L+FP+GI++A+YLEE++ K      F++ ++ NI+NLA VP
Sbjct: 311 AGVYPQLVGSIVVVGFMAILAFPVGISAAVYLEEYAPKSGWGSRFATLLEVNISNLAGVP 370

Query: 257 SIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
           S+VYG+LG A+            +     L L+ LP ++++   A+R VP S+R A+ G+
Sbjct: 371 SVVYGLLGLALFRRTLGFGTGIVVSAAGTLGLLILPIVVVSAQEAIRAVPDSLREASYGM 430

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATA 376
           GAS+ QT+ + V P A+P+ILTG+ ++LARA+GETAPL+ + +       P G+   ATA
Sbjct: 431 GASRWQTLRNVVFPEAVPSILTGTILALARAIGETAPLVMIAVATTTYTPPEGLFSSATA 490

Query: 377 FPVQIYLWAADAERPFVERTF-GAILLLLIFLAVINTAMLWLRNRFKK 423
            P+QIY   + A   F       A ++LL  + V+N   + +RNR+++
Sbjct: 491 LPLQIYAARSSALPEFRHGVVPAAAIVLLALMLVMNATAVIVRNRYER 538


>gi|53714047|ref|YP_100039.1| putative ABC transporter permease [Bacteroides fragilis YCH46]
 gi|60682242|ref|YP_212386.1| phosphate transport system permease protein [Bacteroides fragilis
           NCTC 9343]
 gi|253564689|ref|ZP_04842145.1| phosphate transport system permease [Bacteroides sp. 3_2_5]
 gi|265766334|ref|ZP_06094375.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_16]
 gi|52216912|dbj|BAD49505.1| putative ABC transporter permease protein [Bacteroides fragilis
           YCH46]
 gi|60493676|emb|CAH08465.1| phosphate transport system permease protein [Bacteroides fragilis
           NCTC 9343]
 gi|251946154|gb|EES86531.1| phosphate transport system permease [Bacteroides sp. 3_2_5]
 gi|263254002|gb|EEZ25467.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_16]
 gi|301163720|emb|CBW23274.1| phosphate transport system permease protein [Bacteroides fragilis
           638R]
          Length = 291

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 111/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA+K
Sbjct: 123 GLFGMALFVNYMDFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTSILDQCMALPYH 241

Query: 381 IYL 383
           +Y+
Sbjct: 242 LYV 244


>gi|312144335|ref|YP_003995781.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halanaerobium sp. 'sapolanicus']
 gi|311904986|gb|ADQ15427.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halanaerobium sp. 'sapolanicus']
          Length = 283

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 135/230 (58%), Gaps = 9/230 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G+  + +I   +S PLG   AIYL E++ KG  S  ++  I NLA VPSIV+
Sbjct: 56  GGIFPAIYGTFLITVITAAVSIPLGAFGAIYLNEYAKKGRSSRLIRMAIRNLAGVPSIVF 115

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G  + +  F    S  L  GL LA+MTLP  I A+  AL+TVP S R  +L LGA+K
Sbjct: 116 GLFGVGIFVVLFGFGVSI-LSAGLTLAMMTLPITITASEEALKTVPRSYRDGSLALGATK 174

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+ ++VLP+A+P +LTGS + LAR+ GETAP+LF G   F+   P  +     A P  
Sbjct: 175 WQTIKNNVLPVALPGMLTGSILGLARSAGETAPILFTGAAFFLPYLPKSIFSQFMALPYH 234

Query: 381 IYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           +Y+ +         RP    T  A++L+ + L V  TA++ LRN+ +K++
Sbjct: 235 LYILSTQHHAIARVRPIAYGT--ALVLITLVLVVNLTAII-LRNKLRKKY 281


>gi|91775146|ref|YP_544902.1| phosphate ABC transporter permease [Methylobacillus flagellatus KT]
 gi|91709133|gb|ABE49061.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methylobacillus flagellatus KT]
          Length = 312

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 147/269 (54%), Gaps = 18/269 (6%)

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
           F  L  DG  +  F   F  +  S R   AG+  A VGSL +ML+    + PLG+A+ IY
Sbjct: 47  FVDLVVDG--YPRFTLDFLTSYPSRRAASAGLLSAWVGSLLVMLVTFFSAVPLGVAAGIY 104

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           LEE++ K +FS  ++ N+ NLA VPSIVYG+L   + +    +  S    G  +  L+ L
Sbjct: 105 LEEYAPKNWFSDLIEINVTNLAGVPSIVYGLLALGLFVYGLNLGESILTAGLTLGLLI-L 163

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I+ T  ++R +P SIR AA  +GA+K Q VFHHVL  +   ILTG  + +ARALGET
Sbjct: 164 PIVIVTTRESIRGIPVSIREAAYAVGATKWQVVFHHVLHYSSGGILTGIIIGMARALGET 223

Query: 352 APLLFVGMVAFVTDYPVG-VTDIA------------TAFPVQIYLWAADAERPFVERTFG 398
           AP++ +G + F+   P   V+D+A            T  P+Q++ W +  +  F      
Sbjct: 224 APIITIGALTFIAFLPPSPVSDVAPFINFEWLQSGFTVLPIQMFNWLSRPDHAFHINAAA 283

Query: 399 AILLLLIFLAVINTAMLWLRNRFKK--RW 425
              L+++   ++N   +WLR R +K  +W
Sbjct: 284 TGALIIVVTLLMNGTAIWLRYRIRKNIKW 312


>gi|333031398|ref|ZP_08459459.1| phosphate ABC transporter, inner membrane subunit PstA [Bacteroides
           coprosuis DSM 18011]
 gi|332741995|gb|EGJ72477.1| phosphate ABC transporter, inner membrane subunit PstA [Bacteroides
           coprosuis DSM 18011]
          Length = 284

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 84/229 (36%), Positives = 133/229 (58%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G+L +++  +  +FPLG+ SAIY  E++  G+    ++   NNLA +PSIV+
Sbjct: 56  GGIYPAIIGTLCLIVGSMLFAFPLGVMSAIYTSEYAGNGWIIKVIRVMTNNLAGIPSIVF 115

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ +N   +  S  + G L L L+ LP +I  T  AL+++P+S R+A+L LGASK
Sbjct: 116 GLFGMSLFVNTMGLGDSI-IAGSLTLGLLVLPIVIRTTEEALKSIPNSFRNASLALGASK 174

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F+   P  + D   A P  
Sbjct: 175 LQTIRKVVLPMAFPNIITGLILSIGRVSGETAPILFTVAAYFLPKLPSSMFDQVMALPYH 234

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ A      +A RP     +G  L+L+  + ++N     LR  F K+
Sbjct: 235 LYVIATSGTDIEASRPI---AYGTALVLIAIVLIMNLLATALRRYFSKK 280


>gi|298386615|ref|ZP_06996171.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           1_1_14]
 gi|298260992|gb|EFI03860.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           1_1_14]
          Length = 291

 Score =  140 bits (352), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 111/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA++
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATR 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTSILDQCMALPYH 241

Query: 381 IYL 383
           +Y+
Sbjct: 242 LYV 244


>gi|253572871|ref|ZP_04850269.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251837503|gb|EES65596.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 291

 Score =  140 bits (352), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 111/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA++
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATR 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPTSILDQCMALPYH 241

Query: 381 IYL 383
           +Y+
Sbjct: 242 LYV 244


>gi|154247877|ref|YP_001418835.1| phosphate ABC transporter, inner membrane subunit PstA
           [Xanthobacter autotrophicus Py2]
 gi|154161962|gb|ABS69178.1| phosphate ABC transporter, inner membrane subunit PstA
           [Xanthobacter autotrophicus Py2]
          Length = 311

 Score =  140 bits (352), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 98/262 (37%), Positives = 150/262 (57%), Gaps = 18/262 (6%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
           +D  G + LDF   F     S R   AGI  A VG+  +ML+   L+ PLG+A+ +YLEE
Sbjct: 52  VDGLGRIDLDFLTSF----PSRRASEAGILSAWVGTTLVMLVTTALAVPLGVAAGLYLEE 107

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++ + + +  ++ N+ NLA VPSI+YG+L   + +  F M + T LV G+ LAL+ LP I
Sbjct: 108 YAPRNWITHLIEINVTNLAGVPSIIYGLLALGLFVQSFAMGQ-TILVAGITLALLILPII 166

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I+AT  A+R++P  IR  A  LGA K QTV  ++LP A P ILTG+ V ++RA+GETAP+
Sbjct: 167 IVATREAVRSIPLEIREGAYALGADKWQTVSGYILPTARPGILTGAIVGMSRAIGETAPI 226

Query: 355 LFVG---MVAFVTDYPVGVT----------DIATAFPVQIYLWAADAERPFVERTFGAIL 401
           + +G    +AF+   PV  T             T  P+Q++ W +  +  F        L
Sbjct: 227 ITIGALTFIAFLPPSPVQDTFPFINFNWLNSPFTVMPIQMFNWVSRPQAAFHVNAAATGL 286

Query: 402 LLLIFLAVINTAMLWLRNRFKK 423
           +LL+   ++N   +WLR + ++
Sbjct: 287 ILLLMTLLMNAIAIWLRYKIRR 308


>gi|158521938|ref|YP_001529808.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfococcus oleovorans Hxd3]
 gi|158510764|gb|ABW67731.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfococcus oleovorans Hxd3]
          Length = 294

 Score =  140 bits (352), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 129/226 (57%), Gaps = 3/226 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G+ Y+    I  + P+G+ASA+Y+ E++ KG     ++  INNLA VPSIV+
Sbjct: 67  GGIFPCILGTFYLAAGAICFALPIGVASAVYMNEYAAKGRVLRIIRFGINNLAGVPSIVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A       +  S  L G L L ++TLP II AT  AL+ VP   R A+L LGA++
Sbjct: 127 GLFGLAFFCIVLGLGVSL-LAGILTLGVLTLPVIIGATEEALKAVPDDYRKASLALGATQ 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT++  VLP A+P ILTG+ + L+RA GETAP++F   V F    P  + D   A P  
Sbjct: 186 WQTIYRVVLPAAIPEILTGAILGLSRAAGETAPIMFTAAVFFTPVLPSSLFDEVMALPYH 245

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A       + R   +G  L+L++ +  +N   +  R++ +K+
Sbjct: 246 IYVLATAGTDIALTRPLQYGTALVLIVLVCGMNLFAIITRSKMRKK 291


>gi|76801637|ref|YP_326645.1| phosphate ABC transporter permease [Natronomonas pharaonis DSM
           2160]
 gi|76557502|emb|CAI49082.1| ABC-type transport system permease protein I (probable substrate
           phosphate) 1 [Natronomonas pharaonis DSM 2160]
          Length = 301

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 137/224 (61%), Gaps = 1/224 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
           AG+  A++GS++++ +    +  LG+ +AIYLEE++     + F++ANI NLA VPSIVY
Sbjct: 79  AGLYPAIIGSVFLIALTALFTIFLGVGAAIYLEEYAPDNRLTRFIEANIANLAGVPSIVY 138

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+LG A+ +    +  S+ L G L L L+ LP +I++   A+R VP S R AA G+GA+K
Sbjct: 139 GLLGLAIFVRAAGL-GSSLLAGALTLTLLILPIVIVSAQEAIRAVPDSRRQAAYGVGATK 197

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            Q     VLP A+P I+TG+ +SL+RA+GETAP+L VG   F+   P  +    +A P+Q
Sbjct: 198 WQVTRDVVLPSALPGIMTGTILSLSRAIGETAPILMVGAATFMIAPPDSLLGPFSAMPMQ 257

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           ++ WA   +  F        ++LL  L ++N   + +RN++  +
Sbjct: 258 VFEWAKQPDPAFQHIAAAGSIVLLTVLVLMNATAILIRNKYDTQ 301


>gi|237726313|ref|ZP_04556794.1| phosphate ABC transporter [Bacteroides sp. D4]
 gi|229434839|gb|EEO44916.1| phosphate ABC transporter [Bacteroides dorei 5_1_36/D4]
          Length = 295

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 110/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 67  GGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRMMTNNLSGIPSIVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ + +     S  L G L L L+ +P +I  T  AL+ +P S R  +L LGA+K
Sbjct: 127 GLFGMALFVKYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSFREGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPHSILDQCMALPYH 245

Query: 381 IYL 383
           +Y+
Sbjct: 246 LYV 248


>gi|29346732|ref|NP_810235.1| putative ABC transporter permease [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338629|gb|AAO76429.1| putative ABC transporter permease protein [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 291

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 110/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M      +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 63  GGIWPAIVGTFYLMAGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRVMTNNLSGIPSIVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L+ +P +I  T  AL+ +P S+R  +  LGA++
Sbjct: 123 GLFGMALFVNYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSMREGSRALGATR 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 182 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPASILDQCMALPYH 241

Query: 381 IYL 383
           +Y+
Sbjct: 242 LYV 244


>gi|237712166|ref|ZP_04542647.1| phosphate ABC transporter [Bacteroides sp. 9_1_42FAA]
 gi|265751857|ref|ZP_06087650.1| phosphate ABC transporter, permease PstA [Bacteroides sp.
           3_1_33FAA]
 gi|229453487|gb|EEO59208.1| phosphate ABC transporter [Bacteroides sp. 9_1_42FAA]
 gi|263236649|gb|EEZ22119.1| phosphate ABC transporter, permease PstA [Bacteroides sp.
           3_1_33FAA]
          Length = 295

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 110/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 67  GGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRMMTNNLSGIPSIVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ + +     S  L G L L L+ +P +I  T  AL+ +P S R  +L LGA+K
Sbjct: 127 GLFGMALFVKYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSFREGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPHSILDQCMALPYH 245

Query: 381 IYL 383
           +Y+
Sbjct: 246 LYV 248


>gi|212691392|ref|ZP_03299520.1| hypothetical protein BACDOR_00884 [Bacteroides dorei DSM 17855]
 gi|212666002|gb|EEB26574.1| hypothetical protein BACDOR_00884 [Bacteroides dorei DSM 17855]
          Length = 295

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 110/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 67  GGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKMVRFIRMMTNNLSGIPSIVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ + +     S  L G L L L+ +P +I  T  AL+ +P S R  +L LGA+K
Sbjct: 127 GLFGMALFVKYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSFREGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPHSILDQCMALPYH 245

Query: 381 IYL 383
           +Y+
Sbjct: 246 LYV 248


>gi|223938481|ref|ZP_03630374.1| phosphate ABC transporter, inner membrane subunit PstA [bacterium
           Ellin514]
 gi|223892900|gb|EEF59368.1| phosphate ABC transporter, inner membrane subunit PstA [bacterium
           Ellin514]
          Length = 316

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 142/259 (54%), Gaps = 26/259 (10%)

Query: 190 FINGASSR----PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK-GFFSSF 244
           FI G + +     + AGI   + G+   ++++     P+G+ +AIYL E++H    F+  
Sbjct: 55  FITGGTEKDMFNTKYAGILPMIYGTAARVILMTIFVIPVGVTTAIYLTEYAHHTSIFTRI 114

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG---------------LILALM 289
           ++  +NNLA VPSIV+G+ G    INF        L  G               + LA+M
Sbjct: 115 IRGAVNNLAGVPSIVFGLFGLGFFINFIGHNMDNYLRAGSPDHLWGKPALLWASMTLAVM 174

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP +I+AT  +L+ +P  +R A+L LGA+K++T+   VLP A+P I+TG  ++++RA G
Sbjct: 175 TLPVVIVATEESLKAIPQGMREASLALGATKLETILRIVLPQALPGIMTGGILAVSRAAG 234

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERT----FGAILLLLI 405
           E AP+LF G+  ++ D P  +TD        +Y+ +  +    VE+T    +  +L+LL+
Sbjct: 235 EVAPILFTGVAYYMADLPRTITDQFMDLGNHVYVLSTQSTN--VEQTKPILYATVLVLLM 292

Query: 406 FLAVINTAMLWLRNRFKKR 424
               +N   +++R R +K+
Sbjct: 293 LTFALNIIAIFIRARMRKK 311


>gi|150392303|ref|YP_001322352.1| phosphate ABC transporter, inner membrane subunit PstA
           [Alkaliphilus metalliredigens QYMF]
 gi|149952165|gb|ABR50693.1| phosphate ABC transporter, inner membrane subunit PstA
           [Alkaliphilus metalliredigens QYMF]
          Length = 281

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 124/222 (55%), Gaps = 1/222 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G+LY++L  +  + PLGI SAIYL E++ +G  S  ++  I NLA VPS+VY
Sbjct: 56  GGIYPAIIGTLYLVLGTVLFALPLGIGSAIYLTEYAKQGILSRLIRLAILNLAGVPSVVY 115

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G  + + F     S+ L G L LA + LP +I A+  AL++VP S R A+L LGA+K
Sbjct: 116 GLFGLGLFVLFLGF-GSSILAGSLTLACLILPIVITASEEALKSVPQSYREASLALGATK 174

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A P I TG+ + + RA GETAP+L      F+   P    D A   P  
Sbjct: 175 WQTIQKVVLPHATPGITTGAILGIGRAAGETAPILLTVAAFFLPRLPKSFFDQAMVLPYH 234

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +Y+ +        E  +G  L+LL  + V       +R +FK
Sbjct: 235 LYIISTQVPNMPEEIKYGTALVLLGIVGVFFMIATTIRIKFK 276


>gi|224024788|ref|ZP_03643154.1| hypothetical protein BACCOPRO_01516 [Bacteroides coprophilus DSM
           18228]
 gi|224018015|gb|EEF76022.1| hypothetical protein BACCOPRO_01516 [Bacteroides coprophilus DSM
           18228]
          Length = 294

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 129/245 (52%), Gaps = 7/245 (2%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ F     S      GI  A+ G+  +M      +FP G+ S IY+ E++  G    F+
Sbjct: 51  NWEFLSQAPSDGMTKGGIWPAIFGTCCLMAGSALFAFPTGVMSGIYMNEYAKDGKLVRFI 110

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +   NNL+ +PSIV+G+ G A  +N+     S  L G L L L+ LP +I  T  A + +
Sbjct: 111 RMMTNNLSGIPSIVFGLFGMAFFVNWLDFGDSI-LAGSLTLGLLALPIVIRTTEEAFKDL 169

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S R  +L LGA+K QT+++ +LP+AMP I+TG  +SL R  GETAP+LF     F+  
Sbjct: 170 PDSFREGSLALGATKAQTIWNVLLPMAMPRIITGLILSLGRVSGETAPILFTCAAYFLPK 229

Query: 366 YPVGVTDIATAFPVQIYLWAA-----DAERPFVERT-FGAILLLLIFLAVINTAMLWLRN 419
            P  + D   A P  +Y+ A      +A+ P    T F  IL++L+     N+   +  N
Sbjct: 230 LPDSIFDQCMALPYHLYVVATSGTDIEAQMPIAYGTAFVLILIVLLMNLAANSIRKFFEN 289

Query: 420 RFKKR 424
           + K++
Sbjct: 290 KLKQK 294


>gi|218679699|ref|ZP_03527596.1| phosphate ABC transporter, inner membrane subunit PstA [Rhizobium
           etli CIAT 894]
          Length = 103

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%)

Query: 324 VFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYL 383
           VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P    D +TA PVQ+Y+
Sbjct: 2   VFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPTTPLDPSTALPVQVYM 61

Query: 384 WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 62  WANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 103


>gi|150006419|ref|YP_001301163.1| putative ABC transporter permease protein [Bacteroides vulgatus
           ATCC 8482]
 gi|254881664|ref|ZP_05254374.1| phosphate ABC transporter [Bacteroides sp. 4_3_47FAA]
 gi|294777061|ref|ZP_06742519.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           vulgatus PC510]
 gi|319643049|ref|ZP_07997682.1| ABC transporter permease [Bacteroides sp. 3_1_40A]
 gi|149934843|gb|ABR41541.1| putative ABC transporter permease protein [Bacteroides vulgatus
           ATCC 8482]
 gi|254834457|gb|EET14766.1| phosphate ABC transporter [Bacteroides sp. 4_3_47FAA]
 gi|294449119|gb|EFG17661.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           vulgatus PC510]
 gi|317385330|gb|EFV66276.1| ABC transporter permease [Bacteroides sp. 3_1_40A]
          Length = 295

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 109/183 (59%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+M      +FP+G+ S IY+ E++ KG    F++   NNL+ +PSIV+
Sbjct: 67  GGIWPAIVGTFYLMAGSALFAFPVGVMSGIYMNEYAPKGKLVRFIRMMTNNLSGIPSIVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ + +     S  L G L L L+ +P +I  T  AL+ +P S R  +L LGA+K
Sbjct: 127 GLFGMALFVKYMGFGDSI-LAGSLTLGLLCVPLVIRTTEEALKAIPDSFREGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPHSILDQCMALPYH 245

Query: 381 IYL 383
           +Y+
Sbjct: 246 LYV 248


>gi|302390901|ref|YP_003826721.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Acetohalobium arabaticum DSM 5501]
 gi|302202978|gb|ADL11656.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Acetohalobium arabaticum DSM 5501]
          Length = 308

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 121/220 (55%), Gaps = 3/220 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++GS Y+++  I  + PLG+ SAIY+ E++ +G     ++  +NNLA VPS+V+
Sbjct: 81  GGIFPALLGSFYLIVGSISFATPLGVLSAIYMTEYAEEGKIIRIIRIGVNNLAGVPSVVF 140

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G AV + FF    S  L G L L ++ LP+II A+  +L  VP   R A+L LGA++
Sbjct: 141 GLFGLAVFVKFFNFGVSV-LSGALTLGIVILPTIIRASEESLMAVPDEYREASLALGATR 199

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
             TV + VLP A P ILTG  + + R  GETAP+LF     +    P  V D   A P Q
Sbjct: 200 WDTVKNVVLPAAAPGILTGCILGVGRVAGETAPILFTAATYYTGQLPTSVFDEIMALPYQ 259

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLR 418
           IY        P  +    +G  ++LL  +  IN   + LR
Sbjct: 260 IYALVTAGTSPAQQTPLAYGTAVVLLFLVITINLVAIGLR 299


>gi|167950178|ref|ZP_02537252.1| phosphate ABC transporter, permease protein PstA [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 356

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 135/243 (55%), Gaps = 5/243 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           K +L  RY  E  F+   + AV V  +F+  L  SIVSKG  A WQT I L I F   ++
Sbjct: 16  KASLAARYRRERRFKAIGIGAVCVGLLFVSFLFVSIVSKGYTAFWQTQIRLDIHFDAAVI 75

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           DP   R  D   L  ADY  L++++L RK      N    R   +++S+ A + LR  ++
Sbjct: 76  DPSGNR--DLTELGHADYASLIKQSL-RKRFPEVKNRREKRTLYKLVSSGAAFDLRARVL 132

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
            DP LIG    + LLA  ++D  +KG +    P N  R+ D    W   L + GA+ L F
Sbjct: 133 ADPDLIGTRQTLWLLADDDLDMLVKGQIDRSLPENERRLKDQVIGWIDALSAQGAVELKF 192

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  FF NG S  PE AGIG A++GSLY +LI + L+FP+G+A+++YLEEF+ +  ++  +
Sbjct: 193 NSTFFTNGDSREPEQAGIGGALMGSLYTLLITLLLAFPIGVATSVYLEEFAPRNCWTDLI 252

Query: 246 QAN 248
           +  
Sbjct: 253 EGQ 255


>gi|239617107|ref|YP_002940429.1| phosphate ABC transporter, inner membrane subunit PstA [Kosmotoga
           olearia TBF 19.5.1]
 gi|239505938|gb|ACR79425.1| phosphate ABC transporter, inner membrane subunit PstA [Kosmotoga
           olearia TBF 19.5.1]
          Length = 278

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/230 (36%), Positives = 135/230 (58%), Gaps = 5/230 (2%)

Query: 195 SSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLAS 254
           S+  E  GI  A++GS Y +LI +  S P+GI  A++L E+S + +    +  + N L+S
Sbjct: 47  SNSMESGGIFPAILGSAYFLLIALTFSIPIGILGAVFLSEYSSENWLKKIILGSTNVLSS 106

Query: 255 VPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAAL 314
           +PSIV+G+ G A+    F   R++ L GGL L ++ LP II  T  AL+ VP S R A++
Sbjct: 107 IPSIVFGLFGLALFSITFGF-RTSLLSGGLTLGVLALPYIISNTHEALKAVPDSYREASM 165

Query: 315 GLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIA 374
            LGA+K +TVF  V+P ++  ILTG  +S+ R +GETAP+LF G   ++T  P  + D A
Sbjct: 166 ALGATKGETVFKVVIPASISRILTGVIISVGRIIGETAPILFTGAAFYITSNPDSLLDPA 225

Query: 375 TAFPVQIYLWAA---DAERPFVERTFGAILLLLI-FLAVINTAMLWLRNR 420
            + P  I++ +    +A    +E T   ++++++   AV+N   L  R +
Sbjct: 226 MSLPTHIFVLSTVYPEAVTSNLEGTISVMMIIVVAIFAVVNLKRLSERRK 275


>gi|256423402|ref|YP_003124055.1| phosphate ABC transporter inner membrane protein [Chitinophaga
           pinensis DSM 2588]
 gi|256038310|gb|ACU61854.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chitinophaga pinensis DSM 2588]
          Length = 280

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/262 (32%), Positives = 141/262 (53%), Gaps = 27/262 (10%)

Query: 168 QWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            WK+   L S+G                      GI  A+ G++ + L+   ++ PLGI+
Sbjct: 40  SWKFVTTLPSNGM------------------TKGGILPAITGTVILTLLTAVVAVPLGIS 81

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
            AIYL E++   + +  ++A+I NL+ VPSI+YG+ G A+ +    M  S  +  GL L 
Sbjct: 82  CAIYLNEYAPDHWVTRLIRASIRNLSGVPSIIYGLFGLALFVKGLHMGTS-VIAAGLTLG 140

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           L++LP II  T  ALR +P+S R AALG+GA++ +++   VLP A+P ILTG  ++L+RA
Sbjct: 141 LLSLPYIISTTEEALRRIPASTREAALGIGATQFESIRDVVLPSALPGILTGVVLTLSRA 200

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAE-----RPFVERTFGAILL 402
            GETAP+LF G+  ++T     +     A P  +Y+ +   +     RP     +G  L+
Sbjct: 201 AGETAPILFTGVAFYITGSSGFLNQEFMALPYHLYMLSTQHQSIVEVRPL---AYGTALV 257

Query: 403 LLIFLAVINTAMLWLRNRFKKR 424
           L+I + ++N    ++R +    
Sbjct: 258 LIIVVFLLNLTAFYIRYKHSNN 279


>gi|293400680|ref|ZP_06644825.1| phosphate ABC transporter, permease protein PstA
           [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305706|gb|EFE46950.1| phosphate ABC transporter, permease protein PstA
           [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 414

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 139/228 (60%), Gaps = 6/228 (2%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  +++ +LY+++I + ++ PLGI +AIYL E++ K   +S +++ I  L  VPSI++
Sbjct: 189 GGIRGSLLTTLYLIMISLLIALPLGIGAAIYLHEYAAKNKITSGIRSAIEMLTGVPSIIF 248

Query: 261 GILGSAVLINFFKM---PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLG 317
           G++G AVL    K+     +  L+G L +A++ LP II +   AL  VP ++R A+L LG
Sbjct: 249 GLMGVAVLFPLTKLAGADTTNVLLGSLTMAIILLPIIIRSCEEALAIVPQTLRDASLSLG 308

Query: 318 ASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAF 377
           A++ QT+F  VLP A+P IL+G  +S+ R +GE+A L++  M  +V D P  ++   T+ 
Sbjct: 309 ANQSQTIFKIVLPCAVPGILSGVLLSIGRVIGESAALIYT-MGTYVNDSPTLLSQ-GTSL 366

Query: 378 PVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            V IY   + +E+P  E      +++L+F+ ++N  +  +  RF K W
Sbjct: 367 AVHIYNIMS-SEQPNFELACAISIVILVFVFMLNLLVKLMSRRFNKAW 413


>gi|227539737|ref|ZP_03969786.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227240379|gb|EEI90394.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 284

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 126/229 (55%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G++ + LI    + P GI  AIYL E++     +  ++A I NL+ VPSI+Y
Sbjct: 59  GGILSPIIGTVLLTLITALFAIPFGICCAIYLNEYAQDNMLTRLIRAAIRNLSGVPSIIY 118

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +    M  S  +  GL L L++LP II  T  AL  +P S R  ALG+GA++
Sbjct: 119 GLFGLALFVQALNMGTSL-MAAGLTLGLLSLPYIITTTEEALMRIPQSTREGALGVGATQ 177

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            + +   VLP AMP ILTG  ++L+RA GETAP+LF G   ++      +     A P  
Sbjct: 178 FECIKDVVLPSAMPGILTGVVLTLSRAAGETAPILFTGAAFYINGTNGYMNQEFMALPYH 237

Query: 381 IYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +   +     RP     +G  L+L++ + ++N    ++R +++K 
Sbjct: 238 LYMLSTQHQAIEEVRPI---AYGTALILVVVVFLMNLTAFYIRYKYRKN 283


>gi|303327852|ref|ZP_07358292.1| phosphate ABC transporter, permease protein PstA [Desulfovibrio sp.
           3_1_syn3]
 gi|302862213|gb|EFL85147.1| phosphate ABC transporter, permease protein PstA [Desulfovibrio sp.
           3_1_syn3]
          Length = 292

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 134/228 (58%), Gaps = 7/228 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G+  + L  + L+FP+G+ASA+YL E++ +  F+ +V+  +NNLA VPS+V+
Sbjct: 67  GGIWPCILGTAILSLGALLLAFPMGVASAVYLHEYAKRNAFARYVRLGVNNLAGVPSVVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G +  + F     S  L G L LA++TLP II     ALR+VP + R A+L LGA+K
Sbjct: 127 GLFGLSFFVTFCGFGVSI-LSGVLTLAVLTLPVIIGTAEEALRSVPDTYREASLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A+P +LTG+ + +ARA GETA ++F   V +    P  +     A P  
Sbjct: 186 SQTIARVVLPCALPGMLTGAILGVARAAGETAAIMFTAAVFYTPKTPDSIFSAVMALPYH 245

Query: 381 IYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ A       +E+T    +G  L+L++ +  +N   + LR+  ++R
Sbjct: 246 MYVLATAGTE--IEKTRPLQYGTGLVLILLVLGMNLLAVLLRDHLQRR 291


>gi|300773878|ref|ZP_07083747.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300760049|gb|EFK56876.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 284

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 126/229 (55%), Gaps = 9/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G++ + LI    + P GI  AIYL E++     +  ++A I NL+ VPSI+Y
Sbjct: 59  GGILSPIIGTVLLTLITALFAIPFGICCAIYLNEYAQDNMLTRLIRAAIRNLSGVPSIIY 118

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +    M  S  +  GL L L++LP II  T  AL  +P S R  ALG+GA++
Sbjct: 119 GLFGLALFVQALNMGTSL-MAAGLTLGLLSLPYIITTTEEALMRIPQSTREGALGVGATQ 177

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            + +   VLP AMP ILTG  ++L+RA GETAP+LF G   ++      +     A P  
Sbjct: 178 FECIKDVVLPSAMPGILTGVVLTLSRAAGETAPILFTGAAFYINGTNGYMNQEFMALPYH 237

Query: 381 IYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +   +     RP     +G  L+L++ + ++N    ++R +++K 
Sbjct: 238 LYMLSTQHQAIEEVRPI---AYGTALILVVVVFLMNLTAFYIRYKYRKN 283


>gi|119356867|ref|YP_911511.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides DSM 266]
 gi|119354216|gb|ABL65087.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chlorobium phaeobacteroides DSM 266]
          Length = 448

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 93/304 (30%), Positives = 162/304 (53%), Gaps = 23/304 (7%)

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           +DP+ + K   V   AS    S ++ + Y   N+  + + ++  +              +
Sbjct: 158 SDPTAMSKEYFVGRAASFQGTSLVRLFPYVEKNIVHILEPEFTVY--------------W 203

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GF  + +       GI   + G+ ++ +  +  +FP+G+ +A+Y  E++ +GFF+S +++
Sbjct: 204 GFLTDSSLDSHIFGGIWPEIQGTFFLAIGAMLFAFPVGVIAAVYFTEYAKEGFFNSMLRS 263

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGLILALMTLPSIIIATGVALRTVP 306
             + LA VPSIV+G+ G A  IN  K+  S + L G L LA+M LP+II A   A+ +VP
Sbjct: 264 ANSTLAGVPSIVFGLFGLAFFINTMKVSESKSVLAGSLTLAIMILPTIIRAAEEAILSVP 323

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
            + + A+L LG++K  T+   ++P A+P ILTG  +SL RA GETAP++F   V+     
Sbjct: 324 KTYKEASLSLGSTKWNTIVTVIIPAALPGILTGGIISLGRAAGETAPIIFTAAVS--VGS 381

Query: 367 PVGVTDIAT----AFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNR 420
            +G+ D+ T    A    IY  A++ E     R   +G +L L+  + ++N + + LR R
Sbjct: 382 AIGLADVFTSPTPALSWNIYNLASEHEMAGEIRHVQYGMVLALVSIVLILNLSAILLRAR 441

Query: 421 FKKR 424
             K+
Sbjct: 442 ISKK 445


>gi|242280929|ref|YP_002993058.1| phosphate ABC transporter inner membrane subunit PstA
           [Desulfovibrio salexigens DSM 2638]
 gi|242123823|gb|ACS81519.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio salexigens DSM 2638]
          Length = 318

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 132/228 (57%), Gaps = 7/228 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   +VG++ +    + ++ P GIA+AIYL E++        ++  INNLA VPS+V+
Sbjct: 91  GGIFPCIVGTIVLSYGALMIALPWGIATAIYLNEYATSPRLVRIIRLGINNLAGVPSVVF 150

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ +    M  S  + G   L  + LP +I A+  ALR+VP + R A+LGLGA+K
Sbjct: 151 GLFGLSLFVTVMGMGVSI-MAGVCTLGALALPLVIGASEEALRSVPQTYREASLGLGATK 209

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT++  VLP A+P +LTG+ ++L+RA GETA ++F   V F  + P  + D   A P  
Sbjct: 210 WQTIYKVVLPAALPGMLTGAILTLSRAAGETAAIMFTAAVFFTPEMPESLFDDVMALPYH 269

Query: 381 IYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A       +E+T    +G  L+L+  +  +N   +++R + +K+
Sbjct: 270 IYVLATAGTE--IEKTRHIQYGTSLVLITLVLSMNMLAIYIRAKMQKK 315


>gi|110597977|ref|ZP_01386258.1| Phosphate transport system permease protein 2 [Chlorobium
           ferrooxidans DSM 13031]
 gi|110340426|gb|EAT58915.1| Phosphate transport system permease protein 2 [Chlorobium
           ferrooxidans DSM 13031]
          Length = 448

 Score =  135 bits (341), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 85/245 (34%), Positives = 140/245 (57%), Gaps = 9/245 (3%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           +GF  + +       GI   + G+ ++ +  +  +FPLG+ +A+Y  E++  GFF+S ++
Sbjct: 203 WGFITDSSVDSHIFGGIWPEIQGTFFLAVGAMLFAFPLGVIAAVYFTEYAKSGFFNSMLR 262

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG-LILALMTLPSIIIATGVALRTV 305
           +  + LA VPSIV+G+ G A  IN  K+  S +++ G L LA+M LP+II A   A+  V
Sbjct: 263 SANSTLAGVPSIVFGMFGLAFFINTLKVSESKSVIAGSLTLAIMILPTIIRAAEEAILAV 322

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R A+L LG++K  T+   +LP A+P ILTG  +SL RA GETAP++F   V+  + 
Sbjct: 323 PKTYREASLSLGSTKWNTIATVILPAALPGILTGGVISLGRAAGETAPIIFTAAVSVGS- 381

Query: 366 YPVGVTDI----ATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRN 419
             +G+ D+      A    IY  A++ E     R   +G +L L+  + ++N + + LR 
Sbjct: 382 -AIGLADVFSSPTPALSWNIYNLASEHEAAAQIRHVQYGMVLALVSIVLLLNLSAIVLRA 440

Query: 420 RFKKR 424
           R  K+
Sbjct: 441 RISKK 445


>gi|310779967|ref|YP_003968299.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Ilyobacter polytropus DSM 2926]
 gi|309749290|gb|ADO83951.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Ilyobacter polytropus DSM 2926]
          Length = 281

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/239 (35%), Positives = 130/239 (54%), Gaps = 3/239 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
            + F   G  S     GI   +VGS+ + +  I  + P GI + IYL E+S+  +    +
Sbjct: 43  TWSFITEGPKSGMREGGIFPVIVGSILLTIGTIIAAVPFGILTGIYLVEYSNDNWLRRII 102

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
              I NLA +PSIVYG+ G A  +    M RS  + G L L +M+LP II AT  +L  +
Sbjct: 103 NLTIVNLAGIPSIVYGLFGMAFFVMALGMGRSL-MAGSLTLGIMSLPVIITATRESLLAI 161

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S+R A+L LGA++ +T +  VLP A+P ILTG  +S++RA GETAP++F     ++  
Sbjct: 162 PKSMREASLALGATRWETTWKIVLPAALPGILTGIILSVSRAAGETAPIMFTAAAFYLPF 221

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV-INTAMLWLRNRFKK 423
            P  ++D   A P  +Y+ +        E      L +L+F+ V  N    ++RN+F+K
Sbjct: 222 LPESLSDQVMALPYHLYVISTQVPN-MPESNMMGTLFVLVFITVGFNLLGAYIRNKFRK 279


>gi|37519579|ref|NP_922956.1| phosphate ABC transporter permease protein [Gloeobacter violaceus
           PCC 7421]
 gi|35210570|dbj|BAC87951.1| phosphate ABC transporter permease protein [Gloeobacter violaceus
           PCC 7421]
          Length = 304

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 91/249 (36%), Positives = 141/249 (56%), Gaps = 14/249 (5%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF +  S   E AGI  A VGS  +ML+    + PLG+AS IYLEE++ K +F+  ++ N
Sbjct: 54  FFTSFPSRFAEQAGILSAWVGSCLVMLVTAAAAVPLGVASGIYLEEYAPKNWFTEIIEVN 113

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA VPSI++G++   + +    +  S    G  +  L+ LP +I++T  +LR VP S
Sbjct: 114 ITNLAGVPSIIFGLMALGLFVYGLGLGESILTAGLTLALLI-LPIVIVSTRESLRAVPDS 172

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG---MVAFVTD 365
           IR AA  LGA++ Q V  H+LP +   ILTG  + L+RA+GETAPL+ +G    +AF+ D
Sbjct: 173 IREAAYALGATRWQVVSDHILPYSTGGILTGIIIGLSRAIGETAPLITIGALTFIAFLPD 232

Query: 366 YPVG----------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            P+           ++   T  P+Q++ W +  +  F      A L+L++    +N   +
Sbjct: 233 LPLRAEFPFFSFQWLSSGFTVLPIQMFNWVSRPQEAFQLNAAAAGLVLIVMTLGMNALAI 292

Query: 416 WLRNRFKKR 424
           +LR  F+KR
Sbjct: 293 YLRYSFRKR 301


>gi|312891832|ref|ZP_07751338.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
 gi|311295666|gb|EFQ72829.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
          Length = 281

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/231 (37%), Positives = 140/231 (60%), Gaps = 13/231 (5%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G+L + +I   ++ P GI  AIYL E++   + +  ++A+I NLA VPSI+Y
Sbjct: 56  GGILPAIIGTLLLTIITALVAAPFGICCAIYLNEYAADSWLTRIIRASIRNLAGVPSIIY 115

Query: 261 GILGSAVLINFFKMPRSTALVG-GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGAS 319
           G+ G A+ +   +M   T+LV  GL L L++LP III T  ALR VP+ +R AAL +GA+
Sbjct: 116 GLFGLALFVQGLQM--GTSLVAAGLTLGLLSLPYIIITTEEALRRVPNRMREAALAVGAT 173

Query: 320 KVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIA-TAFP 378
           + +++   VLP A+P +LTG  ++L+RA GETAP+LF G VAF  + P G  +      P
Sbjct: 174 QFESIRDVVLPSAVPGMLTGLVLTLSRAAGETAPILFTG-VAFYINKPAGYLNQEFMTLP 232

Query: 379 VQIYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             +Y+ +   +     RP     +G  L+L+I + ++N +  ++R ++ K 
Sbjct: 233 YHLYMLSTQHQAIEQVRPLA---YGTALVLIILVFLLNLSAFYIRYQYSKH 280


>gi|21673726|ref|NP_661791.1| phosphate ABC transporter, permease protein, putative [Chlorobium
           tepidum TLS]
 gi|21646849|gb|AAM72133.1| phosphate ABC transporter, permease protein, putative [Chlorobium
           tepidum TLS]
          Length = 448

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 137/247 (55%), Gaps = 9/247 (3%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           F +GF  + +       GI   + G+ ++ +  +  +FPLGI +A+Y  E++++G+F+S 
Sbjct: 201 FYWGFITDSSIDSHIFGGIWPEIKGTFFLAVGAMLFAFPLGIVAAVYFTEYANEGWFTSM 260

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGLILALMTLPSIIIATGVALR 303
           +++  N LA VPSIV+G+ G A  IN   +  S + L G L LA+M LP+II A   A+ 
Sbjct: 261 LRSANNTLAGVPSIVFGLFGLAFFINTLHVSHSKSVLAGSLTLAIMILPTIIRAAEEAIL 320

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP + + A+L LG++K  T+   +LP A+P ILTG  +SL RA GETAP++F   V+  
Sbjct: 321 AVPKTYKEASLSLGSTKWNTIMTVILPAALPGILTGGVISLGRAAGETAPIIFTAAVS-- 378

Query: 364 TDYPVGVTDI----ATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWL 417
               VG+ D+      A    IY   ++ E     R   +G +L L+  +  +N + +  
Sbjct: 379 VGAAVGLGDVLNTPTPALSWNIYNLVSEHEMASQIRYVQYGMVLALISIVLFLNLSAIMW 438

Query: 418 RNRFKKR 424
           R R  K+
Sbjct: 439 RARISKK 445


>gi|171911087|ref|ZP_02926557.1| ABC-type phosphate transport system, permease component
           [Verrucomicrobium spinosum DSM 4136]
          Length = 378

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 99/303 (32%), Positives = 151/303 (49%), Gaps = 36/303 (11%)

Query: 158 PANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASS-RPEVAGIGVAVVGSLYMMLI 216
           P  +H + D Q   + K D  GA  +    G  +    +      GI   +VG+  ++L+
Sbjct: 75  PETLHVLEDKQGHIY-KTDPKGADAIKHQLGDNLRQEKTISYSGGGILGPIVGTFLLVLV 133

Query: 217 VIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI------- 269
            I ++  LGI+SAIYL E++  G F  +V+  I NLA VPS+V+G+ G  V +       
Sbjct: 134 CIVVALFLGISSAIYLSEYAKPGKFIEWVRLAILNLAGVPSVVFGLFGLGVFVLAAPVFT 193

Query: 270 -------------NFFKMP----RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSA 312
                         F +M      ++ L G   LA + LP II A+   LR VP   R  
Sbjct: 194 NTPLDRALLVIPLGFTQMSFQGWDTSVLSGAFTLAFVILPVIITASEECLRAVPMGFRET 253

Query: 313 ALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP----- 367
           +L LGA++ QT++  VLP AMP ILT S + +ARA GETAP++F   +AF    P     
Sbjct: 254 SLALGATRWQTIWRSVLPFAMPGILTSSILGIARAAGETAPIMFTAALAFKDKLPWQGEA 313

Query: 368 --VGV-TDIATAFPVQIYLWAAD-AERPFVERT-FGAILLLLIFLAVINTAMLWLRNRFK 422
              GV T+   A P  IY  AA   +  + ER  +G++ + L+ +  + TA + LR + +
Sbjct: 314 GFGGVFTESVQALPYHIYTLAARIPQNEYSERAQYGSVFVFLVLVMTLATASVLLRRKLR 373

Query: 423 KRW 425
            ++
Sbjct: 374 AKY 376


>gi|219851146|ref|YP_002465578.1| phosphate ABC transporter, inner membrane subunit PstC
           [Methanosphaerula palustris E1-9c]
 gi|219545405|gb|ACL15855.1| phosphate ABC transporter, inner membrane subunit PstC
           [Methanosphaerula palustris E1-9c]
          Length = 645

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 129/223 (57%), Gaps = 2/223 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+LY++   I  + P G+ +AIYL E+  +G+ +  ++  I+ L   PSIV+
Sbjct: 421 GGIFPAIVGTLYLVAGSILFALPFGVGAAIYLNEYRMEGYLTQMIRTGIDLLNGTPSIVF 480

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G   L+ +  +  S  L G L L LM LP+II  T  AL+ VPSS+R  +L LGA++
Sbjct: 481 GLFGFTFLVLYLDIGVSM-LAGQLTLGLMVLPTIIRTTEEALKNVPSSLREGSLALGATR 539

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A+  I+TG+ +S+ RA GETAP+LF  +V      P  + D   A P  
Sbjct: 540 WQTISRVVLPSAVAGIITGTILSIGRAAGETAPILFTAVVFSQRYLPSSILDPVMALPYH 599

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +++ + +       R +G  L+L++ +  I +  ++LRN F+ 
Sbjct: 600 LFILSTNVPDSSQNR-YGTALVLIMLVIGIYSIAIYLRNHFQN 641



 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 102/204 (50%), Gaps = 17/204 (8%)

Query: 181 LFLDFNYGF-------FINGASSRPEVA----GIGVAVVGSLYMMLIVIGLSFPLGIASA 229
           LF D   GF       F+ G +  P  A    GI   +VG+L + L  + ++ PL I +A
Sbjct: 50  LFKDSYLGFVQIGILPFLTGMTWNPVAAIPSYGIAPLIVGTLLVTLGSMVIAVPLSIGTA 109

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF----FKMPRSTA-LVGGL 284
           +Y+ E +        ++  I  LA +PS+VYG  G  V+ N+    F  P   + L G L
Sbjct: 110 VYISELAPPRV-KLIIKPAIELLAGIPSVVYGFFGLMVMTNWLRVLFDQPSGESWLAGSL 168

Query: 285 ILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL 344
           +L +M LP+I      A+R+VP   R  +L +GA++ QT+   V+P A+  I     + +
Sbjct: 169 LLGIMALPTITSVAEDAIRSVPQEYREGSLAVGATRWQTISKVVVPAALSGITAAIILGM 228

Query: 345 ARALGETAPLLFVGMVAFVTDYPV 368
            RA+GET  ++ V   + V   P+
Sbjct: 229 GRAIGETMAVMMVTGNSAVIPSPI 252


>gi|220903840|ref|YP_002479152.1| phosphate ABC transporter inner membrane subunit PstA
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868139|gb|ACL48474.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 306

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 117/196 (59%), Gaps = 3/196 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G+  + L  + L+FPLG+ASA+YL E++ +  F+ +V+  +NNLA VPS+V+
Sbjct: 81  GGILPCIIGTAILSLGALLLAFPLGVASAVYLHEYAKRNAFARYVRLGVNNLAGVPSVVF 140

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G +  + F  +  S  L G L LA++TLP II     ALR VP + R A+L LGA+K
Sbjct: 141 GLFGLSFFVTFCGLGVSI-LSGVLTLAVLTLPVIIGTAEEALRNVPDTYREASLALGATK 199

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A+P +LTG+ + +ARA GETA ++F   V +    P  +     A P  
Sbjct: 200 SQTISRVVLPCALPGMLTGAILGVARAAGETAAIMFTAAVFYTPKTPDSIFSSVMALPYH 259

Query: 381 IYLWAADAERPFVERT 396
           +Y+ A       +E+T
Sbjct: 260 MYVLATAGTE--IEKT 273


>gi|237736375|ref|ZP_04566856.1| phosphate ABC transporter [Fusobacterium mortiferum ATCC 9817]
 gi|229421417|gb|EEO36464.1| phosphate ABC transporter [Fusobacterium mortiferum ATCC 9817]
          Length = 297

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 136/259 (52%), Gaps = 23/259 (8%)

Query: 168 QWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            W++  ++ +DG                      GI  A+VG+L++ L  I ++ P GI 
Sbjct: 58  SWEFLSEMPTDGM------------------RAGGIFPAIVGTLWLTLGTIIVAVPFGIF 99

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           + +YL E++   F +  +   I NLA +PSI+YG+ G A+ + F     S  L G L L 
Sbjct: 100 TGVYLVEYAKDNFLTRIINLTIINLAGIPSIIYGLFGMALFVIFLGFDVSI-LSGSLTLG 158

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           +M LP II AT  +L  +P+ +R A+L LGA+K +T+   +LP AMP ILTG  +S++RA
Sbjct: 159 IMCLPVIITATRESLLAIPNHLREASLALGATKWETITKVILPAAMPGILTGVILSISRA 218

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF--GAILLLLI 405
            GETAP++F  +  ++   P+   D   A P  +Y+     + P +  +F  G + +L++
Sbjct: 219 AGETAPIMFTAVAFYLPFLPISYWDQVMALPYHLYV--ISTQVPNMPPSFINGTLFILVV 276

Query: 406 FLAVINTAMLWLRNRFKKR 424
                N    ++R RF  +
Sbjct: 277 ITLSFNLFGAFIRQRFNSK 295


>gi|212704967|ref|ZP_03313095.1| hypothetical protein DESPIG_03034 [Desulfovibrio piger ATCC 29098]
 gi|212671631|gb|EEB32114.1| hypothetical protein DESPIG_03034 [Desulfovibrio piger ATCC 29098]
          Length = 291

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 132/228 (57%), Gaps = 7/228 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   +VG+  + L  + L+FPLG+A+A+YL E++    F+  V+  +NNLA VPS+V+
Sbjct: 64  GGILPCIVGTAILALGSLLLAFPLGVATAVYLHEYAGNTPFARMVRLGVNNLAGVPSVVF 123

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G +  + F  M  S  L G L LA++TLP II     +LR+VP + R A+L LGA K
Sbjct: 124 GLFGLSFFVTFCGMGVSI-LSGILTLAVLTLPVIISTAEESLRSVPDTYRQASLALGAGK 182

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP AMP +LTG+ + +ARA GETA ++F   V +    P  +     A P  
Sbjct: 183 AQTITRVVLPCAMPGMLTGAILGVARAAGETAAIMFTAAVFYTPKNPDSIFSSVMALPYH 242

Query: 381 IYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ A       +E+T    +G  L+L++ +  +N   + LR+  ++R
Sbjct: 243 MYVLATAGTD--IEKTRPLQYGTGLVLILLVLGMNLLAIILRDHLQRR 288


>gi|194336739|ref|YP_002018533.1| phosphate ABC transporter, inner membrane subunit PstA [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194309216|gb|ACF43916.1| phosphate ABC transporter, inner membrane subunit PstA [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 448

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/245 (34%), Positives = 138/245 (56%), Gaps = 9/245 (3%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           +GF  + +       GI   + G+ ++ +  +  +FPLG+ +A+Y  E++  GF +S ++
Sbjct: 203 WGFITDSSVDSHFFGGIWPEIQGTFFLAIGAMLFAFPLGVIAAVYFTEYAKPGFLNSMLR 262

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGLILALMTLPSIIIATGVALRTV 305
           +  + LA VPSIV+G+ G A  IN  K+  S + L G L LA+M LP+II A   A+  V
Sbjct: 263 SANSTLAGVPSIVFGMFGLAFFINTMKVSESKSVLAGALTLAIMILPTIIRAAEEAILAV 322

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R A+L LG++K  T+   +LP A+P ILTG  +SL RA GETAP++F   V+    
Sbjct: 323 PKTYREASLSLGSTKWNTIATVILPAALPGILTGGVISLGRAAGETAPIIFTAAVS--VG 380

Query: 366 YPVGVTDIAT----AFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRN 419
             +G+ D+ +    A    IY  A++ E     R   +G +L L+  + ++N + + LR 
Sbjct: 381 SAIGLADVLSSPTPALSWNIYNLASEHEAASQIRHVQYGMVLALVSIVLLLNLSAIVLRA 440

Query: 420 RFKKR 424
           R  K+
Sbjct: 441 RISKK 445


>gi|111075042|gb|ABH04888.1| ABC-type phosphate transporter permease component pstA
           [Heliobacillus mobilis]
          Length = 265

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 129/223 (57%), Gaps = 1/223 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+++  +  + P+G+ +A+YL E++ + + +  ++  + NLA VPS+V+
Sbjct: 40  GGIFPAIVGTFYLIVGTVLFALPVGVMTAVYLVEYARESWVTRVIRLAVVNLAGVPSVVF 99

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G    + F     S  L G L LALM LP II  +  ALR VP+  R A+L LGA+K
Sbjct: 100 GLFGLGFFVLFLNFGASI-LAGSLTLALMVLPVIITTSEEALRAVPNGFREASLALGATK 158

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+   VLP A+P I+TGS + LARA GETAP+L      F+   P  + D   A P  
Sbjct: 159 LQTILFIVLPNALPGIMTGSILGLARAAGETAPILLTAAAFFLPRLPNSIFDQVMALPYH 218

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +Y+ A        +  +G   +L++ +  +N A + LR+ F++
Sbjct: 219 LYVIATQVPNADEKIPYGTATVLMLLVLGLNLAAVLLRSYFRR 261


>gi|145219802|ref|YP_001130511.1| phosphate ABC transporter, inner membrane subunit PstA
           [Prosthecochloris vibrioformis DSM 265]
 gi|145205966|gb|ABP37009.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chlorobium phaeovibrioides DSM 265]
          Length = 448

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 119/190 (62%), Gaps = 3/190 (1%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           F +GFF + +       GI   + G+ ++ +  +  +FPLG+ +A+Y  E++ +GFF+S 
Sbjct: 201 FYWGFFTDRSLDAHIFGGIWPEIQGTFFLAIGAMLFAFPLGVIAAVYFTEYAKEGFFTSI 260

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGLILALMTLPSIIIATGVALR 303
           +++  + LA VPSIV+G+ G A  IN  K+  S + L G L LA+M LP+II A   A+ 
Sbjct: 261 LRSANSTLAGVPSIVFGLFGLAFFINTMKVSESKSVLAGSLTLAIMILPTIIRAAEEAIL 320

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP + + A+LGLG++K  T+   +LP A+P I+TG  +SL RA GETAP++F   V+  
Sbjct: 321 SVPKTYKEASLGLGSTKWNTIATVILPAALPGIITGGIISLGRAAGETAPIIFTAAVSVG 380

Query: 364 TDYPVGVTDI 373
           +   +G+ D+
Sbjct: 381 S--AIGIADV 388


>gi|188585608|ref|YP_001917153.1| phosphate ABC transporter, inner membrane subunit PstA
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179350295|gb|ACB84565.1| phosphate ABC transporter, inner membrane subunit PstA
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 305

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 134/228 (58%), Gaps = 9/228 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G+ Y+ ++ +  S P+GI++AIYL E++ KG+F   ++ +I NLA +PSIVY
Sbjct: 78  GGIFPAILGTFYLSVLTLLFSLPIGISAAIYLHEWAGKGWFVRLIRLSIRNLAGIPSIVY 137

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+  +      S      L L+LMTLP +I ++  AL+ VP++ R AAL LGA++
Sbjct: 138 GLFGLALFASGMGFGSSLLSAS-LTLSLMTLPIVITSSEEALKGVPNNFRQAALSLGATR 196

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            +T+   VLP A+P + TGS + LARA GETAP++  G   ++   P  V D   A P  
Sbjct: 197 WETIKLQVLPYALPGMATGSILGLARAAGETAPIILTGAAYYLPYLPESVFDRFMALPYH 256

Query: 381 IYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +Y+ A         RP     FG  L+L++ +  +N+  + +R + +K
Sbjct: 257 LYILATQHSDISTVRPI---AFGTALVLILIVLTVNSVAILIRVKIRK 301


>gi|86608553|ref|YP_477315.1| phosphate ABC transporter, permease protein PtsA [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557095|gb|ABD02052.1| phosphate ABC transporter, permease protein PtsA [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 296

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/187 (42%), Positives = 120/187 (64%), Gaps = 4/187 (2%)

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSI 258
           +V G G AV+G++ ++ I I ++FP+G+ +AIYL EF      +S ++  I  L  VPSI
Sbjct: 72  QVGGFGNAVLGTIIVVSIAITITFPIGLFAAIYLSEFGQNSSTASSLRFIIKVLTGVPSI 131

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           + G+    VL+        +AL GG+ L+++TLP II++   ALR VP+  R+AA  LGA
Sbjct: 132 IAGVFAYGVLV--LSTKTFSALSGGVALSVLTLPIIILSCEEALRLVPADTRAAAYALGA 189

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
           S+VQTVF  VLP A+P +LTG T+++ARA GETAPL+F  + +F+  +P G+     +  
Sbjct: 190 SRVQTVFRVVLPAALPVVLTGVTLAIARAAGETAPLIFTALFSFL--WPDGLLKPVASLA 247

Query: 379 VQIYLWA 385
           V IY +A
Sbjct: 248 VLIYNFA 254


>gi|124485937|ref|YP_001030553.1| hypothetical protein Mlab_1117 [Methanocorpusculum labreanum Z]
 gi|124363478|gb|ABN07286.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methanocorpusculum labreanum Z]
          Length = 627

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 136/225 (60%), Gaps = 4/225 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G+L ++   I ++ P+GI SAIYL E+S     +  ++   + LA  PSIV+
Sbjct: 404 GGIFPAIIGTLQLVGGAILIALPIGIGSAIYLHEYSRDNILTRLLRTGNDLLAGTPSIVF 463

Query: 261 GILGSAVLINFFKMPRSTALVGGLI-LALMTLPSIIIATGVALRTVPSSIRSAALGLGAS 319
           G+ G A L+ F        L+ G++ LALM LP+II  T  AL++VP+S+R A+LGLGA+
Sbjct: 464 GVFGFAFLVIFLGW--GVCLLAGMVCLALMILPTIIKTTEEALKSVPNSLREASLGLGAT 521

Query: 320 KVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPV 379
           K QT+ + VLP A P ILTG+ +S+ RA GETAP++F  +V       + + D   A P 
Sbjct: 522 KWQTLKNVVLPSAAPGILTGTILSIGRAAGETAPIMFTAVVFSKRFISMDLFDPVMALPF 581

Query: 380 QIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +Y+ A        ++   A++L+ + +A+   A++ +R RF+KR
Sbjct: 582 HLYVLATSVPGSQTQQYGTAVVLISLVMAIYLVAIV-IRKRFQKR 625



 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 96/190 (50%), Gaps = 11/190 (5%)

Query: 188 GFFING----ASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           GFF N       S P   GI   ++ +L +    +  + PLGI SA++L   + +     
Sbjct: 51  GFFFNTVWNPTGSTPSY-GIATLIIDTLLVTFGAMIFAVPLGIISAVFLAYLAPQKV-RD 108

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFK----MPRSTA-LVGGLILALMTLPSIIIAT 298
            V+  I  LA +PS+VYG  G  VL +F +    +P   + L   ++L +M LP+I+  +
Sbjct: 109 IVKPAIELLAGIPSVVYGFFGMVVLCSFLQSTLNIPSGFSWLAASILLGIMALPTIVSVS 168

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL  VP   + A+LGLGA+K QT+   ++P A   I     + + RA+GET  ++ V 
Sbjct: 169 EDALYVVPKDYKEASLGLGATKWQTISRVLIPAAASGISAAVILGIGRAIGETMAVMMVA 228

Query: 359 MVAFVTDYPV 368
             A V   P+
Sbjct: 229 GNAAVIPSPI 238


>gi|312887131|ref|ZP_07746735.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
 gi|311300443|gb|EFQ77508.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
          Length = 281

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 137/230 (59%), Gaps = 11/230 (4%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G++ + LI   ++ P GI  AIYL E++   + +  ++A+I NLA VPSI+Y
Sbjct: 56  GGILPAIIGTVLLTLITALIAAPFGICCAIYLNEYATDSWLTRIIRASIRNLAGVPSIIY 115

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +   +M  S    G L L L++LP III T  ALR VP+S+R AAL +GA++
Sbjct: 116 GLFGLALFVQGLQMGTSLLAAG-LTLGLLSLPYIIITTEEALRRVPNSMREAALAVGATQ 174

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIA-TAFPV 379
            +++   VLP A+P +LTG  ++L+RA GETAP+LF G VAF  + P G  +    A P 
Sbjct: 175 FESIRDVVLPSAVPGMLTGLVLTLSRAAGETAPILFTG-VAFYINKPAGYLNQEFMALPY 233

Query: 380 QIYLWAADAE-----RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +Y+ +   +     RP     +G  L+L+I +  +N +  ++R +  K 
Sbjct: 234 HLYMLSTQHQAIEQVRPLA---YGTALVLIIVVFFLNLSAFYIRYQHSKH 280


>gi|124009229|ref|ZP_01693910.1| phosphate ABC transporter, permease protein PstA [Microscilla
           marina ATCC 23134]
 gi|123985214|gb|EAY25148.1| phosphate ABC transporter, permease protein PstA [Microscilla
           marina ATCC 23134]
          Length = 285

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 133/244 (54%), Gaps = 9/244 (3%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++GFF     +     GI  A++G+L +++    ++FP+GI + I++ E++H+ +F  FV
Sbjct: 43  SWGFFTGVPENGMTEGGIFPAIMGTLILIVGSGLVAFPMGILAGIFMNEYAHQNWFKKFV 102

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +   NNLA +PSIV+G+ G A  +N      S  L G L L ++ LP II  T  +L+ +
Sbjct: 103 RLMTNNLAGIPSIVFGLFGMAFFVNGLGFGVSI-LSGCLTLGVLILPIIIRTTEESLKFI 161

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P   R A+  LGASK QT++  +LP A+P ++TG  +++ R  GETA +LF     F+  
Sbjct: 162 PDDYRLASYALGASKWQTIWRVILPAALPNVVTGVILAVGRVAGETAAILFTVAAYFLPK 221

Query: 366 YPVGVTDIATAFPVQIYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            P  + D   A P  +Y+ +      +  RP+ +   G  L LLI +  +N    W R R
Sbjct: 222 MPTSIYDETMALPYHLYVISTSGTDIEKARPYAD---GTALTLLILVFGLNLLANWYRKR 278

Query: 421 FKKR 424
             K+
Sbjct: 279 LNKK 282


>gi|312136497|ref|YP_004003834.1| phosphate abc transporter membrane protein 2, phot family
           [Methanothermus fervidus DSM 2088]
 gi|311224216|gb|ADP77072.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanothermus fervidus DSM 2088]
          Length = 284

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 132/239 (55%), Gaps = 7/239 (2%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F            GI   +V S+Y+ L  I ++ PLG+ +AIYL E++ +      +
Sbjct: 47  NLQFLTESPIEAGRAGGIAPMIVSSIYVTLTAIIVATPLGVGAAIYLAEYAAETSLIKVI 106

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +     LA++PSIVYG+ G A  + F  +  S  L GGL+LALM LP+I+     +++ V
Sbjct: 107 RFTTQTLAAIPSIVYGLFGLAFFVVFCGLGFSL-LSGGLVLALMALPTILYTAESSIKAV 165

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S R A+L LGA+K QT++  VLP A P I TG  + +ARAL E A ++FV  V   TD
Sbjct: 166 PESYREASLALGATKWQTIYKVVLPAAAPGIATGVILGMARALEEAAAVMFV--VGSATD 223

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFG--AILLLLIFLAVINTAMLWLRNRFK 422
            P  + D     P+ +YL A +     ++  +G  A+L++L+ L  I T +L  ++R K
Sbjct: 224 MPYTIFDPGRPLPLHLYLLAVEGIS--LKNAYGTAAVLVILVLLITITTNILIEKHREK 280


>gi|86606218|ref|YP_474981.1| phosphate ABC transporter, permease protein PtsA [Synechococcus sp.
           JA-3-3Ab]
 gi|86554760|gb|ABC99718.1| phosphate ABC transporter, permease protein PtsA [Synechococcus sp.
           JA-3-3Ab]
          Length = 299

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 122/187 (65%), Gaps = 4/187 (2%)

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSI 258
           +V G G AV+G++ ++ I I ++FP+G+ +AIYL EF      +SF++  I  L  VPSI
Sbjct: 75  QVGGFGNAVLGTIIVVSIAISITFPIGLFAAIYLSEFGKNSPTASFLRFIIKVLTGVPSI 134

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           + G+    VL+        +AL GG+ L+++TLP II+++  ALR VP+  R+AA  LGA
Sbjct: 135 IAGVFAYGVLV--LSSKTFSALAGGMALSVLTLPIIILSSEEALRLVPADTRAAAYALGA 192

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
           S+VQTVF  VLP A+P ILTG T+++ARA GETAPL+F  + +F+  +P G+     +  
Sbjct: 193 SRVQTVFRVVLPAALPVILTGVTLAIARAAGETAPLIFTALFSFL--WPSGLLKPVASLA 250

Query: 379 VQIYLWA 385
           V IY +A
Sbjct: 251 VLIYNFA 257


>gi|83643639|ref|YP_432074.1| phosphate ABC transporter, permease PtsA [Hahella chejuensis KCTC
           2396]
 gi|83631682|gb|ABC27649.1| phosphate ABC transporter, permease protein PtsA [Hahella
           chejuensis KCTC 2396]
          Length = 554

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 75/184 (40%), Positives = 115/184 (62%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M++I+  L  PLG+ +A+YL E++H+G  +  ++  +NNLA VPSIVY
Sbjct: 300 GGIFPAIYGTVLMVIIMSVLVTPLGVIAAVYLREYAHQGALTRIIRIAVNNLAGVPSIVY 359

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LGS +  +FF   +P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 360 GVFGLGFFIYFLGSGIDEHFFPEALPSPTFGAPGLLWASITLAILTLPVVIVATEEGLAR 419

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P SIR  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 420 IPRSIREGSLALGATKAETLWRVVLPMASPAMMTGVILAIARAAGEVAPLMLVGVVKLAP 479

Query: 365 DYPV 368
             P+
Sbjct: 480 SLPL 483


>gi|154151458|ref|YP_001405076.1| phosphate ABC transporter, inner membrane subunit PstA [Candidatus
           Methanoregula boonei 6A8]
 gi|154000010|gb|ABS56433.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methanoregula boonei 6A8]
          Length = 604

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 133/225 (59%), Gaps = 4/225 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+LY++   I ++ PLG+ +AIYL E++ +G  +  ++  ++ L   PSIV+
Sbjct: 380 GGIFPAIVGTLYLVAGAILIALPLGVGAAIYLIEYTREGRITKLIRTGVDLLNGTPSIVF 439

Query: 261 GILGSAVLINFFKMPRSTALVGGLI-LALMTLPSIIIATGVALRTVPSSIRSAALGLGAS 319
           G+ G A L+ F  +    +L+ G+I LALM LP++I  T  AL+ VP S+R  +L LGA+
Sbjct: 440 GLFGFAFLVLFLNV--GVSLIAGMITLALMVLPTVIRTTEEALKNVPQSLREGSLALGAT 497

Query: 320 KVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPV 379
           K QT+ + V+P A+P I+TG+ +S+ RA GETAP++F  +V      P  +     A P 
Sbjct: 498 KWQTIKNVVIPPAVPGIVTGAILSIGRAAGETAPIMFTAVVFSTRFLPTSLFQPVMALPY 557

Query: 380 QIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +++ + +       + +G  L+LL+ +       + +RN + K+
Sbjct: 558 HLFILSTNVPGSSTNK-YGTALVLLMLVVTFYAVAILIRNHYAKK 601



 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 89/172 (51%), Gaps = 6/172 (3%)

Query: 202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYG 261
           GI   ++G+L + L  +  + PL +  AIY+ E +      + ++     LA +PS+VYG
Sbjct: 33  GIAALIIGTLLVTLGAMVFAVPLSLGCAIYISELASP-RIKNILKPATELLAGIPSVVYG 91

Query: 262 ILGSAVLINFFKM-----PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
             G  VL NF ++        T L G ++L +M LP+II  +  A+ +VP   R  +L  
Sbjct: 92  FFGMIVLSNFIRVTFNISSGQTWLAGSILLGIMALPTIISVSEDAISSVPREYREGSLAT 151

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           GA++ QT+   ++P A+  I     + + RA+GET  ++ V   A +   P+
Sbjct: 152 GATRWQTISKVIVPAALSGIAAAIILGIGRAIGETMAVIMVTGNAAIIPSPI 203


>gi|294141826|ref|YP_003557804.1| phosphate ABC transporter permease protein [Shewanella violacea
           DSS12]
 gi|293328295|dbj|BAJ03026.1| phosphate ABC transporter, permease protein, putative [Shewanella
           violacea DSS12]
          Length = 555

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 115/426 (26%), Positives = 198/426 (46%), Gaps = 79/426 (18%)

Query: 46  KGIGALWQTHISLPIEFSETIVDPQKK------------RFMDPAILLRADYNLLVRKAL 93
           + + A +++HI   +E ++  V+ QK             R  +    L  +   +V+  L
Sbjct: 158 ENVEASFESHIERSVELNDKAVEIQKGEIGSINYAIEKLRLQERGYELDGELTPVVKADL 217

Query: 94  ARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIG--KTVEVSLLASANIDSAL 151
           A+K +I  + +  + +          + LRK    D  +I   + VEV+L     +DS L
Sbjct: 218 AQKRAILQAQYQTVEKEF--------FGLRKQAGRDSVIIKDMRDVEVTL----KLDSIL 265

Query: 152 KGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV--AVVG 209
               YS  N   + D    WF               G F++         G GV  A+ G
Sbjct: 266 D-VTYS--NRLGLLDKLGHWF------------VGVGRFVSDDPREANTEG-GVFPAIFG 309

Query: 210 SLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI 269
           +++M++++  +  P G+ +A+YL E++ KG  +  ++  + NLA VPSIVYG+ G    +
Sbjct: 310 TVFMVMLMAVIVTPFGVVAAVYLHEYAKKGPVTKMIRIAVINLAGVPSIVYGVFGLGFFV 369

Query: 270 NFF-----------KMPRST-----ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAA 313
             F            +P  T      L   L LA++TLP +I++T   L  +PSS+R A+
Sbjct: 370 YMFGGSIDQLFFPEALPAPTFGSPGVLWSALTLAILTLPVVIVSTEEGLSRIPSSVRQAS 429

Query: 314 LGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI 373
           L LGA+K +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V      P+ V   
Sbjct: 430 LALGATKAETLWRIVLPMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLPIDVN-- 487

Query: 374 ATAFP----------VQIYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRN 419
              FP          +  +++    + P VE      +    LL+  +  +N   + +RN
Sbjct: 488 ---FPFVHLERKFMHLGFHIYDVGFQSPNVEAARPLVYATSFLLVTVIVSLNLTAIAVRN 544

Query: 420 RFKKRW 425
             ++++
Sbjct: 545 HLREKY 550


>gi|269791711|ref|YP_003316615.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099346|gb|ACZ18333.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 284

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 132/230 (57%), Gaps = 13/230 (5%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   +VG++ +ML+ +  + P+G+A+A+YL E++ KG  +S V+  I +LA VPS+V+
Sbjct: 57  GGIATPLVGTIQLMLLSMAFALPIGVATAVYLTEYAPKGPVASAVRLAIRSLAGVPSVVF 116

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G +    F  +  S  L   L LA + LP ++ A   AL  VP  +R A+  +GA++
Sbjct: 117 GLFGLSFFCIFLGLGASM-LSASLTLACLVLPVVVTAAETALLNVPKDLRDASFAMGATR 175

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP AMP+I+TG+ + L R  GETAP++F G V F  ++     +   A P  
Sbjct: 176 WQTIRKVVLPTAMPSIMTGAILGLGRVAGETAPIMFTGAVFFTPNFAKSPFESVMALPYH 235

Query: 381 IYLWAA-----DAERPFVERTFGAILLLL--IFLAVINTAMLWLRNRFKK 423
           IY+ A      DA RP     +G  L+L+  +FL  + T + W R+R ++
Sbjct: 236 IYVLATAGTNIDATRPI---QYGTSLVLVGTVFLLSL-TGIAW-RSRLRR 280


>gi|154494330|ref|ZP_02033650.1| hypothetical protein PARMER_03685 [Parabacteroides merdae ATCC
           43184]
 gi|154085774|gb|EDN84819.1| hypothetical protein PARMER_03685 [Parabacteroides merdae ATCC
           43184]
          Length = 295

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 127/226 (56%), Gaps = 3/226 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+++    +SFP+GI S IY+ E++  G    F++   NNL+ VPS+V+
Sbjct: 67  GGIFPAIVGTFYLIVGSSIISFPIGIMSGIYMNEYATNGKVVRFIRIMTNNLSGVPSVVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ +N      S  + G   LALM+LP II  T  AL+++  S R  +L LGA+K
Sbjct: 127 GLFGMSLFVNALGWGDSI-IAGSFTLALMSLPLIIRTTEEALKSIDDSFRHGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIRRVVLPMAFPNIITGLILSVGRVSGETAPILFTVAAYFLPQLPGSIFDQCMALPYH 245

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +         R   +G  L+L+  + V+N     LRN F K+
Sbjct: 246 LYVISTSGTDIEASRGMAYGTALVLIAIVLVVNLLANLLRNYFAKK 291


>gi|218262380|ref|ZP_03476866.1| hypothetical protein PRABACTJOHN_02540 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223414|gb|EEC96064.1| hypothetical protein PRABACTJOHN_02540 [Parabacteroides johnsonii
           DSM 18315]
          Length = 295

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 127/226 (56%), Gaps = 3/226 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+ Y+++    +SFP+GI S IY+ E++  G    F++   NNL+ VPS+V+
Sbjct: 67  GGIFPAIVGTFYLIVGSSIISFPIGIMSGIYMNEYATNGKVVRFIRIMTNNLSGVPSVVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ +N      S  + G   LALM+LP II  T  AL+++  S R  +L LGA+K
Sbjct: 127 GLFGMSLFVNALGWGDSI-IAGSFTLALMSLPLIIRTTEEALKSIDDSFRHGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIRRVVLPMAFPNIITGLILSVGRVSGETAPILFTVAAYFLPQLPGSIFDQCMALPYH 245

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +         R   +G  L+L+  + V+N     LRN F K+
Sbjct: 246 LYVISTSGTDIEASRGMAYGTALVLIAIVLVVNLLANLLRNYFAKK 291


>gi|308050501|ref|YP_003914067.1| phosphate ABC transporter, inner membrane subunit PstA [Ferrimonas
           balearica DSM 9799]
 gi|307632691|gb|ADN76993.1| phosphate ABC transporter, inner membrane subunit PstA [Ferrimonas
           balearica DSM 9799]
          Length = 549

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 105/389 (26%), Positives = 176/389 (45%), Gaps = 73/389 (18%)

Query: 82  RADYNLLVRKALARKLSIS--DSNHALLRQASQMLSTTARYH-LRKTLMTDPSLIGKTV- 137
           R ++ L   +   RKL++   D+  AL    ++  +  A Y  L + L       GK+  
Sbjct: 182 RINHQLERLRLEQRKLALDGQDTPEALAEIDARREALNAEYQILERRLFDLREQAGKSAL 241

Query: 138 --------EVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGF 189
                   EV L  +  +D      L +P  V       W W + + S           F
Sbjct: 242 LVRDMRGQEVRLFLNDVLDVTYSNALSTPGKV-------WHWMKAVGS-----------F 283

Query: 190 FINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANI 249
            ++         G+  A+ G+++M++++  +  P G+ +A+YL E++HKG  +  ++  +
Sbjct: 284 VVDEPREANTEGGVFPAIFGTVFMVMLMAVIVTPFGVMAAVYLHEYAHKGPITRLIRIAV 343

Query: 250 NNLASVPSIVYGILG--------SAVLINFF---KMPRST-----ALVGGLILALMTLPS 293
            NLA VPSIVYG+ G           L   F    +P  T      L   L LA++TLP 
Sbjct: 344 INLAGVPSIVYGVFGLGFFVYMVGGSLDELFYPEALPNPTFGTPGVLWSALTLAILTLPV 403

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +I++T   L  +PS++R  +L LGA+K +T++  VLP+A PAI+TG  +++ARA GE AP
Sbjct: 404 VIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVLPMASPAIMTGLILAVARAAGEVAP 463

Query: 354 LLFVGMVAFVTDYPVG------------------VTDIATAFPVQIYLWAADAERPFVER 395
           L+ VG+V      PV                   + D+    P        +A RP V  
Sbjct: 464 LMLVGVVKLAPQLPVDGNFPYVHLDRKFMHLGFHIYDVGFQSP------NVEAARPLV-- 515

Query: 396 TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +    LL+  +  +N   + +RN  +++
Sbjct: 516 -YATSFLLVTVIVALNLTAIGVRNHLREK 543


>gi|95929019|ref|ZP_01311764.1| Phosphate transport system permease protein 2 [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134920|gb|EAT16574.1| Phosphate transport system permease protein 2 [Desulfuromonas
           acetoxidans DSM 684]
          Length = 530

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 142/280 (50%), Gaps = 43/280 (15%)

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            ++ D     F+          G+  A+ G++ ++ ++   SFPLG+ +AIYL E++ +G
Sbjct: 255 GIYFDKLIELFVGEPRESNTEGGLFPAIYGTVLLIFVMSLFSFPLGVIAAIYLSEYAGEG 314

Query: 240 FFSSFVQANINNLASVPSIVYGI---------LGSAVLINFF--KMPRSTALVGGLI--- 285
                V+  +NNLA +PSIVYGI         +GS +   FF  ++P  T   GGL+   
Sbjct: 315 LMVRMVRIAVNNLAGIPSIVYGIFGLGFFIYGIGSGIDQLFFPERLPTPTFGTGGLLWAS 374

Query: 286 --LALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
             LAL+T+P +I+ T  AL  +P  IR  +L LG+++ QT+   +LP+A P I+TG  +S
Sbjct: 375 LTLALLTVPVVIVTTEEALGAIPGGIREGSLALGSTRFQTLTRILLPMASPGIMTGLILS 434

Query: 344 LARALGETAPLLFVGMVAFVTDYPVG------------------VTDIATAFPVQIYLWA 385
           +ARA GE APL+  G+V      P+                   + DI    P       
Sbjct: 435 MARAAGEVAPLMITGVVKLAPSLPLDGQFPYFHLERKFMHLGFHIYDIGFQSP------N 488

Query: 386 ADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            +A RP V   F   LLL++ + V++   + LRN  KK++
Sbjct: 489 VEAARPMV---FVTTLLLVLIVIVMSGVAIRLRNHMKKKY 525


>gi|257093344|ref|YP_003166985.1| phosphate ABC transporter inner membrane subunit PstA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257045868|gb|ACV35056.1| phosphate ABC transporter, inner membrane subunit PstA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 296

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 134/244 (54%), Gaps = 7/244 (2%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F +   +      G+  A++G+++++ + + LS P+GI +AIYL E++   +F+  +
Sbjct: 56  SWEFLLTAPTDGMRTGGLFPALLGTIWLVTVALILSVPIGIFAAIYLSEYAGDNWFTRTI 115

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
              I NLA VPSIV+ + G    + FFK   S  L   L LA+MT+P +I+AT  +L+ V
Sbjct: 116 NLAIINLAGVPSIVHALFGLGAFVLFFKFGTSI-LAASLTLAVMTMPVVIVATRESLQAV 174

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R A   +GA++ QT+   VLP ++  ILTG  + ++R  GETAP++F G V F   
Sbjct: 175 PQAFREACWNMGATRWQTIRRVVLPNSITGILTGVILEVSRTAGETAPIMFTGAVFFTPF 234

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA----MLWLRNRF 421
            P  V D   A  + +++ A           FG  L+L+  +  +N+      +WLR   
Sbjct: 235 LPQSVFDQTMALSLHLFVAATQVPEIAEHVPFGIALVLIGLVLTMNSVSIAFRMWLRG-- 292

Query: 422 KKRW 425
           KK+W
Sbjct: 293 KKKW 296


>gi|332886072|gb|EGK06316.1| phosphate ABC transporter, permease PstA [Dysgonomonas mossii DSM
           22836]
          Length = 284

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 134/244 (54%), Gaps = 9/244 (3%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ F  +  +      GI  A+VG++Y+++  +  +FPLG+ SAIY  E++   +   F+
Sbjct: 41  NWEFLTSAPTEGMTSGGIFPAIVGTMYLIIGSMIFAFPLGVMSAIYTNEYAGNSWIVKFI 100

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +   NNL S+PSIV+G+ G A+ +N      S  + G L L L+ LP II  T  AL+ V
Sbjct: 101 RVMTNNLGSIPSIVFGLFGMALFVNTLGFGDSI-IAGSLTLGLLVLPLIIRTTEEALKAV 159

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S R+ +L LGA+K+QT+   VLP A+P I TG  +S+ R  GETAP+LF     F+  
Sbjct: 160 PDSYRTGSLALGATKLQTIRRVVLPAALPNITTGLILSIGRVSGETAPILFTVAAYFLPK 219

Query: 366 YPVGVTDIATAFPVQIYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            P  + D   A P  +Y+ A      +A RP     +G  L+L++ +  +N     LR  
Sbjct: 220 LPESMYDQVMALPYHLYVIATSGTDIEASRPI---AYGTALVLIVIVLFMNILATILRRY 276

Query: 421 FKKR 424
           F K+
Sbjct: 277 FGKK 280


>gi|120601813|ref|YP_966213.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio vulgaris DP4]
 gi|120562042|gb|ABM27786.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Desulfovibrio vulgaris DP4]
          Length = 309

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 131/226 (57%), Gaps = 3/226 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G++ +    + ++ P G+A+AIYL+E++  G     ++  INNLA VPS+V+
Sbjct: 83  GGILPCILGTIALSYGSMLIALPWGVATAIYLQEYARPGPLVHAIRLTINNLAGVPSVVF 142

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ +   KM  S  L G   LA + LP II A+  ALR+V  + R A+LGLGA+K
Sbjct: 143 GLFGLSMFVTAMKMGVSL-LAGMFTLAALVLPLIIGASEEALRSVSQTYREASLGLGATK 201

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A+P+ILTG+ +++ RA GETA ++F   + F    P  V D   A P  
Sbjct: 202 WQTISLVVLPAALPSILTGAILAVGRAAGETAAIMFTAAMFFSPRLPDSVFDSVMALPYH 261

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A       + R   FG  L+L++ +  +N   + +R R ++R
Sbjct: 262 IYVLATAGTEIELTRPMQFGTSLVLIVLVLGMNLMAIIMRARLQRR 307


>gi|77918271|ref|YP_356086.1| phosphate ABC transporter permease [Pelobacter carbinolicus DSM
           2380]
 gi|77544354|gb|ABA87916.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Pelobacter carbinolicus DSM 2380]
          Length = 532

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 90/266 (33%), Positives = 144/266 (54%), Gaps = 35/266 (13%)

Query: 190 FINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANI 249
           F +         G+  A+ G++ ++ I+   SFPLG+ +A+YL E++ +G     V+  +
Sbjct: 267 FCDSPRESNTEGGLFPAIFGTVMLIFIMSLFSFPLGVLAAVYLREYAREGLIVRLVRIAV 326

Query: 250 NNLASVPSIVYGILGSAVLIN---------FF--KMPRSTALVGG-----LILALMTLPS 293
           NNLA +PSIVYGI G A  +          FF  ++P  T   GG     L L+L+T+P 
Sbjct: 327 NNLAGIPSIVYGIFGLAFFVYGIGGSIDRMFFPEQLPTPTFGTGGILWASLTLSLLTVPV 386

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +I+AT  AL  +P+ +R  +L LGA+K QT+   +LP+A P I+TG  +++ARA GE AP
Sbjct: 387 VIVATEEALGAIPAGVREGSLALGATKFQTLTRILLPMASPGIMTGLILAMARAAGEVAP 446

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFP----------VQIYLWAADAERPFVERT----FGA 399
           L+  G+V      PV  T     FP          +  +++    + P VE      F  
Sbjct: 447 LMITGVVKIAPALPVDGT-----FPFVHLDRKFMHLGFHIYDIGFQSPNVEAAKPMVFVT 501

Query: 400 ILLLLIFLAVINTAMLWLRNRFKKRW 425
            LLL++ + V+++  ++LRN+ KKR+
Sbjct: 502 TLLLVLIVLVMSSVAIYLRNKMKKRY 527


>gi|87121061|ref|ZP_01076952.1| membrane protein component of ABC phosphate transporter
           [Marinomonas sp. MED121]
 gi|86163553|gb|EAQ64827.1| membrane protein component of ABC phosphate transporter
           [Marinomonas sp. MED121]
          Length = 572

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 115/184 (62%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M+L++  L  P G+ +A+YL E++ +G+ +  ++  +NNLA VPSIVY
Sbjct: 318 GGVFPAIFGTIMMVLLMTILVTPFGVVAAVYLREYASQGWLTRIIRIAVNNLAGVPSIVY 377

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         +GS++   FF   +P  T   GGL+     LAL+T+P +I+AT   L  
Sbjct: 378 GVFGLGFFIYFMGSSIDQAFFPEALPSPTFGTGGLMWASITLALLTVPVVIVATEEGLSR 437

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 438 IPRNVREGSLALGATKAETLWRVVLPMASPAIMTGVILAVARAAGEVAPLMLVGVVKLAP 497

Query: 365 DYPV 368
             P+
Sbjct: 498 SLPL 501


>gi|332666469|ref|YP_004449257.1| phosphate ABC transporter, inner membrane subunit PstA
           [Haliscomenobacter hydrossis DSM 1100]
 gi|332335283|gb|AEE52384.1| phosphate ABC transporter, inner membrane subunit PstA
           [Haliscomenobacter hydrossis DSM 1100]
          Length = 286

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 131/215 (60%), Gaps = 7/215 (3%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           W+ F K  S  A+ LDF + +   G +    + GI   ++G++++ L+    S PLGIA+
Sbjct: 31  WEVFSKGVS--AIGLDFIFDYPRKGMT----LGGIFPTIMGTIFVTLVTTVFSIPLGIAT 84

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYL E+++  + +  ++A+I NLA VPSI+YG+ G AV +    +  S+ L  GL L L
Sbjct: 85  AIYLSEYANNNWINRVIRASIRNLAGVPSIIYGLFGVAVFVQGMGL-GSSVLSSGLTLGL 143

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           +TLP II  T  AL+ VP S R  AL LGA+K + ++ +VLP A+  I+TGS + L+RA 
Sbjct: 144 LTLPYIITTTEEALKNVPHSYREGALALGATKWEAIWSNVLPSAVTGIVTGSILGLSRAA 203

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYL 383
           GETAP+LF G+  ++   P  + D   A P  +Y+
Sbjct: 204 GETAPILFTGVAFYLRYLPSSIHDSFMAMPYHLYI 238


>gi|104784367|ref|YP_610865.1| phosphate ABC transporter permease [Pseudomonas entomophila L48]
 gi|95113354|emb|CAK18082.1| phosphate ABC transporter, permease protein [Pseudomonas
           entomophila L48]
          Length = 556

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 139/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++  +NNLA VP+IVY
Sbjct: 302 GGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYAKQGPVTRLIRIAVNNLAGVPAIVY 361

Query: 261 GI---------LGSAVLINFF--KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG ++   FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSIDRLFFPESLPAPTLGTPGLLWASLTLALLAVPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 SLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +W+RN  ++++
Sbjct: 533 IATLNLSAVWIRNHLREKY 551


>gi|254490338|ref|ZP_05103527.1| phosphate ABC transporter, permease protein PstA, putative
           [Methylophaga thiooxidans DMS010]
 gi|224464471|gb|EEF80731.1| phosphate ABC transporter, permease protein PstA, putative
           [Methylophaga thiooxydans DMS010]
          Length = 561

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 139/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M++I+  +  P G+ +A+YL+E++ +G     ++  +NNLA VPSIVY
Sbjct: 307 GGIFPAIFGTVMMVIIMAIMVTPFGVVAAVYLKEYAKQGPVIRLIRIAVNNLAGVPSIVY 366

Query: 261 GILGSAVLINFF-----------KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G    + F            K+P  T    GL+     LA++T+P +I+AT   L  
Sbjct: 367 GVFGLGFFVYFVGGSIDELLFQAKLPSPTFGSPGLLWASLTLAILTVPVVIVATEEGLSR 426

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P +IR  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 427 IPRAIREGSLALGATKAETLWRTVLPMAAPAMMTGLILAVARAAGEVAPLMMVGVVKLAP 486

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+    P        +A RP V  T  A LL+LI 
Sbjct: 487 ALPVDNIAPYLHLDRQFMHLGFHIYDVGFQSP------NVEAARPLVYAT--AFLLVLII 538

Query: 407 LAVINTAMLWLRNRFKKRW 425
           + V+N A + +RNR ++ +
Sbjct: 539 I-VLNMAAIGIRNRLRETY 556


>gi|148550435|ref|YP_001270537.1| phosphate ABC transporter inner membrane subunit PstA [Pseudomonas
           putida F1]
 gi|148514493|gb|ABQ81353.1| phosphate ABC transporter, inner membrane subunit PstA [Pseudomonas
           putida F1]
          Length = 556

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 139/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++  +NNLA VP+IVY
Sbjct: 302 GGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYARQGPVTRLIRIAVNNLAGVPAIVY 361

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG ++   FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSIDRLFFPEALPAPTLGTPGLLWASLTLALLAVPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 SLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +W+RN  ++++
Sbjct: 533 IATLNLSAVWIRNHLREKY 551


>gi|26992003|ref|NP_747428.1| phosphate ABC transporter inner membrane protein [Pseudomonas
           putida KT2440]
 gi|24987136|gb|AAN70892.1|AE016733_4 phosphate ABC transporter, permease protein [Pseudomonas putida
           KT2440]
 gi|313501300|gb|ADR62666.1| PstA [Pseudomonas putida BIRD-1]
          Length = 556

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 139/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++  +NNLA VP+IVY
Sbjct: 302 GGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYARQGPVTRLIRIAVNNLAGVPAIVY 361

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG ++   FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSIDRLFFPEALPAPTLGTPGLLWASLTLALLAVPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 SLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +W+RN  ++++
Sbjct: 533 IATLNLSAVWIRNHLREKY 551


>gi|167036360|ref|YP_001671591.1| phosphate ABC transporter inner membrane subunit PstA [Pseudomonas
           putida GB-1]
 gi|166862848|gb|ABZ01256.1| phosphate ABC transporter, inner membrane subunit PstA [Pseudomonas
           putida GB-1]
          Length = 556

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 139/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++  +NNLA VP+IVY
Sbjct: 302 GGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYARQGPVTRLIRIAVNNLAGVPAIVY 361

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG ++   FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSIDRLFFPEALPAPTLGTPGLLWASLTLALLAVPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 SLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +W+RN  ++++
Sbjct: 533 IATLNLSAVWIRNHLREKY 551


>gi|88604210|ref|YP_504388.1| phosphate ABC transporter permease [Methanospirillum hungatei JF-1]
 gi|88189672|gb|ABD42669.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanospirillum hungatei JF-1]
          Length = 649

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 131/227 (57%), Gaps = 4/227 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G+ Y+++  I ++ PLGI +AIYL E++ +   + F++   + L   PSIV+
Sbjct: 425 GGIFPAIIGTFYLVIGSILIALPLGIGAAIYLVEYTKENILTRFIRTATDLLNGTPSIVF 484

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G   L+ F     S  L G + LALM LP++I  T  AL++VP S+R  +  LGA++
Sbjct: 485 GLFGFTFLVLFLGFGISL-LAGMITLALMVLPTVIRTTEEALKSVPDSLREGSYALGATR 543

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QTV   VLP ++P I+TG+ +S+ RA GETAP++F  +V      P    D   A P  
Sbjct: 544 WQTVRRVVLPPSVPGIITGAILSIGRAAGETAPIMFTAVVFMQRRLPDSFFDPVMALPYH 603

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK--RW 425
           +++ A +       +   A++LL++ + +   A+L +RN + K  RW
Sbjct: 604 LFILATNVPGARNNQYATAVILLILVIMIYGGAIL-IRNHYDKKIRW 649



 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 102/196 (52%), Gaps = 10/196 (5%)

Query: 182 FLDFNYGFFINGASSRPEVA----GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           FLD     F+ G    P       G+   +VG+L + +  +  + P GIA AI++ E + 
Sbjct: 52  FLDIGLIPFLTGERWDPTSIMPKYGLVPLIVGTLLVTMGAMVFAVPFGIACAIFIAELAS 111

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----MPR-STALVGGLILALMTLP 292
                + ++  +  LA +PS+VYG  G A+L+ F +    +P   + L G ++L +M+LP
Sbjct: 112 PRM-RNILKPAVELLAGIPSVVYGFFGLAILVKFLQDLLSVPSGESVLAGSILLGIMSLP 170

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
           +II  +  A+ +VP  ++  +L LGA+  QT+   ++P A+  I     + + RA+GET 
Sbjct: 171 TIISVSEDAISSVPRYLKEGSLALGATHWQTISQVIVPAALSGITAAVILGIGRAVGETM 230

Query: 353 PLLFVGMVAFVTDYPV 368
            ++ V   A +   P+
Sbjct: 231 AVIMVTGNAAIIPSPI 246


>gi|116750313|ref|YP_847000.1| phosphate ABC transporter inner membrane subunit PstA
           [Syntrophobacter fumaroxidans MPOB]
 gi|116699377|gb|ABK18565.1| phosphate ABC transporter, inner membrane subunit PstA
           [Syntrophobacter fumaroxidans MPOB]
          Length = 288

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 126/226 (55%), Gaps = 3/226 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   + G+  +    + ++FP G+ASAI+L E++  G     ++  INNLA VPS+V+
Sbjct: 63  GGIFPCIAGTFLLGFGSMLVAFPWGVASAIFLHEYARPGPALRVIRLGINNLAGVPSVVF 122

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A  + + K+  S  L G L L ++ LP II     ALR+VP++ R A+L LGA+K
Sbjct: 123 GLFGLAFFVTWCKLGVSI-LSGVLTLGVLILPVIIGTAEEALRSVPATYREASLALGATK 181

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A P +LTGS + ++RA GETA ++F   V F    P  + D   A P  
Sbjct: 182 WQTILRVVLPAAFPGMLTGSILGISRAAGETAAIMFTAAVFFTPHLPASLFDPVMALPYH 241

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A    +  V R   +G  L+L+  +  +N   +  R R +++
Sbjct: 242 IYVLATAGTQIEVTRPLQYGTALVLIALVFGMNLVAIVCRARLQRK 287


>gi|303239887|ref|ZP_07326410.1| phosphate ABC transporter, inner membrane subunit PstA [Acetivibrio
           cellulolyticus CD2]
 gi|302592597|gb|EFL62322.1| phosphate ABC transporter, inner membrane subunit PstA [Acetivibrio
           cellulolyticus CD2]
          Length = 275

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 86/223 (38%), Positives = 124/223 (55%), Gaps = 7/223 (3%)

Query: 202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYG 261
           GI   +V +LY++L+ + +S P+GI SAIYL E+S  G     ++     L  +PSI+YG
Sbjct: 54  GILPMIVNTLYIVLLSVIISTPIGIFSAIYLVEYSKPGKILKLIRFATETLQGIPSIIYG 113

Query: 262 ILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKV 321
           + G    +   K   S  L G L L++M LP+II  T  AL+TVP S R  +L LGA+K+
Sbjct: 114 LFGFIFFVTSLKFGFS-LLAGALTLSIMVLPTIIRTTEEALKTVPVSFREGSLALGATKL 172

Query: 322 QTVFHHVLPLAMPAILTGSTVSLARALGETAPL-LFVGMVAFVTDYPVGVTDIATAFPVQ 380
           QT+   VLP A+P IL    +S+ R +GETA + L  GMVA    +P GV D      V 
Sbjct: 173 QTIIRVVLPSAIPGILNSVILSIGRIVGETAAVYLTAGMVA---KFPQGVMDSGRTLSVH 229

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +Y+ A +      E  F    +L+I +A+IN+    +  R KK
Sbjct: 230 LYMLAKEGLS--FEEAFSTATILIITVAIINSITSLIAKRIKK 270


>gi|152998410|ref|YP_001343245.1| phosphate ABC transporter inner membrane subunit PstA [Marinomonas
           sp. MWYL1]
 gi|150839334|gb|ABR73310.1| phosphate ABC transporter, inner membrane subunit PstA [Marinomonas
           sp. MWYL1]
          Length = 570

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 114/184 (61%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M+L++  L  P G+ +A+YL E++ +G+ +  ++  +NNLA VPSIVY
Sbjct: 316 GGVFPAIFGTVMMVLLMTVLVTPFGVVAAVYLREYASQGWVTRTIRIAVNNLAGVPSIVY 375

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LGS +   FF   +P  T   GGL+     LAL+T+P +I+AT   L  
Sbjct: 376 GVFGLGFFIYFLGSGIDQAFFPEALPSPTFGTGGLMWASITLALLTVPVVIVATEEGLSR 435

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 436 IPRNVREGSLALGATKFETLWRVVLPMASPAIMTGVILAVARAAGEVAPLMLVGVVKLAP 495

Query: 365 DYPV 368
             P+
Sbjct: 496 SLPL 499


>gi|189347112|ref|YP_001943641.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           limicola DSM 245]
 gi|189341259|gb|ACD90662.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           limicola DSM 245]
          Length = 448

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 116/188 (61%), Gaps = 3/188 (1%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           +GF  + +       GI   + G+ ++ +  +  +FPLG+ +A+Y  E++ +GFF+S ++
Sbjct: 203 WGFLTDSSVDSHIFGGIWPEIQGTFFLAVGAMLFAFPLGVIAAVYFTEYAREGFFNSILR 262

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGLILALMTLPSIIIATGVALRTV 305
           +  + LA VPSIV+G+ G A  IN  K+  S + L G L LA+M LP+II A   A+ +V
Sbjct: 263 SANSTLAGVPSIVFGLFGLAFFINTLKVSESKSVLAGSLTLAIMILPTIIRAAEEAILSV 322

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + + A+L LG++K  T+   +LP A+P I+TG  +SL RA GETAP++F   V+  + 
Sbjct: 323 PKTYKEASLSLGSTKWNTIMTVILPAALPGIITGGVISLGRAAGETAPIIFTAAVSVGS- 381

Query: 366 YPVGVTDI 373
             +G+ D+
Sbjct: 382 -AIGLADV 388


>gi|294102662|ref|YP_003554520.1| phosphate ABC transporter, inner membrane subunit PstA
           [Aminobacterium colombiense DSM 12261]
 gi|293617642|gb|ADE57796.1| phosphate ABC transporter, inner membrane subunit PstA
           [Aminobacterium colombiense DSM 12261]
          Length = 283

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 126/225 (56%), Gaps = 3/225 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G+L ++++ +  S P+GIA+ +YL E+S KG F++ ++  I +LA VPS+V+
Sbjct: 57  GGISTPLMGTLQLVVVSMLFSLPVGIATGLYLAEYSRKGQFTALLRLAIRSLAGVPSVVF 116

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ +   K   S+ L  GL L  + LP I+ A+  A   VP   R+A+  LGASK
Sbjct: 117 GLFGLSLFVILLKF-GSSLLSAGLTLGCLALPLIVTASEQAFLAVPQDYRAASYALGASK 175

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT++  V P A   I+TG  +S+ R  GETAP++F G   F       V D   A P  
Sbjct: 176 WQTIWKVVFPAASSTIITGGILSIGRVAGETAPIIFTGAAYFTPGVAKSVFDEVMALPYH 235

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKK 423
           I + A +     + R   +G +L+LL F+  I+   + +R R K+
Sbjct: 236 IMVLATEGTNITLTRPIQYGTVLVLLAFVLGISAIGVIMRARLKQ 280


>gi|330806794|ref|YP_004351256.1| phosphate ABC transporter permease [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327374902|gb|AEA66252.1| Putative phosphate ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 556

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 139/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++  +NNLA VP+IVY
Sbjct: 302 GGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYARQGPMTRLIRIAVNNLAGVPAIVY 361

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG +V   FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSVDRLFFPEALPAPTFGTPGLLWASLTLALLAVPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             P+                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 SLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +W+RN  ++++
Sbjct: 533 IATLNLSAVWIRNHLREKY 551


>gi|294495552|ref|YP_003542045.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanohalophilus mahii DSM 5219]
 gi|292666551|gb|ADE36400.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanohalophilus mahii DSM 5219]
          Length = 283

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 136/241 (56%), Gaps = 3/241 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F      +R    GI  A+VG+ Y++ I + ++ PLG+ SAIYL E++ +      +
Sbjct: 41  SWDFLTEMPKNRMTEGGIYPALVGTAYLVGISMAVAIPLGVLSAIYLNEYAKESRSKWII 100

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +  INNLA  PS+V+G+ G A+ + F    + + +   L L+L+ LP +I A+  AL TV
Sbjct: 101 EMAINNLAGTPSVVFGLFGLALFVKFLAF-KPSIISASLTLSLLILPVVIRASKEALITV 159

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R A+L LG +K +T+   VLP A+P I+TG  +S+ R  GETAP++F G   F+  
Sbjct: 160 PLAHREASLALGVTKWKTIRSIVLPEALPGIVTGIILSIGRVAGETAPIMFTGAAYFLPR 219

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P  V     A P  +Y+ A     P   R   +G  L+LLI + +IN+  + +R  ++K
Sbjct: 220 LPESVFSQFMALPYHLYILATSGLNPMETRPIQYGTGLVLLILVLLINSIAIIIRKHYRK 279

Query: 424 R 424
           +
Sbjct: 280 K 280


>gi|46580883|ref|YP_011691.1| phosphate ABC transporter permease [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450303|gb|AAS96951.1| phosphate ABC transporter, permease protein, putative
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|311234576|gb|ADP87430.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio vulgaris RCH1]
          Length = 309

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 131/226 (57%), Gaps = 3/226 (1%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G++ +    + ++ P G+A+AIYL+E++  G     ++  INNLA VPS+V+
Sbjct: 83  GGILPCILGTIALSYGSMLIALPWGVATAIYLQEYARPGPLVHAIRLTINNLAGVPSVVF 142

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ +   KM  S  L G   LA + LP II A+  ALR+V  + R A+LGLGA+K
Sbjct: 143 GLFGLSMFVTAMKMGVSL-LAGMFTLAALVLPLIIGASEEALRSVSQTYREASLGLGATK 201

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+   VLP A+P+ILTG+ +++ RA GETA ++F   + F    P  + D   A P  
Sbjct: 202 WQTISLVVLPAALPSILTGAILAVGRAAGETAAIMFTAAMFFSPRLPGSLFDSVMALPYH 261

Query: 381 IYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY+ A       + R   FG  L+L++ +  +N   + +R R ++R
Sbjct: 262 IYVLATAGTEIELTRPMQFGTSLVLIVLVLGMNLMAIIMRARLQRR 307


>gi|71278005|ref|YP_270309.1| phosphate ABC transporter permease [Colwellia psychrerythraea 34H]
 gi|71143745|gb|AAZ24218.1| phosphate ABC transporter, permease protein [Colwellia
           psychrerythraea 34H]
          Length = 545

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 140/280 (50%), Gaps = 43/280 (15%)

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
           ALF      F I          G+  A+ G++ M+L++  +  P G+ +AIYL E++ K 
Sbjct: 270 ALFFSHIGSFLIEDPREANTEGGVFPAIFGTVLMVLLMTVIVSPFGVIAAIYLHEYAGKN 329

Query: 240 FFSSFVQANINNLASVPSIVYGILG--------SAVLINFF---KMPRST-----ALVGG 283
            F+  ++  + NLA VPSIVYG+ G           L   F    +P  T      L   
Sbjct: 330 AFTKLLRIAVINLAGVPSIVYGVFGLGFFVYMVGGSLDQLFYSENLPSPTFGTPGVLWSA 389

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  +LP+A PAI+TG  ++
Sbjct: 390 LTLAILTLPVVIVSTEEGLSRIPSTMRHGSLALGATKAETLWRIILPIASPAIMTGIILA 449

Query: 344 LARALGETAPLLFVGMVAFVTDYPVG------------------VTDIATAFPVQIYLWA 385
           +ARA GE APL+ VG+V    + P+                   + D+    P       
Sbjct: 450 IARAAGEVAPLMLVGVVKMAPNLPLDGNFPFLHLDRKFMHLGFHIYDVGFQSP------N 503

Query: 386 ADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            +A RP V   F   LLL+  +  +N   + +RN+ ++R+
Sbjct: 504 VEAARPLV---FATALLLVTIIVALNMTAVSIRNKLRERY 540


>gi|170719334|ref|YP_001747022.1| phosphate ABC transporter inner membrane subunit PstA [Pseudomonas
           putida W619]
 gi|169757337|gb|ACA70653.1| phosphate ABC transporter, inner membrane subunit PstA [Pseudomonas
           putida W619]
          Length = 556

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 139/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++  +NNLA VP+IVY
Sbjct: 302 GGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYAKQGPVTRLIRIAVNNLAGVPAIVY 361

Query: 261 GI---------LGSAVLINFF--KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG ++   FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSIDRLFFPESLPAPTLGTPGLLWASLTLALLAVPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             P+                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 SLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVMV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +W+RN  ++++
Sbjct: 533 IATLNLSAVWIRNHLREKY 551


>gi|258623558|ref|ZP_05718557.1| phosphate ABC transporter, permease protein [Vibrio mimicus VM573]
 gi|258584165|gb|EEW08915.1| phosphate ABC transporter, permease protein [Vibrio mimicus VM573]
          Length = 548

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 123/215 (57%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPNSVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|78187105|ref|YP_375148.1| phosphate ABC transporter permease [Chlorobium luteolum DSM 273]
 gi|78167007|gb|ABB24105.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chlorobium luteolum DSM 273]
          Length = 448

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 139/245 (56%), Gaps = 9/245 (3%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           +GF  + +       GI   + G+ ++ +  +  +FPLG+ +AIY  E++  G F+S ++
Sbjct: 203 WGFLTDSSIDAHIFGGIWPEIQGTFFLAIGAMLFAFPLGVVAAIYFTEYAKDGVFTSMLR 262

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGLILALMTLPSIIIATGVALRTV 305
           +  + LA VPSIV+G+ G A  IN   +  S + L G L LA+M LP+II A   A+  V
Sbjct: 263 SANSTLAGVPSIVFGLFGLAFFINTLNVSESKSVLAGALTLAIMILPTIIRAAEEAILAV 322

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + + A+LGLG++K  T+   +LP A+P I+TG  +SL RA GETAP++F   V+  + 
Sbjct: 323 PKTYKEASLGLGSTKWNTIVTVILPAALPGIITGGVISLGRAAGETAPIIFTAAVSVGS- 381

Query: 366 YPVGVTDIAT----AFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRN 419
             +G+ D+ +    A    IY  A++ E     R   +G +L L+  + ++N + + LR 
Sbjct: 382 -AIGIADVLSSPTPALSWNIYNLASEHEAAAEIRHVQYGMVLALVSIVLLLNLSAVLLRA 440

Query: 420 RFKKR 424
           R  K+
Sbjct: 441 RISKK 445


>gi|258626946|ref|ZP_05721748.1| phosphate ABC transporter, permease protein [Vibrio mimicus VM603]
 gi|258580770|gb|EEW05717.1| phosphate ABC transporter, permease protein [Vibrio mimicus VM603]
          Length = 548

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 123/215 (57%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPNSVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|262165041|ref|ZP_06032778.1| phosphate transport system permease protein PstA [Vibrio mimicus
           VM223]
 gi|262024757|gb|EEY43425.1| phosphate transport system permease protein PstA [Vibrio mimicus
           VM223]
          Length = 548

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 123/215 (57%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPNSVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|330836406|ref|YP_004411047.1| phosphate ABC transporter, inner membrane subunit PstA [Spirochaeta
           coccoides DSM 17374]
 gi|329748309|gb|AEC01665.1| phosphate ABC transporter, inner membrane subunit PstA [Spirochaeta
           coccoides DSM 17374]
          Length = 525

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 136/238 (57%), Gaps = 7/238 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
           L F Y       S R    GIG  ++ +  M+ +   ++ PLGIA+A+YL E++ KG  +
Sbjct: 286 LTFRYLVLPTQESGR--FGGIGSIIINTFLMVFLTTLIAAPLGIAAAVYLVEYAKKGRLT 343

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           S +++ I+ LAS+PSI++G+ G  V +       S  + G L +ALM LP+II  +  A+
Sbjct: 344 SIIRSGIDVLASIPSIIFGLFGLLVFVQLLGWSFSL-ISGTLTVALMILPTIIRTSEEAI 402

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+V   +R A++G+GA+K++T++  VLP A+  I TG  +++ RA+GETA LL+   +  
Sbjct: 403 RSVEQRLREASIGMGATKMETIWRVVLPSALNGITTGIILAMGRAIGETAALLYT--IGS 460

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            T    G++  +    + I L   + +    ++ F +  +L++ + +INT   W+ NR
Sbjct: 461 STAVATGLSSGSRVLALHIMLTINEGQS--FDKAFASAFVLIVVVLIINTTARWMMNR 516


>gi|118581560|ref|YP_902810.1| phosphate ABC transporter inner membrane subunit PstA [Pelobacter
           propionicus DSM 2379]
 gi|118504270|gb|ABL00753.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Pelobacter propionicus DSM 2379]
          Length = 532

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 134/255 (52%), Gaps = 35/255 (13%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M+L++   S P G+ +A+YL E++  G  +  V+  +NNLA VPSIVY
Sbjct: 278 GGLFPAIFGTVMMVLLMSVFSLPFGVIAAVYLREYAKDGLLTRMVRIAVNNLAGVPSIVY 337

Query: 261 GILGSAVLIN---------FF--KMPRSTALVGG-----LILALMTLPSIIIATGVALRT 304
           G+ G    +          FF  ++P  T   GG     L LAL+T+P +IIAT  +L +
Sbjct: 338 GVFGLGFFVYGIGGSLDQLFFPERLPTPTFGTGGILWSSLTLALLTVPVVIIATEESLAS 397

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P  IR  +L LGA+K QT+   +LP+A P I+TG  +S+ARA GE APL+ VG+V    
Sbjct: 398 IPRGIREGSLALGATKFQTLTRILLPMATPGIMTGLILSMARAAGEVAPLMIVGVVKLAP 457

Query: 365 DYPVGVTDIATAFP----------VQIYLWAADAERPFVERT----FGAILLLLIFLAVI 410
             P         FP          +  +++    + P VE      +   +LL+  + V 
Sbjct: 458 TLP-----FDGYFPFFHMDRKFMHLGFHIYDVGFQSPNVEAAKPMVYVTTMLLIAIVIVA 512

Query: 411 NTAMLWLRNRFKKRW 425
           ++  +  R R +KR+
Sbjct: 513 SSLAIRFRTRMRKRY 527


>gi|89092204|ref|ZP_01165158.1| phosphate ABC transporter, permease protein [Oceanospirillum sp.
           MED92]
 gi|89083292|gb|EAR62510.1| phosphate ABC transporter, permease protein [Oceanospirillum sp.
           MED92]
          Length = 562

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 135/259 (52%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M++I+  +  P G+ +A+YL E++ +GF +  ++  +NNLA VPSIVY
Sbjct: 308 GGIFPAIYGTVLMVIIMSVMVTPFGVVAAVYLREYAKQGFVTRVIRIAVNNLAGVPSIVY 367

Query: 261 GILGSAVLINFF-----------KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G    + F              P  T    GL+     LAL+T+P +I+AT   L  
Sbjct: 368 GVFGLGFFVYFLGGHIDDAFFAEAKPAPTFGTPGLLWASITLALLTVPVVIVATEEGLTR 427

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T+   V+P+A PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 428 IPRAVREGSLALGATKFETLMKIVIPMASPAIMTGVILAIARAAGEVAPLMLVGVVKLAP 487

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             P+                   + D+    P        +A RP V   +    LL+  
Sbjct: 488 SLPLDGNYPFLHLDQKFMHLGFHIYDVGFQSP------NVEAARPLV---YATAFLLVAV 538

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A++N + + +RN  ++++
Sbjct: 539 IAMLNLSAIQIRNHLREKY 557


>gi|146284337|ref|YP_001174490.1| membrane protein component of ABC phosphate transporter
           [Pseudomonas stutzeri A1501]
 gi|145572542|gb|ABP81648.1| membrane protein component of ABC phosphate transporter
           [Pseudomonas stutzeri A1501]
          Length = 556

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 136/259 (52%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++  +NNLA VPSIVY
Sbjct: 302 GGVFPAIFGTVLMTLIMAVIVTPFGVIAAVYLREYAKQGLLTRIIRIAVNNLAGVPSIVY 361

Query: 261 GILG--------SAVLINFFKMPRSTALVGG--------LILALMTLPSIIIATGVALRT 304
           G+ G           L   F    + A V G        L LA++TLP +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSLDRLFYPEAAPAPVFGTPGLMWASLTLAILTLPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P  IR  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRMIREGSLALGATKSETLWKVVLPMASPAMMTGLILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
           + P+                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 NLPLNGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +++RN  ++++
Sbjct: 533 IATLNFSAIYIRNHLREKY 551


>gi|330446703|ref|ZP_08310355.1| phosphate ABC transporter, permease protein PstA [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328490894|dbj|GAA04852.1| phosphate ABC transporter, permease protein PstA [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 545

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 136/273 (49%), Gaps = 43/273 (15%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           Y F            G+  A+ G+++M+L++  +  PLG+ +AIYL E++    F+  ++
Sbjct: 277 YKFLTEAPREANTEGGVFPAIFGTVFMVLLMSVMVTPLGVLAAIYLHEYAGNNSFTKLIR 336

Query: 247 ANINNLASVPSIVYGILGSAVLIN---------FFKMPRSTALVG-------GLILALMT 290
             + NLA VPSIVYG+ G    +          FF     T   G        L LA+MT
Sbjct: 337 VAVINLAGVPSIVYGVFGLGFFVYMVGGTIDDVFFSAQLPTPTFGTPGILWSALTLAIMT 396

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I++T   L  +PSSIR+ +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 397 LPVVIVSTEEGLSRIPSSIRNGSLALGATQAETLWRIVLPMASPAIMTGLILAVARAAGE 456

Query: 351 TAPLLFVGMVAFVTDYPVG------------------VTDIATAFPVQIYLWAADAERPF 392
            APL+ VG+V      PV                   + D+A   P        +A RP 
Sbjct: 457 VAPLMLVGVVKMAPTLPVDAHFPFVHLDRKFMHLGYHIYDVAFQSP------NVEAARPL 510

Query: 393 VERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           V   +    LL+  +  +N   + +RN  ++++
Sbjct: 511 V---YATSFLLVTVIVSLNLTAIGIRNHLREKF 540


>gi|327482721|gb|AEA86031.1| membrane protein component of ABC phosphate transporter
           [Pseudomonas stutzeri DSM 4166]
          Length = 556

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 136/259 (52%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++  +NNLA VPSIVY
Sbjct: 302 GGVFPAIFGTVLMTLIMAVIVTPFGVIAAVYLREYAKQGLLTRIIRIAVNNLAGVPSIVY 361

Query: 261 GILG--------SAVLINFFKMPRSTALVGG--------LILALMTLPSIIIATGVALRT 304
           G+ G           L   F    + A V G        L LA++TLP +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSLDRLFYPEAAPAPVFGTPGLMWASLTLAILTLPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P  IR  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRMIREGSLALGATKSETLWKVVLPMASPAMMTGLILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
           + P+                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 NLPLNGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +++RN  ++++
Sbjct: 533 IATLNFSAIYIRNHLREKY 551


>gi|189500178|ref|YP_001959648.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides BS1]
 gi|189495619|gb|ACE04167.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides BS1]
          Length = 448

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 142/247 (57%), Gaps = 9/247 (3%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           F +GF    +       G+   + G+L++ +  +  +FP+G+ +AIY  E++ +  F+S 
Sbjct: 201 FYWGFLTERSLDAHIFGGVWAEIQGTLFLAIGAMLFAFPMGVIAAIYFTEYARENVFTSI 260

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGLILALMTLPSIIIATGVALR 303
           +++  + LA VPSIV+G+ G A  IN  K+  S + L G L LA+M LP+II A   A+ 
Sbjct: 261 LRSANSTLAGVPSIVFGLFGLAFFINTIKVSDSKSVLAGSLTLAIMILPTIIRAAEEAIL 320

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP + + A++GLG++K +T+   +LP A+P I+TG  +SL RA GETAP++F   V+  
Sbjct: 321 SVPKTYKEASIGLGSTKWRTIVTVILPAALPGIITGGIISLGRAAGETAPIIFTAAVS-- 378

Query: 364 TDYPVGVTDIAT----AFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWL 417
               +G+ D+ T    A    IY  A++ E     R   +G +L L+  + ++N + + L
Sbjct: 379 VGATIGLGDVLTSPTPALSWNIYNLASEHEAANEIRHVQYGMVLALISIVLLLNLSAILL 438

Query: 418 RNRFKKR 424
           R R  K+
Sbjct: 439 RARISKK 445


>gi|89072670|ref|ZP_01159235.1| putative phosphate ABC transporter, permease protein
           [Photobacterium sp. SKA34]
 gi|89051490|gb|EAR56944.1| putative phosphate ABC transporter, permease protein
           [Photobacterium sp. SKA34]
          Length = 545

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 139/273 (50%), Gaps = 43/273 (15%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           Y F            G+  A+ G+++M+L++  +  PLG+ +AIYL E++    F+  ++
Sbjct: 277 YKFLTEAPREANTEGGVFPAIFGTVFMVLLMSAMVTPLGVLAAIYLYEYAGNNNFTKVIR 336

Query: 247 ANINNLASVPSIVYGILGSAVLIN---------FF--KMPRST-----ALVGGLILALMT 290
             + NLA VPSIVYG+ G    +          FF  ++P  T      L   L LA+MT
Sbjct: 337 IAVINLAGVPSIVYGVFGLGFFVYMVGGTIDDVFFSAQLPTPTFGTPGILWSALTLAIMT 396

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I++T   L  +PSS+R+ +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 397 LPVVIVSTEEGLSRIPSSVRNGSLALGATQAETLWRIVLPMASPAIMTGLILAVARAAGE 456

Query: 351 TAPLLFVGMVAFVTDYPVGVT------------------DIATAFPVQIYLWAADAERPF 392
            APL+ VG+V      PV V                   D+A   P        +A RP 
Sbjct: 457 VAPLMLVGVVKMAPTLPVDVHFPYVHLDRKFMHLGYHIYDVAFQSP------NVEAARPL 510

Query: 393 VERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           V   +    LL+  +  +N   + +RN  ++++
Sbjct: 511 V---YATSFLLVTVIVSLNLTAIGIRNHLREKF 540


>gi|300717932|ref|YP_003742735.1| phosphate ABC transporter permease subunit [Erwinia billingiae
           Eb661]
 gi|299063768|emb|CAX60888.1| Phosphate ABC transporter, permease subunit [Erwinia billingiae
           Eb661]
          Length = 548

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 104/302 (34%), Positives = 158/302 (52%), Gaps = 46/302 (15%)

Query: 162 HR--MSDYQWKWFQKLDSDGA--LFLDFNYGFFINGASSRP-EVAGIGVAVVGSLYMMLI 216
           HR  M++    W+    S G   L L +    F++G         G+  A+ G++ M+L+
Sbjct: 250 HRIAMNEILGAWYPNAMSYGEKWLHLAWQIWHFVSGTQGDSLGEGGVFPAIFGTVLMVLL 309

Query: 217 VIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN------ 270
           +  +  PLG+ +AI+L E++  G  +  V+  + NLA VPSIVYG+ G    +       
Sbjct: 310 MSIVVMPLGVIAAIWLHEYAGNGLMTRLVRIAVVNLAGVPSIVYGVFGLGFFVWLVGGSL 369

Query: 271 ---FFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
              FF   +P  T    GL+     LAL+TLP +I+AT   L  +P S+R  +L LGA++
Sbjct: 370 DKLFFADALPDPTFGTPGLLWASLTLALLTLPVVIVATEEGLSRIPKSLRQGSLALGATQ 429

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP-- 378
            +T++H  LPLA+PA+LTG  +++ARA GETAPL+ VG+V  V + P     I   FP  
Sbjct: 430 AETLWHVTLPLAVPAMLTGLILAVARAAGETAPLMLVGVVKMVPELP-----IDAVFPYL 484

Query: 379 ----------VQIYLWA-----ADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
                      QIY  A     A A+RP V   F   LLL+  +  +N   + LR+R ++
Sbjct: 485 HLDRKFMHLGFQIYDLAFQSPNAQADRPLV---FATALLLVTIILALNLLAMVLRHRLRE 541

Query: 424 RW 425
           R+
Sbjct: 542 RY 543


>gi|309775535|ref|ZP_07670535.1| phosphate ABC transporter, permease protein PstA
           [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916629|gb|EFP62369.1| phosphate ABC transporter, permease protein PstA
           [Erysipelotrichaceae bacterium 3_1_53]
          Length = 273

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 225 GIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL---INFFKMPRSTALV 281
           GIASAIYL E++     +S +++ I  L  VPSI++G++G AVL      F    +  L+
Sbjct: 72  GIASAIYLHEYAKPNRLTSLIRSAIEMLTGVPSIIFGLMGVAVLFPITQMFGATTTNILL 131

Query: 282 GGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGST 341
           G   ++++ LP+II +T  AL  VP S+R A+L +GA++ QT+F  VLP A+P ILTG  
Sbjct: 132 GSFTMSIILLPTIIRSTEEALIVVPQSLRDASLSVGANQSQTIFKIVLPCAVPGILTGVL 191

Query: 342 VSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAIL 401
           +S+ R +GE+A L++  M  +V D P  ++   T+  V IY     +E+P  E      +
Sbjct: 192 LSIGRVIGESAALIYT-MGTYVNDTPTLMSQ-GTSLAVHIY-NIMSSEQPNFELASAISI 248

Query: 402 LLLIFLAVINTAMLWLRNRFKKRW 425
           ++L+F+ ++N  +  L  R  K W
Sbjct: 249 VILVFVLILNICVKLLSKRLNKSW 272


>gi|116754016|ref|YP_843134.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methanosaeta thermophila PT]
 gi|116665467|gb|ABK14494.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanosaeta thermophila PT]
          Length = 290

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 138/244 (56%), Gaps = 28/244 (11%)

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSI 258
           +  GI   + G+++++L  + +S PLGI + IYL E+S     +  +  +I+ L  VPS+
Sbjct: 58  QEGGIVTCIEGTMWLVLGAMLVSAPLGIGAGIYLNEYSRSHTLNRIITISISCLNGVPSV 117

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           VYG+ G A L++   +   + L G +IL LM LP+II+ T  ALR+VP+S+R  ++ LGA
Sbjct: 118 VYGLFGLAFLVSTVGI---SLLAGSVILGLMNLPTIILTTQEALRSVPNSLREGSVALGA 174

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
           +K QT+   V+P A+P ILTG  + +ARA GETAP+++      VT  PV V  +    P
Sbjct: 175 TKWQTILRIVIPSALPGILTGLIIGVARAAGETAPIMWTA----VTFTPVYVDKVYGVVP 230

Query: 379 -------------VQI--YLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
                        +Q+  +L A D E+    R +G  L+L+  +  +N   + +RN ++K
Sbjct: 231 DVYQPVNNLCYHLLQLIYFLGAWDVEK----RAWGTALVLMGLVLAMNFLAIVVRNHYRK 286

Query: 424 --RW 425
             RW
Sbjct: 287 NIRW 290


>gi|150009023|ref|YP_001303766.1| putative ABC transporter permease [Parabacteroides distasonis ATCC
           8503]
 gi|255014855|ref|ZP_05286981.1| putative ABC transporter permease protein [Bacteroides sp. 2_1_7]
 gi|262383917|ref|ZP_06077053.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_33B]
 gi|301312079|ref|ZP_07218001.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           20_3]
 gi|149937447|gb|ABR44144.1| putative ABC transporter permease protein [Parabacteroides
           distasonis ATCC 8503]
 gi|262294815|gb|EEY82747.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_33B]
 gi|300830181|gb|EFK60829.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           20_3]
          Length = 295

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 110/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+LY+++    +SFP+GI S IY+ E++  G    F++   NNL+ VPS+V+
Sbjct: 67  GGIFPAIVGTLYLVIGSSLISFPIGIMSGIYMNEYATNGKLIRFIRIMTNNLSGVPSVVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ ++      S  + G   LALM+LP II  T  AL+++  S R  +L LGA+K
Sbjct: 127 GLFGMSLFVSTLGWGDSI-IAGSFTLALMSLPLIIRTTEEALKSIDDSFRHGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIRRVVLPMAFPNIITGLILSIGRVSGETAPILFTVAAYFLPQLPKSIFDQCMALPYH 245

Query: 381 IYL 383
           +Y+
Sbjct: 246 LYV 248


>gi|256840975|ref|ZP_05546482.1| phosphate ABC transporter, permease PstA [Parabacteroides sp. D13]
 gi|256736818|gb|EEU50145.1| phosphate ABC transporter, permease PstA [Parabacteroides sp. D13]
          Length = 295

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 110/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+LY+++    +SFP+GI S IY+ E++  G    F++   NNL+ VPS+V+
Sbjct: 67  GGIFPAIVGTLYLVIGSSLISFPIGIMSGIYMNEYATNGKLIRFIRIMTNNLSGVPSVVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ ++      S  + G   LALM+LP II  T  AL+++  S R  +L LGA+K
Sbjct: 127 GLFGMSLFVSTLGWGDSI-IAGSFTLALMSLPLIIRTTEEALKSIDDSFRHGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIRRVVLPMAFPNIITGLILSIGRVSGETAPILFTVAAYFLPQLPKSIFDQCMALPYH 245

Query: 381 IYL 383
           +Y+
Sbjct: 246 LYV 248


>gi|298375744|ref|ZP_06985700.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           3_1_19]
 gi|298266781|gb|EFI08438.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           3_1_19]
          Length = 295

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 110/183 (60%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+LY+++    +SFP+GI S IY+ E++  G    F++   NNL+ VPS+V+
Sbjct: 67  GGIFPAIVGTLYLVIGSSLISFPIGIMSGIYMNEYATNGKLIRFIRIMTNNLSGVPSVVF 126

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ ++      S  + G   LALM+LP II  T  AL+++  S R  +L LGA+K
Sbjct: 127 GLFGMSLFVSTLGWGDSI-IAGSFTLALMSLPLIIRTTEEALKSIDDSFRHGSLALGATK 185

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F+   P  + D   A P  
Sbjct: 186 LQTIRRVVLPMAFPNIITGLILSIGRVSGETAPILFTVAAYFLPQLPKSIFDQCMALPYH 245

Query: 381 IYL 383
           +Y+
Sbjct: 246 LYV 248


>gi|90579396|ref|ZP_01235206.1| putative phosphate ABC transporter, permease protein [Vibrio
           angustum S14]
 gi|90440229|gb|EAS65410.1| putative phosphate ABC transporter, permease protein [Vibrio
           angustum S14]
          Length = 545

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 139/273 (50%), Gaps = 43/273 (15%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           Y F            G+  A+ G+++M+L++  +  PLG+ +AIYL E++    F+  ++
Sbjct: 277 YKFLTEAPREANTEGGVFPAIFGTVFMVLLMSVMVTPLGVLAAIYLHEYAGNNNFTKVIR 336

Query: 247 ANINNLASVPSIVYGILGSAVLIN---------FF--KMPRST-----ALVGGLILALMT 290
             + NLA VPSIVYG+ G    +          FF  ++P  T      L   L LA+MT
Sbjct: 337 IAVINLAGVPSIVYGVFGLGFFVYMVGGTIDDVFFSAQLPTPTFGTPGILWSALTLAIMT 396

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I++T   L  +PSS+R+ +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 397 LPVVIVSTEEGLSRIPSSVRNGSLALGATQAETLWRIVLPMASPAIMTGLILAVARAAGE 456

Query: 351 TAPLLFVGMVAFVTDYPVGVT------------------DIATAFPVQIYLWAADAERPF 392
            APL+ VG+V      PV V                   D+A   P        +A RP 
Sbjct: 457 VAPLMLVGVVKMAPTLPVDVHFPFVHLDRKFMHLGYHIYDVAFQSP------NVEAARPL 510

Query: 393 VERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           V   +    LL+  +  +N   + +RN  ++++
Sbjct: 511 V---YATSFLLVTVIVSLNLTAIGIRNHLREKF 540


>gi|262190972|ref|ZP_06049184.1| phosphate transport system permease protein PstA [Vibrio cholerae
           CT 5369-93]
 gi|262033143|gb|EEY51669.1| phosphate transport system permease protein PstA [Vibrio cholerae
           CT 5369-93]
          Length = 548

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|153829398|ref|ZP_01982065.1| phosphate ABC transporter, permease protein [Vibrio cholerae
           623-39]
 gi|148875118|gb|EDL73253.1| phosphate ABC transporter, permease protein [Vibrio cholerae
           623-39]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRIIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|121728600|ref|ZP_01681620.1| phosphate ABC transporter, permease protein [Vibrio cholerae V52]
 gi|147674308|ref|YP_001216215.1| phosphate ABC transporter, permease protein [Vibrio cholerae O395]
 gi|153216137|ref|ZP_01950292.1| phosphate ABC transporter, permease protein [Vibrio cholerae 1587]
 gi|262168821|ref|ZP_06036516.1| phosphate transport system permease protein PstA [Vibrio cholerae
           RC27]
 gi|121629108|gb|EAX61552.1| phosphate ABC transporter, permease protein [Vibrio cholerae V52]
 gi|124114452|gb|EAY33272.1| phosphate ABC transporter, permease protein [Vibrio cholerae 1587]
 gi|146316191|gb|ABQ20730.1| phosphate ABC transporter, permease protein [Vibrio cholerae O395]
 gi|227012549|gb|ACP08759.1| phosphate ABC transporter, permease protein [Vibrio cholerae O395]
 gi|262022939|gb|EEY41645.1| phosphate transport system permease protein PstA [Vibrio cholerae
           RC27]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|254224998|ref|ZP_04918612.1| phosphate ABC transporter, permease protein [Vibrio cholerae V51]
 gi|125622385|gb|EAZ50705.1| phosphate ABC transporter, permease protein [Vibrio cholerae V51]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|327483519|gb|AEA77926.1| Phosphate transport system permease protein PstA [Vibrio cholerae
           LMA3894-4]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|229513134|ref|ZP_04402600.1| phosphate transport system permease protein PstA [Vibrio cholerae
           TMA 21]
 gi|229350027|gb|EEO14981.1| phosphate transport system permease protein PstA [Vibrio cholerae
           TMA 21]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|229530142|ref|ZP_04419532.1| phosphate transport system permease protein PstA [Vibrio cholerae
           12129(1)]
 gi|229333916|gb|EEN99402.1| phosphate transport system permease protein PstA [Vibrio cholerae
           12129(1)]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|153827123|ref|ZP_01979790.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio cholerae MZO-2]
 gi|149738989|gb|EDM53301.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio cholerae MZO-2]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|153802816|ref|ZP_01957402.1| phosphate ABC transporter, permease protein [Vibrio cholerae MZO-3]
 gi|124121641|gb|EAY40384.1| phosphate ABC transporter, permease protein [Vibrio cholerae MZO-3]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|15640744|ref|NP_230374.1| phosphate ABC transporter, permease protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121590890|ref|ZP_01678213.1| phosphate ABC transporter, permease protein [Vibrio cholerae
           2740-80]
 gi|153818844|ref|ZP_01971511.1| phosphate ABC transporter, permease protein [Vibrio cholerae NCTC
           8457]
 gi|153823132|ref|ZP_01975799.1| phosphate ABC transporter, permease protein [Vibrio cholerae B33]
 gi|227080904|ref|YP_002809455.1| phosphate ABC transporter, permease protein [Vibrio cholerae M66-2]
 gi|229505659|ref|ZP_04395169.1| phosphate transport system permease protein PstA [Vibrio cholerae
           BX 330286]
 gi|229510669|ref|ZP_04400148.1| phosphate transport system permease protein PstA [Vibrio cholerae
           B33]
 gi|229517791|ref|ZP_04407235.1| phosphate transport system permease protein PstA [Vibrio cholerae
           RC9]
 gi|229608677|ref|YP_002879325.1| phosphate transport system permease protein PstA [Vibrio cholerae
           MJ-1236]
 gi|254847866|ref|ZP_05237216.1| phosphate ABC transporter [Vibrio cholerae MO10]
 gi|255744537|ref|ZP_05418488.1| phosphate transport system permease protein PstA [Vibrio cholera
           CIRS 101]
 gi|262161329|ref|ZP_06030440.1| phosphate transport system permease protein PstA [Vibrio cholerae
           INDRE 91/1]
 gi|298499137|ref|ZP_07008944.1| phosphate ABC transporter [Vibrio cholerae MAK 757]
 gi|9655169|gb|AAF93890.1| phosphate ABC transporter, permease protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121547255|gb|EAX57378.1| phosphate ABC transporter, permease protein [Vibrio cholerae
           2740-80]
 gi|126510626|gb|EAZ73220.1| phosphate ABC transporter, permease protein [Vibrio cholerae NCTC
           8457]
 gi|126519349|gb|EAZ76572.1| phosphate ABC transporter, permease protein [Vibrio cholerae B33]
 gi|227008792|gb|ACP05004.1| phosphate ABC transporter, permease protein [Vibrio cholerae M66-2]
 gi|229344506|gb|EEO09480.1| phosphate transport system permease protein PstA [Vibrio cholerae
           RC9]
 gi|229350634|gb|EEO15575.1| phosphate transport system permease protein PstA [Vibrio cholerae
           B33]
 gi|229357882|gb|EEO22799.1| phosphate transport system permease protein PstA [Vibrio cholerae
           BX 330286]
 gi|229371332|gb|ACQ61755.1| phosphate transport system permease protein PstA [Vibrio cholerae
           MJ-1236]
 gi|254843571|gb|EET21985.1| phosphate ABC transporter [Vibrio cholerae MO10]
 gi|255737568|gb|EET92962.1| phosphate transport system permease protein PstA [Vibrio cholera
           CIRS 101]
 gi|262029079|gb|EEY47732.1| phosphate transport system permease protein PstA [Vibrio cholerae
           INDRE 91/1]
 gi|297543470|gb|EFH79520.1| phosphate ABC transporter [Vibrio cholerae MAK 757]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|229523450|ref|ZP_04412857.1| phosphate transport system permease protein PstA [Vibrio cholerae
           TM 11079-80]
 gi|229339813|gb|EEO04828.1| phosphate transport system permease protein PstA [Vibrio cholerae
           TM 11079-80]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|254285448|ref|ZP_04960412.1| phosphate ABC transporter, permease protein [Vibrio cholerae
           AM-19226]
 gi|150424310|gb|EDN16247.1| phosphate ABC transporter, permease protein [Vibrio cholerae
           AM-19226]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRIIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|297581128|ref|ZP_06943052.1| phosphate ABC transporter [Vibrio cholerae RC385]
 gi|297534444|gb|EFH73281.1| phosphate ABC transporter [Vibrio cholerae RC385]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|307353630|ref|YP_003894681.1| phosphate ABC transporter inner membrane subunit PstC
           [Methanoplanus petrolearius DSM 11571]
 gi|307156863|gb|ADN36243.1| phosphate ABC transporter, inner membrane subunit PstC
           [Methanoplanus petrolearius DSM 11571]
          Length = 658

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 138/229 (60%), Gaps = 8/229 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G+LY++   I  + P+G+ +AIYL E++ +   +S +++ ++ L   PSIV+
Sbjct: 434 GGIFPAIIGTLYLVGGAILFALPIGVCAAIYLVEYTKESRITSIIRSGVDLLNGTPSIVF 493

Query: 261 GILGSAVLINFFKMPRSTALVGGLI-LALMTLPSIIIATGVALRTVPSSIRSAALGLGAS 319
           G+ G A L+ F        L+ G+I L LM LP+II  T  AL++VP S+R  +L LGA+
Sbjct: 494 GLFGFAFLVLFLDF--GVCLLAGMITLGLMVLPTIIRTTEEALKSVPDSLRHGSLALGAT 551

Query: 320 KVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY-PVGVTDIATAFP 378
           K QT+   VL  A P I+TG+ +S+ RA GETAP++F  +V F T + P  V D   A P
Sbjct: 552 KWQTIRKVVLSPAAPGIITGTILSIGRAAGETAPIMFTAVV-FTTRFLPSSVFDPVMALP 610

Query: 379 VQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK--RW 425
             +++ + +       +   A++LLL+ +AV   A+L +RN ++K  RW
Sbjct: 611 YHLFILSTNVPGATTNQYGTALVLLLLVMAVYCIAIL-VRNHYQKSLRW 658



 Score = 84.0 bits (206), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 99/188 (52%), Gaps = 8/188 (4%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           DF +G   N   + P    + + V  +L + L  + ++ PLGI SAIY+ E +      S
Sbjct: 66  DFLFGSVWNPGGANPTYGTLPLWV-DTLLVTLGAMIIAAPLGIGSAIYISEIASSRI-RS 123

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA-----LVGGLILALMTLPSIIIAT 298
            ++  +  LA +PS+VYG  G  +L ++ ++    A     L G ++L +M LP+II  +
Sbjct: 124 VIKPAVELLAGIPSVVYGFFGLVILTDWLRITFDLATGECWLAGSILLGIMALPTIISVS 183

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET-APLLFV 357
             A+  VP + R  +LGLGA+  QT+   ++P A+  I     + + RA+GET A ++  
Sbjct: 184 EDAINAVPDNFRRGSLGLGATYWQTISKVIVPAALSGITAAIILGMGRAIGETMAVMMVT 243

Query: 358 GMVAFVTD 365
           G  A + D
Sbjct: 244 GNSAIIPD 251


>gi|303258015|ref|ZP_07344024.1| phosphate ABC transporter, permease protein PstA [Burkholderiales
           bacterium 1_1_47]
 gi|330999430|ref|ZP_08323144.1| phosphate ABC transporter, permease protein PstA [Parasutterella
           excrementihominis YIT 11859]
 gi|302859358|gb|EFL82440.1| phosphate ABC transporter, permease protein PstA [Burkholderiales
           bacterium 1_1_47]
 gi|329574856|gb|EGG56415.1| phosphate ABC transporter, permease protein PstA [Parasutterella
           excrementihominis YIT 11859]
          Length = 290

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 123/228 (53%), Gaps = 3/228 (1%)

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSI 258
           E  GI   ++G+  + +  + ++ PLGIA A++L E++ +G     +   + NLA VPSI
Sbjct: 62  EEGGILPCIIGTAILSIGAMAVALPLGIACAVWLNEYAKEGPLKKLITLAVANLAGVPSI 121

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           V+G+ G A  +    +  S A+ G L LA++TLP +I      L  +P+S R ++L LGA
Sbjct: 122 VFGLFGLAFFVTVCGLGVS-AIAGILTLAVLTLPIVINTVRETLSQIPNSWRESSLALGA 180

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
           SK QTV   VLP A+P ILTG+ + LARA GET+ ++F   V   T+ P        + P
Sbjct: 181 SKTQTVLRTVLPAALPGILTGAILGLARAAGETSAIMFTAAVVSTTNLPNSPFAAVMSLP 240

Query: 379 VQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             IY+ A     P   V       L+LL+ +  +N    ++R +  KR
Sbjct: 241 YHIYVLATTGMNPDKAVPIQCATALVLLMTVFALNLMAFYIRQKSSKR 288


>gi|70733400|ref|YP_263175.1| phosphate ABC transporter permease [Pseudomonas fluorescens Pf-5]
 gi|68347699|gb|AAY95305.1| phosphate ABC transporter, permease protein [Pseudomonas
           fluorescens Pf-5]
          Length = 533

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 138/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +   +  ++  +NNLA VP+IVY
Sbjct: 279 GGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYAKQNTLTRVIRIAVNNLAGVPAIVY 338

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG +V   FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 339 GVFGLGFFVYVLGGSVDRLFFPEALPAPTFGTPGLLWASLTLALLAVPVVIVATEEGLAR 398

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 399 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 458

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             P+                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 459 SLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 509

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +W+RN  ++++
Sbjct: 510 IATLNLSAVWIRNHLREKY 528


>gi|229525373|ref|ZP_04414778.1| phosphate transport system permease protein PstA [Vibrio cholerae
           bv. albensis VL426]
 gi|229338954|gb|EEO03971.1| phosphate transport system permease protein PstA [Vibrio cholerae
           bv. albensis VL426]
          Length = 548

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAQEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWAALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|20089773|ref|NP_615848.1| phosphate ABC transporter, permease protein [Methanosarcina
           acetivorans C2A]
 gi|19914712|gb|AAM04328.1| phosphate ABC transporter, permease protein [Methanosarcina
           acetivorans C2A]
          Length = 307

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 131/241 (54%), Gaps = 3/241 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F       R    GI  A+VG++ +++  + ++ PLGI +A+YL E++ +   +  +
Sbjct: 65  NVEFLTEIPRMRMTQGGIYPAIVGTVLLIIGSMAVALPLGILAAVYLNEYAGETRTTWLI 124

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +  INNLA  PS+V+G+ G A+ + +F    S+ L   L L+ + +P II ++  AL  V
Sbjct: 125 EMAINNLAGTPSVVFGLFGLALFVKYFGF-GSSILSASLTLSFLIIPVIIRSSQEALIAV 183

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P   R ++L LG SK QT+ H VLP A+P I+TGS +S+ R  GETAP+L  G   F+  
Sbjct: 184 PKEYRESSLALGISKWQTIRHVVLPAAIPGIVTGSILSIGRVAGETAPILLTGAAYFLPR 243

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P  +     A P  +++ A         R   +G  L+LL+ +  +N   + +R  ++K
Sbjct: 244 LPDSIYSQFMALPYHLFVLATSGTSIVKTRPLQYGTALVLLMIVLGMNAIAVLIRRHYRK 303

Query: 424 R 424
           +
Sbjct: 304 K 304


>gi|289523920|ref|ZP_06440774.1| phosphate ABC transporter, permease protein PstA [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289502576|gb|EFD23740.1| phosphate ABC transporter, permease protein PstA [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 291

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 130/232 (56%), Gaps = 15/232 (6%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   +VG++ ++L+ I  S P+GI +AIYL E++    F++ ++  I +LA+VPSIVY
Sbjct: 63  GGILTPIVGTIQLILVSIAFSLPVGICTAIYLAEYAKDDIFTTTLRLAIRSLAAVPSIVY 122

Query: 261 GILGSAVLINFFKMP---RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLG 317
           G+ G    ++FF +      + L  GL L  + LP I+ A   AL  VP S+R A+  LG
Sbjct: 123 GLFG----LSFFCITLKFNPSLLSAGLTLGCIALPLIVGAAETALLAVPQSLRYASYALG 178

Query: 318 ASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAF 377
           ASK QT+   V+P AMP+ILTG+ +S+ R  GETAP++F G   F       +     A 
Sbjct: 179 ASKWQTISKVVVPTAMPSILTGAILSVGRVAGETAPIMFTGAAFFTPGIAKSLFQEVMAL 238

Query: 378 PVQIYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           P  +Y+ A      D  RP     +GAIL+LLI +  I    + +R R  +R
Sbjct: 239 PFHVYVLATAGTSIDKTRPL---QYGAILVLLILVLGITLVGIIMRARLSRR 287


>gi|262172200|ref|ZP_06039878.1| phosphate transport system permease protein PstA [Vibrio mimicus
           MB-451]
 gi|261893276|gb|EEY39262.1| phosphate transport system permease protein PstA [Vibrio mimicus
           MB-451]
          Length = 548

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPNSARHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|225156504|ref|ZP_03724839.1| phosphate ABC transporter, inner membrane subunit PstA [Opitutaceae
           bacterium TAV2]
 gi|224802933|gb|EEG21180.1| phosphate ABC transporter, inner membrane subunit PstA [Opitutaceae
           bacterium TAV2]
          Length = 358

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 128/234 (54%), Gaps = 10/234 (4%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   +VG+L + +  + ++  LG+ SAIYL E++  G F  F++  I NLA VPSIV+
Sbjct: 124 GGIWPCIVGTLLLTVGSMTIALILGVCSAIYLSEYARDGRFVRFIRLAILNLAGVPSIVF 183

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G  + + FF    S  L G   LA M LP +I A+  AL+ VP   R  AL LGA+K
Sbjct: 184 GLFGFGLFVIFFGWNVS-LLAGWFTLAFMVLPVVITASEEALKAVPRGFREGALALGATK 242

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIAT----- 375
            Q +  +VLP A+P ILT S + +AR  GETAP++F          P  V  I       
Sbjct: 243 WQAIRTNVLPYALPGILTSSILGIARVAGETAPIMFTAAYVVRDKLPWDVEKIGDFFYQG 302

Query: 376 --AFPVQIYLWAAD-AERPFVERT-FGAILLLLIFLAVINTAMLWLRNRFKKRW 425
             A P  IY+ ++   +    +R  +G  L+ L+ +A+I T  + LRN+ ++R+
Sbjct: 303 VMALPYHIYVVSSKIPQNDHTQRVQYGTALVFLLLVALIATTSIVLRNKLRRRY 356


>gi|229593410|ref|YP_002875529.1| putative phosphate ABC transporter membrane protein [Pseudomonas
           fluorescens SBW25]
 gi|229365276|emb|CAY53607.1| putative phosphate ABC transport system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 556

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 138/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +   +  ++  +NNLA VP+IVY
Sbjct: 302 GGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYAKQNTLTRIIRIAVNNLAGVPAIVY 361

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG +V   FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSVDRLFFAEALPAPTFGTPGLLWASLTLALLAVPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             P+                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 SLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +W+RN  ++++
Sbjct: 533 IATLNLSAVWIRNHLREKY 551


>gi|313897387|ref|ZP_07830930.1| phosphate ABC transporter, permease protein PstA [Clostridium sp.
           HGF2]
 gi|312957757|gb|EFR39382.1| phosphate ABC transporter, permease protein PstA [Clostridium sp.
           HGF2]
          Length = 415

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 121/204 (59%), Gaps = 6/204 (2%)

Query: 225 GIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL---INFFKMPRSTALV 281
           GIASAIYL E++     +S +++ I  L  VPSI++G++G AVL      F    +  L+
Sbjct: 214 GIASAIYLHEYAKPNRLTSLIRSAIEMLTGVPSIIFGLMGVAVLFPITQLFGATTTNILL 273

Query: 282 GGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGST 341
           G   ++++ LP+II +T  AL  VP S+R A+L +GA++ QT+F  VLP A+P ILTG  
Sbjct: 274 GSFTMSIILLPTIIRSTEEALIVVPQSLRDASLSVGANQSQTIFKVVLPCAVPGILTGVL 333

Query: 342 VSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAIL 401
           +S+ R +GE+A L++  M  +V D P  ++   T+  V IY   + +E+P  E      +
Sbjct: 334 LSIGRVIGESAALIYT-MGTYVNDTPTLMSQ-GTSLAVHIYNIMS-SEQPNFELASAISI 390

Query: 402 LLLIFLAVINTAMLWLRNRFKKRW 425
           ++L+F+ ++N  +  L  +  K W
Sbjct: 391 VILVFVLILNICVKLLSKKLNKSW 414


>gi|262402887|ref|ZP_06079448.1| phosphate transport system permease protein PstA [Vibrio sp. RC586]
 gi|262351669|gb|EEZ00802.1| phosphate transport system permease protein PstA [Vibrio sp. RC586]
          Length = 548

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAKEGAFTRMIRVAVINLAGVPSIVY 352

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 473 SLPV------------------DGEFPFIHLERKF 489


>gi|319941525|ref|ZP_08015852.1| phosphate ABC transporter [Sutterella wadsworthensis 3_1_45B]
 gi|319804999|gb|EFW01838.1| phosphate ABC transporter [Sutterella wadsworthensis 3_1_45B]
          Length = 283

 Score =  127 bits (318), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 132/228 (57%), Gaps = 9/228 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G+  + L  + ++ PLG+ASA+YL+E+S    + +  + +I NLA VPSIV+
Sbjct: 60  GGILPCIIGTFCLALGALVIALPLGVASAVYLKEYSQPSVWVTLTRLSIANLAGVPSIVF 119

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G    + F     S  L G L LA+++LP II  T  AL  +P   R A+L LGAS+
Sbjct: 120 GLFGLTFFVVFCGFGVSL-LSGILTLAVLSLPIIINTTEAALSQIPQDWREASLALGASQ 178

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            +T    VLP A+P ILTGS ++LARA GETA +++ G V F     V + D   A P  
Sbjct: 179 RETTLKVVLPNALPGILTGSILALARAAGETAAIMYTGSVFFTPKEGVSLFDPVMALPYH 238

Query: 381 IYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           IY+ A      +A RP     +G  L+LLI + ++++A + +R R ++
Sbjct: 239 IYVLATSGTSIEATRPL---QYGTALVLLILVLLMSSAAIVIRERRRR 283


>gi|261212171|ref|ZP_05926457.1| phosphate transport system permease protein PstA [Vibrio sp. RC341]
 gi|260838779|gb|EEX65430.1| phosphate transport system permease protein PstA [Vibrio sp. RC341]
          Length = 547

 Score =  127 bits (318), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 122/215 (56%), Gaps = 36/215 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++ +G F+  ++  + NLA VPSIVY
Sbjct: 292 GGVFPAIFGTVFLVIIMSIIVMPLGVIAAIYLHEYAKEGAFTRMIRVAVINLAGVPSIVY 351

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 352 GVFGLGFFVYTIGASVDNLFYAERLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 411

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 412 IPISVRHGSLALGATQFETIWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGAVKLAS 471

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFV--ERTF 397
             PV                  D E PF+  ER F
Sbjct: 472 SLPV------------------DGEFPFIHLERKF 488


>gi|307298066|ref|ZP_07577870.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916152|gb|EFN46535.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 278

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 133/241 (55%), Gaps = 2/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           D +  F ++   +     GI  +++G+ Y + I +  S P+GI SA+YL E+S +  F  
Sbjct: 36  DISLEFLVSFPRNSMTEGGIWPSILGTFYFLSIALLFSVPVGILSAVYLSEYSKENRFQR 95

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            V    N LA +PS+V+G+ G ++    F    S  + GGL L +M+LP II  T  +L 
Sbjct: 96  LVLTANNILAGIPSVVFGMFGLSLFSITFGFGTSI-ISGGLTLGIMSLPYIISNTHESLA 154

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S R A++ LGA+K +T F  V+P +   ILTG  +++ R +GETAPLLF G   ++
Sbjct: 155 AVPKSYREASMALGANKAETTFRIVVPASFSRILTGVMIAVGRIIGETAPLLFTGAAFYI 214

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           T  P G+ + A + P  I++ +A        +  G+I +LLI +  +  ++  +R R + 
Sbjct: 215 TRNPSGLFEPAMSLPTHIFVLSAIYPENVTPKLEGSISVLLIIVITLFVSV-AIRRRIES 273

Query: 424 R 424
           +
Sbjct: 274 K 274


>gi|254514192|ref|ZP_05126253.1| phosphate ABC transporter, permease protein PstA [gamma
           proteobacterium NOR5-3]
 gi|219676435|gb|EED32800.1| phosphate ABC transporter, permease protein PstA [gamma
           proteobacterium NOR5-3]
          Length = 487

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 122/203 (60%), Gaps = 27/203 (13%)

Query: 188 GFFINGASSRPEVAGIGV--AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           G F+  +  R  V G GV  A++G++ ++L++  +  PLG+ +AIYL+E++ +G  +  V
Sbjct: 218 GRFLGESPRRSNVQG-GVFPAILGTVILVLLMAVIVSPLGVLAAIYLQEYAQRGPVTRLV 276

Query: 246 QANINNLASVPSIVYGILGSAVLINFF---------------KMPRSTALVGGLI----- 285
           +  +NNLA VPSIVYG+ G    + FF               ++P  T    G++     
Sbjct: 277 RIAVNNLAGVPSIVYGVFG----LGFFVYAIGGSLDSLLFEDRLPAPTLGTPGMLWAALT 332

Query: 286 LALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLA 345
           +AL+TLP +I++T   L  VP+S+R  +L LGA++ +T++H VLP A PA+LTG  +++A
Sbjct: 333 MALLTLPVVIVSTEEGLARVPASLREGSLALGATRAETLWHVVLPAASPAVLTGLILAVA 392

Query: 346 RALGETAPLLFVGMVAFVTDYPV 368
           RA GE APLL VG+  +    PV
Sbjct: 393 RATGEVAPLLLVGVAKYAPGLPV 415


>gi|330507562|ref|YP_004383990.1| phosphate ABC transporter inner membrane subunit [Methanosaeta
           concilii GP-6]
 gi|328928370|gb|AEB68172.1| phosphate ABC transporter, inner membrane subunit [Methanosaeta
           concilii GP-6]
          Length = 415

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 84/250 (33%), Positives = 139/250 (55%), Gaps = 18/250 (7%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ F  +      +  GI  A++GSL+M+L  + +S PLGI +AIYL E+S     +  +
Sbjct: 170 NWEFLTSPHRRLGQAGGISTAILGSLWMVLGAMLISSPLGIGAAIYLHEYSKSERLNRLI 229

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
              ++ L  VPS+VYG+ G A L++ F +   + + G +IL L+ +P+II+ +  AL++V
Sbjct: 230 TIAVSCLNGVPSVVYGLFGLAFLVSLFGV---SLISGSIILGLINIPTIILTSQEALKSV 286

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV----- 360
           P+S+R  ++ LGA+K QT+   VLP AMP ILTG  + +A+A GETAP+++  +      
Sbjct: 287 PNSLREGSMALGATKWQTIRKVVLPSAMPGILTGVIMGVAKASGETAPIMWTAVTFTASP 346

Query: 361 -----AFVTDYPVGVTDIATAFPVQIY-LWAADAERPFVERTFGAILLLLIFLAVINTAM 414
                  + D    V ++       IY L A D E     R +G  L+L+  +   N   
Sbjct: 347 VQMIYGVIPDLFQPVNNLNYHLLNLIYFLGAWDVE----ARAWGTALVLISLVLSTNLLA 402

Query: 415 LWLRNRFKKR 424
           + +RN ++K+
Sbjct: 403 IVVRNYYRKK 412


>gi|189423689|ref|YP_001950866.1| phosphate ABC transporter inner membrane protein [Geobacter lovleyi
           SZ]
 gi|189419948|gb|ACD94346.1| phosphate ABC transporter, inner membrane subunit PstA [Geobacter
           lovleyi SZ]
          Length = 530

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 108/183 (59%), Gaps = 16/183 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M+L++   S P G+ +AIYL E++ +G     V+  +NNLA VPSIVY
Sbjct: 276 GGLFPAIFGTVMMVLLMSVFSLPFGVIAAIYLREYAKEGRLVQLVRIAVNNLAGVPSIVY 335

Query: 261 GILGSAVLIN---------FF--KMPRSTALVGG-----LILALMTLPSIIIATGVALRT 304
           G+ G    +          FF  ++P      GG     L LAL+T+P +I+AT  +L +
Sbjct: 336 GVFGLGFFVYGIGGSLDKLFFPERLPTPVFGTGGILWASLTLALLTVPVVIVATEESLAS 395

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P  IR  +L LGA+K QT+   +LP+A P I+TG  +S+ARA+GE APL+ VG+V    
Sbjct: 396 IPKGIREGSLALGATKFQTLTKVLLPMATPGIMTGLVLSMARAVGEVAPLMMVGVVKLAP 455

Query: 365 DYP 367
             P
Sbjct: 456 TLP 458


>gi|257467877|ref|ZP_05631973.1| phosphate ABC transporter, inner membrane subunit PstA
           [Fusobacterium ulcerans ATCC 49185]
 gi|317062166|ref|ZP_07926651.1| phosphate ABC transporter [Fusobacterium ulcerans ATCC 49185]
 gi|313687842|gb|EFS24677.1| phosphate ABC transporter [Fusobacterium ulcerans ATCC 49185]
          Length = 280

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 122/224 (54%), Gaps = 1/224 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G++Y+ +  I +S P GI + IYL E++     +  +   I NLA +PSI+Y
Sbjct: 58  GGIFPAIIGTIYLTIGTIVVSVPFGIFTGIYLVEYAKDNLLTRIINLTIINLAGIPSIIY 117

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ + F     S  + G L L +M LP II +T  +L  +P+ +R A+L LGA+K
Sbjct: 118 GLFGMALFVIFLGFGVSI-ISGSLTLGIMCLPVIITSTRESLLAIPNHLREASLALGATK 176

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            +T+   VLP A+P ILTG  +S++RA GETAP++F  +  ++   P    D   A P  
Sbjct: 177 WETITKVVLPAALPGILTGVILSISRAAGETAPIMFTAVAFYLPFLPETPWDQVMALPYH 236

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +       V    G + +L++     N     +R +F  +
Sbjct: 237 LYVISTQVPNMPVSYMNGTLFVLVVITISFNLIGAVIRQKFNNK 280


>gi|110803939|ref|YP_697933.1| phosphate ABC transporter permease [Clostridium perfringens SM101]
 gi|110684440|gb|ABG87810.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens SM101]
          Length = 274

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 133/242 (54%), Gaps = 13/242 (5%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           FL  NY        S    +GI   +V +L+ +L+ + ++ P+G+  A+YL+E++ +G  
Sbjct: 43  FLTSNY--------SAGSGSGILPMIVTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKM 94

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
            +F++    +LA +PSIVYG+ G    +   KM  S  L G L ++++ LP II  T  A
Sbjct: 95  VNFIRFATESLAGIPSIVYGLFGGIFFVVDLKMGYSI-LAGSLTVSIIILPVIIRTTEEA 153

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+TVP S R A+LGLGA+K QT++  +LP AMP IL+G  +S+ R +GE+A +L      
Sbjct: 154 LKTVPESYREASLGLGATKFQTLYKVILPSAMPGILSGVILSIGRIIGESAAILLTA--G 211

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
            V   P G+   A    VQ YL     E+  +E      ++L++ +  +N +   +  +F
Sbjct: 212 TVAQMPKGIFSSARTLTVQAYL--VTKEKGDIETAAAVGIVLIVIILALNISAKLIAKKF 269

Query: 422 KK 423
            K
Sbjct: 270 NK 271


>gi|328472626|gb|EGF43489.1| phosphate ABC transporter permease [Vibrio parahaemolyticus 10329]
          Length = 557

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 113/184 (61%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++++LI+  +  PLG+ +AIYL E++    F+  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAIFGTVFLVLIMSIIVMPLGVVAAIYLHEYAKNNAFTRIIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNVFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|326797374|ref|YP_004315194.1| phosphate ABC transporter inner membrane subunit PstA [Marinomonas
           mediterranea MMB-1]
 gi|326548138|gb|ADZ93358.1| phosphate ABC transporter, inner membrane subunit PstA [Marinomonas
           mediterranea MMB-1]
          Length = 566

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M++++  +  P G+ +A+YL E++ +G  +  ++  +NNLA VPSIVY
Sbjct: 312 GGVFPAIFGTVMMVMLMTVIVTPFGVVAAVYLREYASQGVLTRTIRIAVNNLAGVPSIVY 371

Query: 261 GI---------LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LGS +   FF   +P  T   GGL+     LAL+T+P +I+AT   L  
Sbjct: 372 GVFGLGFFIYFLGSGIDQAFFPEALPSPTFGTGGLMWASITLALLTVPVVIVATEEGLSR 431

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  +LP+  PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 432 IPRNVREGSLALGATKAETLWRVILPMCSPAIMTGVILAVARAAGEVAPLMLVGVVKLAP 491

Query: 365 DYPV 368
             P+
Sbjct: 492 SLPL 495


>gi|319901744|ref|YP_004161472.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Bacteroides helcogenes P 36-108]
 gi|319416775|gb|ADV43886.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Bacteroides helcogenes P 36-108]
          Length = 276

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 112/183 (61%), Gaps = 1/183 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+VG+  +M      +FP+G+ S IY+ E++ KG+    ++   NNL+ +PSIV+
Sbjct: 48  GGIFPAIVGTFCLMAGSALFAFPVGVMSGIYMNEYAPKGWIVRLIRVMTNNLSGIPSIVF 107

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ +N+     S  L G L L L++LP +I  T  AL+T+P S+R  +  LGA+K
Sbjct: 108 GLFGMALFVNYMDFGDSI-LAGSLTLGLLSLPLVIRTTEEALKTIPDSLREGSRALGATK 166

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT++H VLP+ MP I+TG  ++L R  GETAP+LF     F+   P G+ D   A P  
Sbjct: 167 LQTIWHVVLPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPAGILDQCMALPYH 226

Query: 381 IYL 383
           +Y+
Sbjct: 227 LYV 229


>gi|323342103|ref|ZP_08082336.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464528|gb|EFY09721.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 407

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 197 RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVP 256
           + +  GI  +++ +L ++   +  + PLGI +A+YL E +     +  ++++I  LA VP
Sbjct: 177 KTQSGGIWGSILATLLLIATSLLFALPLGIGAALYLTEIAPDTAMTRMLESSIEMLAGVP 236

Query: 257 SIVYGILGSAVL---INFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAA 313
           SI++G+LG AVL     FF +   + L+GG+ +A++ LP II +   +L  VP S+RSA+
Sbjct: 237 SIIFGLLGIAVLFPITAFFNVSGLSILLGGMTMAIILLPVIIRSVKESLLVVPDSLRSAS 296

Query: 314 LGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI 373
           L LG ++ QT+F  VLP A+P IL+   +S++R +GE+A L++  M  FV D P G+T  
Sbjct: 297 LSLGGTQTQTIFKVVLPSALPGILSAVLLSVSRIIGESAALIYT-MGTFVNDVP-GLTQG 354

Query: 374 ATAFPVQIYLWAA-DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            T+  V I  W+    E+P  E      +++L  + ++N  + ++  + +KR
Sbjct: 355 GTSLAVHI--WSVMSQEQPNFELASAISIVILALVLILNLTVKYISKQLQKR 404


>gi|170727507|ref|YP_001761533.1| phosphate ABC transporter inner membrane subunit PstA [Shewanella
           woodyi ATCC 51908]
 gi|169812854|gb|ACA87438.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           woodyi ATCC 51908]
          Length = 550

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 111/412 (26%), Positives = 192/412 (46%), Gaps = 67/412 (16%)

Query: 54  THISLPIEFSETIVDPQKKRF------MDPAILLRADYNLLVRKALARKLSISDSNHALL 107
           +HI   +E ++  V  QK         ++   L    Y L  +   ARKL +  +   L 
Sbjct: 161 SHIERAVELNDEAVKLQKSEIGSINYALEKLRLKERGYELDNKLTDARKLELETARSTL- 219

Query: 108 RQASQMLSTTARYHLRKTLMTDPSLIG--KTVEVSLLASANIDSALKGYLYSPANVHRMS 165
            QA  ++     + LR+    D  +I   + +EV+L     +DS L     + AN   + 
Sbjct: 220 -QADYLVLEKQFFALREEAGRDSVIIKDMRGLEVTL----KLDSILD---VTYANRMGLF 271

Query: 166 DYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV--AVVGSLYMMLIVIGLSFP 223
                WF  +            G FI+         G GV  A+ G+++M++++  +  P
Sbjct: 272 SKVGHWFVGM------------GRFISDDPREANTEG-GVFPAIFGTVFMVMLMAVIVTP 318

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFF----------- 272
            G+ +AIYL E++ KG  +  ++  + NLA VPSIVYG+ G    +  F           
Sbjct: 319 FGVIAAIYLHEYAKKGPVTKMIRIAVINLAGVPSIVYGVFGLGFFVYMFGGTLDQLFYPE 378

Query: 273 KMPRSTALVGGLI-----LALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHH 327
            +P  T    G+I     LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  
Sbjct: 379 ALPAPTFGSPGVIWSALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRI 438

Query: 328 VLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP--------- 378
           V+P+A PAI+TG  +++ARA GE APL+ VG+V      P+ +      FP         
Sbjct: 439 VIPMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLPIDMN-----FPFVHLERKFM 493

Query: 379 -VQIYLWAADAERPFVERT----FGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            +  +++    + P VE      +    LL+  +  +N   + +RN  ++++
Sbjct: 494 HLGFHIYDVGFQSPNVEAARPLVYATSFLLVSVIVSLNLTAIGVRNHLREKY 545


>gi|77165860|ref|YP_344385.1| ABC phosphate transporter, inner membrane subunit [Nitrosococcus
           oceani ATCC 19707]
 gi|254433233|ref|ZP_05046741.1| phosphate ABC transporter, permease protein PstA, putative
           [Nitrosococcus oceani AFC27]
 gi|76884174|gb|ABA58855.1| ABC phosphate transporter, inner membrane subunit [Nitrosococcus
           oceani ATCC 19707]
 gi|207089566|gb|EDZ66837.1| phosphate ABC transporter, permease protein PstA, putative
           [Nitrosococcus oceani AFC27]
          Length = 550

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 109/184 (59%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M+LI+  +  P G+ +A+YL E++ +G     ++  +NNLA VPSIVY
Sbjct: 296 GGIFPAIFGTVMMVLIMSVIVTPFGVVAAVYLREYAQQGLLIRIIRIAVNNLAGVPSIVY 355

Query: 261 GILGSAVLINFF-----------KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G    + F             +P  T    GL+     LA++T+P +I+AT   L  
Sbjct: 356 GVFGLGFFVYFLGGNVDRWFFPEALPAPTFGTPGLLWASLTLAILTMPVVIVATEEGLSR 415

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P SIR  +L LGA++ +T++  VLP+A+PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 416 IPRSIREGSLALGATRAETLWRTVLPMAVPAMMTGLILAVARAAGEVAPLMMVGVVKLAP 475

Query: 365 DYPV 368
             P+
Sbjct: 476 SLPL 479


>gi|270296460|ref|ZP_06202660.1| phosphate ABC transporter, permease PstA [Bacteroides sp. D20]
 gi|270273864|gb|EFA19726.1| phosphate ABC transporter, permease PstA [Bacteroides sp. D20]
          Length = 286

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 116/198 (58%), Gaps = 1/198 (0%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F     ++     GI  A+VG+  +M      +FP+G+ S IY+ E+  KG+   F+
Sbjct: 43  DWEFLTTAPANSMTAGGILPAIVGTFCLMAGSALFAFPVGVMSGIYMNEYVPKGWVVRFI 102

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +   NNL+ +PSIV+G+ G A+ +N+     S  L G L L L++LP +I  T  AL+ +
Sbjct: 103 RMMTNNLSGIPSIVFGLFGMALFVNYMDFGDSI-LAGSLTLGLLSLPLVIRTTEEALKAI 161

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+  
Sbjct: 162 PDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQ 221

Query: 366 YPVGVTDIATAFPVQIYL 383
            P G+ D   A P  +Y+
Sbjct: 222 LPTGIFDQCMALPYHLYV 239


>gi|168214871|ref|ZP_02640496.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens CPE str. F4969]
 gi|170713702|gb|EDT25884.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens CPE str. F4969]
          Length = 274

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 124/217 (57%), Gaps = 5/217 (2%)

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           +V +L+ +L+ + ++ P+G+  A+YL+E++ +G    F++    +LA +PSIVYG+ G  
Sbjct: 60  IVTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKMVKFIRFATESLAGIPSIVYGLFGGI 119

Query: 267 VLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFH 326
             +   KM  S  L G L ++++ LP II  T  AL+TVP S R A+LGLGA+K QT++ 
Sbjct: 120 FFVVALKMGYSI-LAGSLTVSIIILPVIIRTTEEALKTVPESYREASLGLGATKFQTLYK 178

Query: 327 HVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA 386
            +LP AMP IL+G  +S+ R +GE+A +L       V   P G+   A    VQ YL   
Sbjct: 179 VILPSAMPGILSGVILSIGRIIGESAAILLTA--GTVAQMPKGIFSSARTLTVQAYL--V 234

Query: 387 DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
             E+  +E      ++L++ +  +N +   +  +F K
Sbjct: 235 TKEKGDIETAAAVGIVLIVIILALNISAKLIAKKFNK 271


>gi|18309621|ref|NP_561555.1| phosphate ABC transporter permease [Clostridium perfringens str.
           13]
 gi|169344719|ref|ZP_02865679.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens C str. JGS1495]
 gi|182625758|ref|ZP_02953526.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens D str. JGS1721]
 gi|18144298|dbj|BAB80345.1| probable phosphate ABC transporter [Clostridium perfringens str.
           13]
 gi|169297154|gb|EDS79269.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens C str. JGS1495]
 gi|177909020|gb|EDT71502.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens D str. JGS1721]
          Length = 274

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 124/217 (57%), Gaps = 5/217 (2%)

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           +V +L+ +L+ + ++ P+G+  A+YL+E++ +G    F++    +LA +PSIVYG+ G  
Sbjct: 60  IVTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKMVKFIRFATESLAGIPSIVYGLFGGI 119

Query: 267 VLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFH 326
             +   KM  S  L G L ++++ LP II  T  AL+TVP S R A+LGLGA+K QT++ 
Sbjct: 120 FFVVALKMGYSI-LAGSLTVSIIILPVIIRTTEEALKTVPESYREASLGLGATKFQTLYK 178

Query: 327 HVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA 386
            +LP AMP IL+G  +S+ R +GE+A +L       V   P G+   A    VQ YL   
Sbjct: 179 VILPSAMPGILSGVILSIGRIIGESAAILLT--AGTVAQMPKGIFSSARTLTVQAYL--V 234

Query: 387 DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
             E+  +E      ++L++ +  +N +   +  +F K
Sbjct: 235 TKEKGDIETAAAVGIVLIVIILALNISAKLIAKKFNK 271


>gi|253583355|ref|ZP_04860553.1| phosphate ABC transporter, inner membrane subunit PstA
           [Fusobacterium varium ATCC 27725]
 gi|251833927|gb|EES62490.1| phosphate ABC transporter, inner membrane subunit PstA
           [Fusobacterium varium ATCC 27725]
          Length = 280

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 122/224 (54%), Gaps = 1/224 (0%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G++Y+ +  I +S P GI + IYL E++     +  +   I NLA +PSI+Y
Sbjct: 58  GGIFPAIIGTIYLTIGTIVVSVPFGIFTGIYLVEYAKDNLLTRIINLTIINLAGIPSIIY 117

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G A+ + F     S  + G L L +M LP II +T  +L  +P+ +R A+L LGA+K
Sbjct: 118 GLFGMALFVIFLGFDVSI-VSGSLTLGIMCLPVIITSTRESLLAIPNHLREASLALGATK 176

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            +T+   VLP A+P ILTG  +S++RA GETAP++F  +  ++   P    D   A P  
Sbjct: 177 WETITKVVLPAALPGILTGVILSISRAAGETAPIMFTAVAFYLPFLPETPWDQVMALPYH 236

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           +Y+ +       +    G + +L++     N     +R +F  +
Sbjct: 237 LYVISTQVPNMPISYMNGTLFVLVVITISFNLIGAVIRQKFNNK 280


>gi|110799373|ref|YP_695073.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens ATCC 13124]
 gi|168206754|ref|ZP_02632759.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens E str. JGS1987]
 gi|168211947|ref|ZP_02637572.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens B str. ATCC 3626]
 gi|168218153|ref|ZP_02643778.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens NCTC 8239]
 gi|110674020|gb|ABG83007.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens ATCC 13124]
 gi|170661867|gb|EDT14550.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens E str. JGS1987]
 gi|170710118|gb|EDT22300.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens B str. ATCC 3626]
 gi|182379842|gb|EDT77321.1| phosphate ABC transporter, permease protein PstA [Clostridium
           perfringens NCTC 8239]
          Length = 274

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 124/217 (57%), Gaps = 5/217 (2%)

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           +V +L+ +L+ + ++ P+G+  A+YL+E++ +G    F++    +LA +PSIVYG+ G  
Sbjct: 60  IVTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKMVKFIRFATESLAGIPSIVYGLFGGI 119

Query: 267 VLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFH 326
             +   KM  S  L G L ++++ LP II  T  AL+TVP S R A+LGLGA+K QT++ 
Sbjct: 120 FFVVALKMGYSI-LAGSLTVSIIILPVIIRTTEEALKTVPESYREASLGLGATKFQTLYK 178

Query: 327 HVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA 386
            +LP AMP IL+G  +S+ R +GE+A +L       V   P G+   A    VQ YL   
Sbjct: 179 VILPSAMPGILSGVILSIGRIIGESAAILLT--AGTVAQMPKGIFSSARTLTVQAYL--V 234

Query: 387 DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
             E+  +E      ++L++ +  +N +   +  +F K
Sbjct: 235 TKEKGDIETAAAVGIVLIVIILALNISAKLIAKKFNK 271


>gi|300113429|ref|YP_003760004.1| phosphate ABC transporter inner membrane subunit PstA
           [Nitrosococcus watsonii C-113]
 gi|299539366|gb|ADJ27683.1| phosphate ABC transporter, inner membrane subunit PstA
           [Nitrosococcus watsonii C-113]
          Length = 550

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 109/184 (59%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M+LI+  +  P G+ +A+YL E++ +G     ++  +NNLA VPSIVY
Sbjct: 296 GGIFPAIFGTVMMVLIMSVIVTPFGVVAAVYLREYAQQGLLIRIIRIAVNNLAGVPSIVY 355

Query: 261 GILGSAVLINFF-----------KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G    + F             +P  T    GL+     LA++T+P +I+AT   L  
Sbjct: 356 GVFGLGFFVYFLGGNVDRWFFPEALPAPTFGTPGLLWASLTLAILTMPVVIVATEEGLSR 415

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P SIR  +L LGA++ +T++  VLP+A+PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 416 IPRSIREGSLALGATRAETLWRTVLPMAVPAMMTGLILAVARAAGEVAPLMMVGVVKLAP 475

Query: 365 DYPV 368
             P+
Sbjct: 476 SLPL 479


>gi|317049112|ref|YP_004116760.1| phosphate ABC transporter inner membrane subunit PstA [Pantoea sp.
           At-9b]
 gi|316950729|gb|ADU70204.1| phosphate ABC transporter, inner membrane subunit PstA [Pantoea sp.
           At-9b]
          Length = 532

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 151/277 (54%), Gaps = 41/277 (14%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           FL   + F  N  ++    +G   A+ G++ M+L++  +  PLG+ +A++L E++ +   
Sbjct: 259 FLSQLWQFVSNNPAAGESESGALPAIFGTVLMVLLMSVIVMPLGVVAALWLHEYAGRNAL 318

Query: 242 SSFVQANINNLASVPSIVYGILG--------SAVLINFF---KMPRSTALVGGLI----- 285
           +  V+  + NLA VPSIVYG+ G           +   F    +P  T    GL+     
Sbjct: 319 TRLVRIAVVNLAGVPSIVYGVFGLGFFVWLIGGTIDQLFYSRALPNPTFGTPGLLWASLT 378

Query: 286 LALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLA 345
           LAL+TLP +I+AT   L  +P S+R  +L LGA++ +T++  VLPLA+PA+LTG  +++A
Sbjct: 379 LALLTLPVVIVATEEGLSRIPDSLRQGSLALGATQAETLWRVVLPLAVPAMLTGLILAVA 438

Query: 346 RALGETAPLLFVGMVAFVTDYPVGVTDIATAFP------------VQIYLWA-----ADA 388
           RA GETAPL+ VG+V  V + PV        FP             QIY  A      DA
Sbjct: 439 RAAGETAPLMLVGVVKMVPELPVDAV-----FPYLHLDRKFMHLGFQIYDLAFQSPNIDA 493

Query: 389 ERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           +RP V  T  A+LL+ I L+ +N   + LR+R ++R+
Sbjct: 494 DRPLVYAT--ALLLVAIILS-LNLLAMALRHRLRERY 527


>gi|164687348|ref|ZP_02211376.1| hypothetical protein CLOBAR_00989 [Clostridium bartlettii DSM
           16795]
 gi|164603772|gb|EDQ97237.1| hypothetical protein CLOBAR_00989 [Clostridium bartlettii DSM
           16795]
          Length = 280

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 128/223 (57%), Gaps = 5/223 (2%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++ ++YM+L+ I ++ P+GI +A+YL+E++ +G     ++     LA +PSIVY
Sbjct: 60  GGILPMIMTTVYMVLVSILVATPIGILAAVYLQEYAKQGKLVRVIRFATECLAGIPSIVY 119

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G    +   K+  S  L GGL +A++ LP+II +T  AL+TVP + R A+LGLGA+K
Sbjct: 120 GLFGGIFFVVALKLQYSI-LSGGLTVAIIILPTIIRSTEEALKTVPDTYREASLGLGATK 178

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT++  +LP A+P IL+G  +S+ R +GE+A +L       V   P+ V D A    V 
Sbjct: 179 FQTLYKVILPSAIPGILSGVILSIGRVIGESAAILLTA--GTVAKMPLTVFDSARTLTVH 236

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            YL     E   ++   G  L+L++ +  +NT    +  +  K
Sbjct: 237 AYLL--TKETGDIQTACGVGLVLIVIVFALNTIAKLVAKKLNK 277


>gi|300869911|ref|YP_003784782.1| phosphate ABC transporter inner membrane subunit PstA [Brachyspira
           pilosicoli 95/1000]
 gi|300687610|gb|ADK30281.1| phosphate ABC transporter, inner membrane, subunit PstA
           [Brachyspira pilosicoli 95/1000]
          Length = 596

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 129/222 (58%), Gaps = 8/222 (3%)

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH-KGFFSSFVQANINNLASVPSIVYGILG 264
           A+V +  M+ + + ++ PLG+ +AIYL E+S  K    S ++   ++L+ +PSIV+G+ G
Sbjct: 381 AIVSTSMMLFMSLIIAIPLGVFAAIYLTEYSKAKSQLISIIRIFTDSLSGIPSIVFGLFG 440

Query: 265 SAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTV 324
             V  N F M RS  L G L L L+ LPSII  T   L ++P+S+R  +L LGASKV+T+
Sbjct: 441 MLVFANLFGMGRSI-LAGSLTLVLIILPSIIRQTEETLLSIPASLREGSLALGASKVRTI 499

Query: 325 FHHVLPLAMPAILTGSTVSLARALGETAPLLFV-GMVAFVTDYPVGVTDIATAFPVQIYL 383
           F  VLP     I+T   +S+ R +GE+A L++  G V ++   P G     ++F V   +
Sbjct: 500 FKIVLPCGFSGIMTSVILSIGRIVGESAALIYTAGAVRYM---PKGYFSAGSSFSVM--M 554

Query: 384 WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           W   +E  ++ +TF    +LLI + ++N ++  +  + KK +
Sbjct: 555 WMFSSEGLYINQTFATASILLIMVILLNASLFLVNTKLKKDY 596



 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 87/184 (47%), Gaps = 8/184 (4%)

Query: 181 LFLDFNYGFFINGASSRPEVAGIGV--AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           +F +  +  F+ G +  P     G+   +VGSLY+ ++ + L    G  +A+Y+  F+ K
Sbjct: 47  IFKEVGFFKFVFGMNWSPSTKDFGILPMIVGSLYITILSVFLGGGFGFFTAVYISMFAPK 106

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFK--MPRSTA---LVGGLILALMTLPS 293
                  Q  I+ LA +PSIVYG  G  VL+ F K   P       L   +ILA+M LP+
Sbjct: 107 NIRVILSQV-IDLLAGIPSIVYGFFGMVVLVPFLKNLSPNDVGEGVLASSIILAIMILPT 165

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           I   T   L  V       A  LG +  Q +F  ++  A   I +   + + RA+GET  
Sbjct: 166 ITSITRYNLEAVYKYYYDGARALGNTHSQAIFGVIVKAAKSGIFSAIVLGMGRAIGETMA 225

Query: 354 LLFV 357
           ++ V
Sbjct: 226 VMMV 229


>gi|258591858|emb|CBE68161.1| conserved membrane protein of unknown function [NC10 bacterium
           'Dutch sediment']
          Length = 539

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 111/197 (56%), Gaps = 19/197 (9%)

Query: 190 FINGASSRPEVAGIGV--AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           FI+G        G GV  A+ G++ M++I+  L  PLG+ +A YL E++ +G   S V+ 
Sbjct: 273 FISGDPRESNTEG-GVFPAIFGTVMMVMIMSLLVAPLGVLAAFYLREYAKQGVLVSTVRI 331

Query: 248 NINNLASVPSIVYGILGSAVLINFF-----------KMPRSTALVGG-----LILALMTL 291
            +NNLA VPSIV+G+ G    I               +P  T   GG     L LALMT+
Sbjct: 332 AVNNLAGVPSIVFGVFGLGFFIYLVGGSIDRLFYPEALPTPTFGTGGILWASLTLALMTV 391

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I+AT   L  +P  +R A+L LGA+K +T +  VLP  MP+ILTG  +++ARA+GE 
Sbjct: 392 PVVIVATEEGLAAIPPGMREASLALGATKFETTWRVVLPTVMPSILTGLILAMARAIGEV 451

Query: 352 APLLFVGMVAFVTDYPV 368
           APL+  G+V      P+
Sbjct: 452 APLMITGVVKLAPSLPI 468


>gi|254414568|ref|ZP_05028334.1| phosphate ABC transporter, permease protein PstA [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178798|gb|EDX73796.1| phosphate ABC transporter, permease protein PstA [Microcoleus
           chthonoplastes PCC 7420]
          Length = 303

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 135/230 (58%), Gaps = 19/230 (8%)

Query: 170 KWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
           K F +L+ D  LF +      ++G        G+G A+VG+L ++ I   +S P+G+ +A
Sbjct: 58  KGFNRLNLD--LFTELPPAAGLSGG-------GVGNAIVGTLIVIAIGALISVPIGVLAA 108

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLI---NFFKMPRS-TALVGGLI 285
           +YL EFS  G  + +++   N L+ VPSI+ GI    +++    F     S +AL GG+ 
Sbjct: 109 VYLSEFS-SGPIARWIRFATNVLSGVPSIIAGIFAYGIIVLGAGFVPCSGSFSALAGGVA 167

Query: 286 LALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLA 345
           LA++ LP II  T  AL+ VP  +R A++G+GAS+ QTV   VLP A+PAILTG+T+++A
Sbjct: 168 LAVLMLPIIIRTTDEALQIVPQDVRWASVGVGASEYQTVLRVVLPAALPAILTGTTLAVA 227

Query: 346 RALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVER 395
           RA GETAPL+F  +  F   +P G+     +  V +Y +A     PF ++
Sbjct: 228 RAAGETAPLIFTALFTFF--WPSGLCQPTPSLAVLVYNFATS---PFSDQ 272


>gi|298491241|ref|YP_003721418.1| phosphate ABC transporter inner membrane subunit PstA ['Nostoc
           azollae' 0708]
 gi|298233159|gb|ADI64295.1| phosphate ABC transporter, inner membrane subunit PstA ['Nostoc
           azollae' 0708]
          Length = 293

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 132/222 (59%), Gaps = 8/222 (3%)

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSI 258
           +  G G A++G+L M+ I   +S P G+ +AIYL EFS  G  + +V+   N L+ VPSI
Sbjct: 70  QGGGFGNAILGTLLMVGIGALISIPTGVLTAIYLTEFS-SGKIARWVRFATNVLSGVPSI 128

Query: 259 VYGILGSAV----LINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAAL 314
           + G+    +    L+N  K+   +AL GG  LA++ LP+I+  T  AL+ V   +R A++
Sbjct: 129 IAGVFAYGIVVLTLVNL-KLGSYSALGGGFALAILMLPTIVRTTDEALQLVSQDLRQASV 187

Query: 315 GLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIA 374
           GLGA+K+QTV   VLP A+PAI+TGST+++ARA GETAPLLF  +  F + +P G+    
Sbjct: 188 GLGATKLQTVTQVVLPAALPAIVTGSTLAIARASGETAPLLFTAL--FSSFWPNGLLKPT 245

Query: 375 TAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
            +  V +Y +A    + +    + A L+L++ + +      W
Sbjct: 246 ASLAVLVYNFAISPFKNWQSLAWAASLILVLMVLITTIIARW 287


>gi|78356107|ref|YP_387556.1| phosphate ABC transporter permease [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78218512|gb|ABB37861.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 297

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 129/244 (52%), Gaps = 9/244 (3%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ F            GI   ++G++ +    + ++ P G+ +AIYL E++  G F   +
Sbjct: 56  NWEFLTAHPRDAMTAGGIFPCILGTIALSYGSMLIALPWGVCTAIYLHEYARPGPFVHAM 115

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +  INNLA VPS+V+G+ G A  +   +M  S  L G   LA + LP II A+  ALR+V
Sbjct: 116 RLAINNLAGVPSVVFGLFGLAFFVTLMQMGVSL-LAGMFTLAALILPLIIGASEEALRSV 174

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
             + R A+L LGA+K QT+   VLP A P ILTG+ + + RA GETA ++F   + F   
Sbjct: 175 SQTYREASLALGATKWQTLAKVVLPAATPGILTGAILGIGRAAGETAAIMFTAAMFFSPK 234

Query: 366 YPVGVTDIATAFPVQIYLWAA-----DAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            P  V D   A P  IY+ A      +  RP     +G  L+L++ +  +N   + +R R
Sbjct: 235 LPGSVFDSVMALPYHIYVLATAGIDIEKTRPL---QYGTALVLIVLVLGMNLLAIIIRAR 291

Query: 421 FKKR 424
            +++
Sbjct: 292 LQRK 295


>gi|269103305|ref|ZP_06156002.1| phosphate transport system permease protein PstA [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163203|gb|EEZ41699.1| phosphate transport system permease protein PstA [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 545

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 138/259 (53%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++M+L++  +  PLG+ +A+YL E++ K  F+  ++  + NLA VPSIVY
Sbjct: 291 GGVFPAIFGTVFMVLLMSIIVTPLGVMAAVYLHEYAKKNAFTKVIRIAVINLAGVPSIVY 350

Query: 261 GILGSAVLIN---------FF--KMPRST-----ALVGGLILALMTLPSIIIATGVALRT 304
           G+ G    +          FF  ++P  T      L   L LA++TLP +I++T   L  
Sbjct: 351 GVFGLGFFVYMVGGTIDDLFFSAQLPTPTFGTPGVLWSALTLAILTLPVVIVSTEEGLAR 410

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S+R+ +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 411 IPNSVRNGSLALGATQSETLWRIVLPMASPAIMTGLILAVARAAGEVAPLMLVGVVKMAP 470

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+A   P        +A RP V   +    LL+  
Sbjct: 471 TLPVDLHFPYVHLDRKFMHLGYHIYDVAFQSP------NVEAARPLV---YATSFLLVTV 521

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N   + +RN  ++++
Sbjct: 522 IISLNLTAIGIRNYLREKY 540


>gi|91225170|ref|ZP_01260392.1| phosphate ABC transporter, permease protein [Vibrio alginolyticus
           12G01]
 gi|91190113|gb|EAS76384.1| phosphate ABC transporter, permease protein [Vibrio alginolyticus
           12G01]
          Length = 557

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  AV G+++++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAVFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   K+P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNVFYAEKLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|255658456|ref|ZP_05403865.1| phosphate ABC transporter, permease protein PstA [Mitsuokella
           multacida DSM 20544]
 gi|260849793|gb|EEX69800.1| phosphate ABC transporter, permease protein PstA [Mitsuokella
           multacida DSM 20544]
          Length = 283

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 127/229 (55%), Gaps = 18/229 (7%)

Query: 190 FINGASSRPEVAG-IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FI G SS     G +G  +  S YM+ + + +S P+ + + IYL E++ +   +  ++ +
Sbjct: 44  FILGKSSDIMAGGGVGSQLFNSFYMLFLSMAISIPIALGAGIYLAEYARENKLTKCIRLS 103

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           + +LA+VPSIV G+ G  + +N   M  S  L G L L L+ LP ++  T  ++RTVP S
Sbjct: 104 VESLATVPSIVLGLFGMIIFVNMMNMGFSI-LGGSLTLVLLNLPMLVRVTEESIRTVPKS 162

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF-----VGMVAFV 363
              A+L LGA+K+QT+F  VLP AMP I+TG T++  RALGETA L+F     V    F 
Sbjct: 163 YEEASLALGATKLQTIFKVVLPSAMPGIITGITLTAGRALGETAILIFTAGTTVSRHMFD 222

Query: 364 TDYPVGVTDIATAFPVQIYLW-----AADAERPFVERTFGAILLLLIFL 407
           TD   G   +A      ++LW         +R  +    GA+L+L+I +
Sbjct: 223 TDVMAGGETLA------VHLWYLMSTGLVPDRDAIANGIGALLILVILV 265


>gi|163751372|ref|ZP_02158598.1| phosphate ABC transporter, permease protein, putative [Shewanella
           benthica KT99]
 gi|161328781|gb|EDP99928.1| phosphate ABC transporter, permease protein, putative [Shewanella
           benthica KT99]
          Length = 550

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 136/255 (53%), Gaps = 35/255 (13%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++M++++  +  P G+ +A+YL E++ KG  +  ++  + NLA VPSIVY
Sbjct: 296 GGVFPAIFGTVFMVMLMAVIVTPFGVVAAVYLHEYAKKGPVTKMIRIAVINLAGVPSIVY 355

Query: 261 GILGSAVLINFF-----------KMPRST-----ALVGGLILALMTLPSIIIATGVALRT 304
           G+ G    +  F            +P  T      L   L LA++TLP +I++T   L  
Sbjct: 356 GVFGLGFFVYMFGGSIDQLFFPEALPAPTFGSPGVLWSALTLAILTLPVVIVSTEEGLSR 415

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R A+L LGA+K +T++  +LP+A PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 416 IPSSVRQASLALGATKAETLWRIILPMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAP 475

Query: 365 DYPVGVTDIATAFP----------VQIYLWAADAERPFVERT----FGAILLLLIFLAVI 410
             P+ +      FP          +  +++    + P VE      +    LL+  +  +
Sbjct: 476 TLPIDMN-----FPFVHLERKFMHLGFHIYDVGFQSPNVEAARPLVYATSFLLVTVIVSL 530

Query: 411 NTAMLWLRNRFKKRW 425
           N   + +RN  ++++
Sbjct: 531 NLTAIAVRNHLREKY 545


>gi|302130226|ref|ZP_07256216.1| phosphate ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. tomato NCPPB 1108]
          Length = 556

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 145/295 (49%), Gaps = 47/295 (15%)

Query: 90  RKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDS 149
           R  L  +  + +     L QA    S TAR              GKT+E+SL        
Sbjct: 222 RAELDARYKVIEGRLETLHQAFDRDSLTAR-----------DADGKTIEISLGKVV---- 266

Query: 150 ALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVG 209
               + Y P  +   +   + +FQKL           + F  +         GI  A+ G
Sbjct: 267 ----HAYQPNAMGTFTKLGF-YFQKL-----------WEFLSDDPREANTEGGIFPAIFG 310

Query: 210 SLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGI------- 262
           ++ M LI+ G+  P G+ +A+YL E++ +G  +  ++  +NNLA VP+IVYG+       
Sbjct: 311 TVMMTLIMAGVVAPFGVLAAVYLREYARQGLVTRLIRIAVNNLAGVPAIVYGVFGLGFFV 370

Query: 263 --LGSAVLINFFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRTVPSSIRSAA 313
             LG +V   FF   +P  T    GL+     LAL+ +P +I+AT   L  +P ++R  +
Sbjct: 371 YVLGGSVDRLFFPEALPAPTFGTPGLLWASLTLALLAVPVVIVATEEGLARIPLTLREGS 430

Query: 314 LGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V      PV
Sbjct: 431 LALGATKAETLWKIVLPMASPAMMTGLILAVARAAGEVAPLMLVGVVKLAPSLPV 485


>gi|329960795|ref|ZP_08299101.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           fluxus YIT 12057]
 gi|328532396|gb|EGF59197.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           fluxus YIT 12057]
          Length = 288

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 113/195 (57%), Gaps = 1/195 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F     S      GI  A+VG+  +M      +FP+G+ S IY+ E++ KG+    ++  
Sbjct: 48  FLTTAPSDGMTAGGILPAIVGTFCLMTGSALFAFPVGVMSGIYMNEYAPKGWVVRLIRMM 107

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
            NNL+ +PSIV+G+ G A+ +N+     S  L G L L L++LP +I  T  AL+ +P S
Sbjct: 108 TNNLSGIPSIVFGLFGMALFVNYMDFGDSI-LAGSLTLGLLSLPLVIRTTEEALKAIPDS 166

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+   P 
Sbjct: 167 LREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQLPS 226

Query: 369 GVTDIATAFPVQIYL 383
           G+ D   A P  +Y+
Sbjct: 227 GILDQCMALPYHLYV 241


>gi|269965141|ref|ZP_06179275.1| phosphate ABC transporter, permease protein [Vibrio alginolyticus
           40B]
 gi|269830127|gb|EEZ84354.1| phosphate ABC transporter, permease protein [Vibrio alginolyticus
           40B]
          Length = 557

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAIFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   K+P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNVFYAEKLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|163802445|ref|ZP_02196338.1| phosphate ABC transporter, permease protein [Vibrio sp. AND4]
 gi|159173746|gb|EDP58561.1| phosphate ABC transporter, permease protein [Vibrio sp. AND4]
          Length = 557

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 115/198 (58%), Gaps = 16/198 (8%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F   G        G+  A+ G++++++I+  +  PLG+ +AIYL E++     +  ++
Sbjct: 288 WKFLSEGPRESNSEGGVFPAIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKNNALTRMIR 347

Query: 247 ANINNLASVPSIVYGILG--------SAVLINFF---KMPRSTALVGGLI-----LALMT 290
             + NLA VPSIVYG+ G         A + N F   ++P  T    GL+     LA++T
Sbjct: 348 IAVINLAGVPSIVYGVFGLGFFVYTIGASIDNVFYAERLPAPTFGTPGLLWSALTLAVLT 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 408 LPVVIVTTEEGLTRIPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPV 368
            APL+ VG+V   +  PV
Sbjct: 468 VAPLMLVGVVKLASSLPV 485


>gi|254228688|ref|ZP_04922112.1| ABC-type phosphate transport system, auxiliary component [Vibrio
           sp. Ex25]
 gi|262395148|ref|YP_003287002.1| phosphate transport system permease PstA [Vibrio sp. Ex25]
 gi|151938867|gb|EDN57701.1| ABC-type phosphate transport system, auxiliary component [Vibrio
           sp. Ex25]
 gi|262338742|gb|ACY52537.1| phosphate transport system permease protein PstA [Vibrio sp. Ex25]
          Length = 557

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAIFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   K+P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNVFYAEKLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|77461834|ref|YP_351341.1| phosphate ABC transporter permease [Pseudomonas fluorescens Pf0-1]
 gi|77385837|gb|ABA77350.1| phosphate ABC transport system, membrane protein [Pseudomonas
           fluorescens Pf0-1]
          Length = 556

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 136/259 (52%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M LI+  +  P G+ +A+YL E++ +   +  ++  +NNLA VP+IVY
Sbjct: 302 GGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYAKQNTLTRVIRIAVNNLAGVPAIVY 361

Query: 261 GILGSAVLIN---------FFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G    +          FF   +P  T    GL+     LAL+ +P +I+AT   L  
Sbjct: 362 GVFGLGFFVYVLGGSLDRLFFPEALPAPTFGTPGLLWASLTLALLAVPVVIVATEEGLAR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 422 IPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLAP 481

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+    P        +A RP V   +   LLL++ 
Sbjct: 482 SLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSP------NVEAARPLV---YATALLLVLV 532

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +A +N + +++RN  ++++
Sbjct: 533 IATLNLSAVYIRNHLREKY 551


>gi|260903262|ref|ZP_05911657.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus AQ4037]
 gi|308107937|gb|EFO45477.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus AQ4037]
          Length = 557

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAIFGTVFLVLIMSIIVMPLGVVAAIYLHEYAKNNALTRIIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNVFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|28897349|ref|NP_796954.1| phosphate ABC transporter permease [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838054|ref|ZP_01990721.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio parahaemolyticus AQ3810]
 gi|260364505|ref|ZP_05777126.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus K5030]
 gi|260876311|ref|ZP_05888666.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260898582|ref|ZP_05907078.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus Peru-466]
 gi|28805561|dbj|BAC58838.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149748521|gb|EDM59380.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio parahaemolyticus AQ3810]
 gi|308086896|gb|EFO36591.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus Peru-466]
 gi|308092877|gb|EFO42572.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308114713|gb|EFO52253.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus K5030]
          Length = 557

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAIFGTVFLVLIMSIIVMPLGVVAAIYLHEYAKNNALTRIIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNVFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|257464210|ref|ZP_05628590.1| phosphate ABC transporter, inner membrane subunit PstA
           [Fusobacterium sp. D12]
 gi|317061731|ref|ZP_07926216.1| phosphate ABC transporter permease [Fusobacterium sp. D12]
 gi|313687407|gb|EFS24242.1| phosphate ABC transporter permease [Fusobacterium sp. D12]
          Length = 279

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 118/204 (57%), Gaps = 1/204 (0%)

Query: 220 LSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTA 279
           +S P G+ +AIYL E++ +  F+  ++  I NLA +PSI+YG+ G A+ +  F++  S  
Sbjct: 77  ISVPFGVLTAIYLVEYAKENTFTRLIELMILNLAGIPSIIYGLFGMALFVISFQLGVSM- 135

Query: 280 LVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG 339
           + G L LA+M LP +I AT  ALR +P  +R A+L LGA++ QT+    LP A P ILTG
Sbjct: 136 IAGSLTLAIMCLPVMITATKEALRAIPRELREASLALGATQWQTIQKITLPAAFPGILTG 195

Query: 340 STVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA 399
             +S++RA+GETAP++F  +  ++   P  + +     P  +++ +        E   G 
Sbjct: 196 VILSISRAVGETAPIMFTAVAFYLPFLPESIWEQVMTLPYHLFVISTQIPNMPREMMEGT 255

Query: 400 ILLLLIFLAVINTAMLWLRNRFKK 423
           + +L++     N    ++R+ ++K
Sbjct: 256 VFVLVLIAVGFNLLGAFVRHCYQK 279


>gi|91793934|ref|YP_563585.1| phosphate ABC transporter permease [Shewanella denitrificans OS217]
 gi|91715936|gb|ABE55862.1| Phosphate transport system permease protein 2 [Shewanella
           denitrificans OS217]
          Length = 552

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 102/345 (29%), Positives = 170/345 (49%), Gaps = 44/345 (12%)

Query: 48  IGALWQTHISLPIEFSETIVDPQKKRF------MDPAILLRADYNLLVRKALARKLSISD 101
           +GA+   HI+  +  +E  ++ QK         M+   L    Y L      A+K SI +
Sbjct: 157 LGAVLNEHIARSVAIAEEALELQKSDIGSINYRMERLRLKERKYELEGSLTEAKKASI-E 215

Query: 102 SNHALLRQASQMLSTTARYHLRKTLMTDPSLIG--KTVEVSLLASANIDSALKGYLYSPA 159
           +    L    Q+L     + LR     D  +I   +  EV L    N+D+ L     +  
Sbjct: 216 AEITQLNADYQVLEKRL-FALRDHASRDSVVIKDMRGEEVIL----NLDTVLD---VTYV 267

Query: 160 NVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIG 219
           N   M D    WF+ +            GF ++         G+  A+ G+++M++++  
Sbjct: 268 NDMTMMDKLGHWFKGVG-----------GFVVDDPREANTEGGVFPAIFGTVFMVMLMAV 316

Query: 220 LSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGI---------LGSAVLIN 270
           +  P G+ +AIYL E++ KG  +  ++  + NLA VPSIVYG+         LG ++   
Sbjct: 317 IVTPFGVIAAIYLHEYAKKGPITKMIRIAVINLAGVPSIVYGVFGLGFFVYMLGGSIDQL 376

Query: 271 FFK--MPRSTALVGGLI-----LALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQT 323
           F+   +P  T    G+I     LA++TLP +I++T   L  +PS++R  +L LGA+K +T
Sbjct: 377 FYPEALPAPTFGSPGVIWSALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAET 436

Query: 324 VFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           ++  V+P+A PAI+TG  +++ARA GE APL+ VG+V      P+
Sbjct: 437 LWRIVIPMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLPL 481


>gi|149195680|ref|ZP_01872737.1| Phosphate transport system permease protein 2 [Lentisphaera
           araneosa HTCC2155]
 gi|149141142|gb|EDM29538.1| Phosphate transport system permease protein 2 [Lentisphaera
           araneosa HTCC2155]
          Length = 551

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 89/257 (34%), Positives = 135/257 (52%), Gaps = 36/257 (14%)

Query: 201 AGIGVAVVGSLYMMLIV-IGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIV 259
            GI  A++G+L M +++ I ++F  G+ +AIYL E++     +  V+  INNLA VPSIV
Sbjct: 294 GGIFPAIIGTLVMTIVMCIPVTF-FGVITAIYLHEYAKDSLVTRAVRIAINNLAGVPSIV 352

Query: 260 YGILGSAVLINF------------FKMPRSTALVG-------GLILALMTLPSIIIATGV 300
           +G  G    I F            +K+     + G        L LALMTLP +I++T  
Sbjct: 353 FGAFGLGFFIYFIGSNIDDFFFKDWKLATGEPIFGTGGLLWASLTLALMTLPVVIVSTEE 412

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           AL +VP  +R  A+G GA+K Q+++  +LP A P I+TG  +++AR  GE APL+ VG+V
Sbjct: 413 ALSSVPHGLREGAMGCGATKWQSIWTVILPSATPGIITGMILAMARGAGEVAPLMLVGVV 472

Query: 361 AFVTDYPVGVT----DIATAF---PVQIY---LWAADAE--RPFVERTFGAILLLLIFLA 408
                 PV  T     I   F      IY     + D+E  +P V   +   L L++ + 
Sbjct: 473 KLAPSLPVNATYPFVHIDQKFMHLGFHIYDLGFQSPDSEAAKPMV---YATTLFLILTVT 529

Query: 409 VINTAMLWLRNRFKKRW 425
            +N A + +R R KKR+
Sbjct: 530 GLNLAGIIIRQRLKKRF 546


>gi|134299950|ref|YP_001113446.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfotomaculum reducens MI-1]
 gi|134052650|gb|ABO50621.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Desulfotomaculum reducens MI-1]
          Length = 282

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 132/243 (54%), Gaps = 5/243 (2%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            +  N+ F         +  GI   +V ++Y++LI + ++ P+GI ++I L E++ +G  
Sbjct: 42  LMHVNWTFLTEEPLFMGKEGGIFPTIVSTIYLILISLAIAVPIGIMASIQLTEYTQRGPL 101

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
              ++     LA +PSI++G+ G A L+ F     S  L GGL LA M LP+II  +  A
Sbjct: 102 VKVIRFATETLAGIPSIIFGLFGFAFLVIFMGFSWSL-LSGGLTLAFMVLPTIIRTSEEA 160

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +++VP S R  ++ LGA+K QTV+  VLP A+P I+TG  +S+ R +GETA ++     +
Sbjct: 161 IKSVPLSFREGSMALGATKWQTVWKIVLPSALPGIVTGIILSIGRVVGETAAVILTAGSS 220

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              + P  V D A +  V +Y+ A +     +E+ +    +L+I + +IN+   W+  R 
Sbjct: 221 L--NIPSSVMDPARSMSVHLYILAMEGIS--MEKAYATATVLIILIFLINSVANWIMRRM 276

Query: 422 KKR 424
              
Sbjct: 277 SSN 279


>gi|37678913|ref|NP_933522.1| ABC-type phosphate transport system, permease component [Vibrio
           vulnificus YJ016]
 gi|37197654|dbj|BAC93493.1| ABC-type phosphate transport system, permease component [Vibrio
           vulnificus YJ016]
          Length = 556

 Score =  123 bits (308), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++++LI+  +  PLG+ +AIYL E++    F+  ++  + NLA VPSIVY
Sbjct: 301 GGVFPAIFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNAFTRIIRIAVINLAGVPSIVY 360

Query: 261 GILGSAVLI--------NFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G    +        N F   ++P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 361 GVFGLGFFVYTIGSSIDNLFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 420

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 421 IPNSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 480

Query: 365 DYPV 368
             PV
Sbjct: 481 SLPV 484


>gi|323491602|ref|ZP_08096781.1| ABC transporter transmembrane protein [Vibrio brasiliensis LMG
           20546]
 gi|323314178|gb|EGA67263.1| ABC transporter transmembrane protein [Vibrio brasiliensis LMG
           20546]
          Length = 548

 Score =  123 bits (308), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 109/184 (59%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ ++LI+  +  PLG+ +AIYL E++    F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAMFGTVLLVLIMSVIVMPLGVIAAIYLHEYAKNNAFTRLIRVAVINLAGVPSIVY 352

Query: 261 GILGSAVLI--------NFFKMPRSTA--------LVGGLILALMTLPSIIIATGVALRT 304
           G+ G    +        N F   R  A        L   L LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTLGGSIDNLFYQERLPAPTFGTPGLLWSALTLAVLTLPVVIVATEEGLTR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 413 IPNSVRHGSLALGATQFETMWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGVVKLAS 472

Query: 365 DYPV 368
             PV
Sbjct: 473 SLPV 476


>gi|84385375|ref|ZP_00988407.1| phosphate ABC transporter, permease protein [Vibrio splendidus
           12B01]
 gi|84379972|gb|EAP96823.1| phosphate ABC transporter, permease protein [Vibrio splendidus
           12B01]
          Length = 287

 Score =  123 bits (308), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 150/282 (53%), Gaps = 19/282 (6%)

Query: 148 DSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAV 207
           D+ LKG++++ A V     +   W+  + S+G  ++D+N  F  +  +   E  GI   +
Sbjct: 14  DNVLKGFIWAAAAVTVGFLFWIIWY--ILSNGLQYVDWN--FITDDYTRTGEERGIFPMI 69

Query: 208 VGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF-FSSFVQANINNLASVPSIVYGILGSA 266
           + ++YM++  I ++ PLGI +AIYL E++  G      ++    +LA +PSI++G+ G  
Sbjct: 70  IATIYMVIASIAVAAPLGIMTAIYLTEYAKVGSKLVKVIRFCTESLAGIPSIIFGLFGMT 129

Query: 267 VLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFH 326
             ++   +  S  L G L L+++ LP II  T  AL +VP + R  + GLGASK+ T++ 
Sbjct: 130 FFVSILGLGFSI-LSGALTLSILILPVIIRTTEEALMSVPQTYREGSYGLGASKIYTIWR 188

Query: 327 HVLPLAMPAILTGSTVSLARALGETAPL-LFVGMVAFVTDYPVGVTDIATAFPVQIY--- 382
            +LP AMP ILT   +S+ R +GE+AP+ L  GMVA V   P  V D      V +Y   
Sbjct: 189 LILPSAMPGILTSVILSIGRVIGESAPVFLTAGMVARV---PESVFDSGRTLTVHLYKLT 245

Query: 383 --LWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             L+  D       + +G   +L++ + +IN     +  RF 
Sbjct: 246 TELFTIDEW----NQAYGTATVLIVLVLLINMVTKLIARRFN 283


>gi|27363929|ref|NP_759457.1| phosphate ABC transporter permease PstA [Vibrio vulnificus CMCP6]
 gi|320157311|ref|YP_004189690.1| phosphate transport system permease PstA [Vibrio vulnificus
           MO6-24/O]
 gi|27360046|gb|AAO08984.1| phosphate ABC transporter, permease protein PstA [Vibrio vulnificus
           CMCP6]
 gi|319932623|gb|ADV87487.1| phosphate transport system permease protein PstA [Vibrio vulnificus
           MO6-24/O]
          Length = 556

 Score =  123 bits (308), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++++LI+  +  PLG+ +AIYL E++    F+  ++  + NLA VPSIVY
Sbjct: 301 GGVFPAIFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNAFTRVIRIAVINLAGVPSIVY 360

Query: 261 GILGSAVLI--------NFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G    +        N F   ++P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 361 GVFGLGFFVYTIGSSIDNLFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 420

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 421 IPNSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 480

Query: 365 DYPV 368
             PV
Sbjct: 481 SLPV 484


>gi|189485397|ref|YP_001956338.1| ABC-type phosphate transporter permease component [uncultured
           Termite group 1 bacterium phylotype Rs-D17]
 gi|170287356|dbj|BAG13877.1| ABC-type phosphate transporter permease component [uncultured
           Termite group 1 bacterium phylotype Rs-D17]
          Length = 284

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 129/231 (55%), Gaps = 11/231 (4%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A++G+L ++   I ++ P+G+ +AIYL E++     +  ++  I NLA VPS+VY
Sbjct: 59  GGILPAILGTLLIVTCAIAITLPIGVFAAIYLNEYAKNNLLTRIIKLAIVNLAGVPSVVY 118

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G  + + F K+  S  + G L L++M LP II  +  AL +VP   R A+L LG S+
Sbjct: 119 GLFGLGIFVMFLKLGVSI-IAGALTLSIMELPVIITTSRNALNSVPYYFRDASLSLGVSR 177

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT+ + VLP A+  ILTG+ +S++R  GETAP+LF      V   P  V D     P  
Sbjct: 178 WQTIRYIVLPNAISGILTGAILSISRISGETAPILFTATAFSVPHLPRSVLDQVMTLPYH 237

Query: 381 IYLWAADAERPFVERTFGAILLLLI------FLAVINTAMLWLRNRFKKRW 425
           +Y+ +           FG  L+LL+      F+A++  A ++LR R  ++W
Sbjct: 238 LYIISTQIPNMPENVIFGTALVLLLMVLTMSFIAIV--ARIYLRKR--RKW 284


>gi|260776655|ref|ZP_05885550.1| phosphate transport system permease protein PstA [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607878|gb|EEX34143.1| phosphate transport system permease protein PstA [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 548

 Score =  122 bits (307), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 113/184 (61%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ ++LI+  +  PLG+ +AIYL E++    F+  ++  + NLA VPSIVY
Sbjct: 293 GGVFPAMFGTVLLVLIMSIIVMPLGVIAAIYLHEYAKNNAFTRLIRVAVINLAGVPSIVY 352

Query: 261 GI---------LGSAVLINFF--KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG ++   F+  K+P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 353 GVFGLGFFVYTLGGSIDSLFYAEKLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLTR 412

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +
Sbjct: 413 IPSSVRHGSLALGATQFETMWRIVLPMASPAIITGLILAVARAAGEVAPLMLVGAVKLAS 472

Query: 365 DYPV 368
             PV
Sbjct: 473 SLPV 476


>gi|209695876|ref|YP_002263806.1| phosphate import protein, transmembrane component PstA [Aliivibrio
           salmonicida LFI1238]
 gi|208009829|emb|CAQ80137.1| phosphate import protein, transmembrane component PstA [Aliivibrio
           salmonicida LFI1238]
          Length = 509

 Score =  122 bits (307), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 104/387 (26%), Positives = 174/387 (44%), Gaps = 58/387 (14%)

Query: 80  LLRADYNLLVRKALARKLSISDSNHALLRQASQM----LSTTARYHLRKTLMTDPSLIGK 135
           L R      V+   A+   +    H L +    +    LS  A     KTL  + + I  
Sbjct: 135 LTRQQVESWVKSEKAKIDLLEQEQHKLYKLLDDLPALNLSNDAFTQKEKTLTEELTSISN 194

Query: 136 TVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQK---LDSDGALFLDFNYGFFIN 192
            +  S L     DS  + YL S  NV  +      W+     L    + +++  Y F   
Sbjct: 195 QLTQSYLVLK--DSQNQSYLLSSDNVVNI------WYPNAMILSEQLSHWVNTLYDFLSE 246

Query: 193 GASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNL 252
                    G+  A+ G++ ++L++  +  PLG+ +AIYL E++     +  V+  + NL
Sbjct: 247 PPREANSEGGVFPAIFGTILLVLLMSIIVMPLGVIAAIYLHEYAKPNILTRLVRIAVINL 306

Query: 253 ASVPSIVYGILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIII 296
           A VPSIVYG+ G           +   F   ++P  T    GL+     LA++TLP +I+
Sbjct: 307 AGVPSIVYGVFGLGFFVYVVGGTIDQLFYSNQLPTPTFGTPGLLWSALTLAILTLPVVIV 366

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           AT   L  +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ 
Sbjct: 367 ATEEGLSRIPNSVRHGSLALGATQFETLWKIVLPMASPAIMTGLILAVARAAGEVAPLML 426

Query: 357 VGMVAFVTDYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFG 398
           VG+V      P+                   + D+    P        +A RP V   + 
Sbjct: 427 VGVVKLAPSLPIDSVAPYLHLDRKFMHLGYHIYDVGFQSP------NVEAARPIV---YA 477

Query: 399 AILLLLIFLAVINTAMLWLRNRFKKRW 425
              LL+  +  +N   + +RN  ++++
Sbjct: 478 TAFLLVTVIIGLNLTAIAIRNNLREKY 504


>gi|148974037|ref|ZP_01811570.1| ABC-type phosphate transport system, permease component
           [Vibrionales bacterium SWAT-3]
 gi|145965734|gb|EDK30982.1| ABC-type phosphate transport system, permease component
           [Vibrionales bacterium SWAT-3]
          Length = 290

 Score =  122 bits (307), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 93/284 (32%), Positives = 151/284 (53%), Gaps = 23/284 (8%)

Query: 148 DSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAV 207
           D+ LKG++++ A V     +   W+  + S+G  ++D+N  F  +  +   E  GI   +
Sbjct: 17  DNILKGFIWAAAAVTVGFLFWIIWY--ILSNGLQYVDWN--FITDDYTRTGEERGIFPMI 72

Query: 208 VGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA---NINNLASVPSIVYGILG 264
           + ++YM++  I ++ PLGI +AIYL E++  G  S  V+A      +LA +PSI++G+ G
Sbjct: 73  IATIYMVIASIAVAAPLGIMTAIYLTEYAKVG--SRLVKAIRFCTESLAGIPSIIFGLFG 130

Query: 265 SAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTV 324
               ++   +  S  L G L L+++ LP II  T  AL  VP + R  + GLGASK+ T+
Sbjct: 131 MTFFVSILGLGFSI-LSGALTLSILILPVIIRTTEEALMAVPQTYREGSYGLGASKIYTI 189

Query: 325 FHHVLPLAMPAILTGSTVSLARALGETAPL-LFVGMVAFVTDYPVGVTDIATAFPVQIY- 382
           +  +LP AMP ILT   +S+ R +GE+AP+ L  GMVA V   P  V D      V +Y 
Sbjct: 190 WRLILPSAMPGILTSVILSIGRVIGESAPVFLTAGMVARV---PESVFDSGRTLTVHLYK 246

Query: 383 ----LWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
               L+  D       + +G   +L++ + +IN     +  RF 
Sbjct: 247 LTTELFTIDEW----NQAYGTATVLIVLVLLINMVTKLIARRFN 286


>gi|268324465|emb|CBH38053.1| putative phosphate ABC transporter, permease protein [uncultured
           archaeon]
 gi|268324868|emb|CBH38456.1| putative phosphate transport system permease protein pstA
           [uncultured archaeon]
          Length = 281

 Score =  122 bits (307), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 80/229 (34%), Positives = 125/229 (54%), Gaps = 2/229 (0%)

Query: 197 RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVP 256
           R E  GI   ++GS+ ++ + +  + P+G+ASAIYL E++     +  V+  +  LA +P
Sbjct: 50  RFEYGGIFPQIIGSICLVAVCLIFAVPMGVASAIYLAEYASDNVITRTVRFFVECLAGIP 109

Query: 257 SIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
           SIV G+ G   L+ +  +     L GGL L  M LP  + A+  A++TVP + R A+L L
Sbjct: 110 SIVIGLFGLVFLVYYLDLGICL-LSGGLALGFMILPWTVRASEEAIKTVPPAYREASLAL 168

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATA 376
           G SK +T+   VL  A P I+TG  + + +A+GETA +L        +  P  + D   +
Sbjct: 169 GVSKWRTIRSVVLKSAYPGIITGILLGMGKAIGETAVVLLTAGSGLESFLPKSIFDPVAS 228

Query: 377 FPVQIYLWAADAERPFV-ERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            PV IY+ A          RTFGA L+L++   +I+   L LRNR+ +R
Sbjct: 229 LPVYIYMMATQGHTSAAYSRTFGASLVLIMMFFLISIFALLLRNRYIRR 277


>gi|269962443|ref|ZP_06176793.1| phosphate ABC transporter, permease protein [Vibrio harveyi 1DA3]
 gi|269832939|gb|EEZ87048.1| phosphate ABC transporter, permease protein [Vibrio harveyi 1DA3]
          Length = 557

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNLFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|313125581|ref|YP_004035845.1| phosphate ABC transporter membrane protein 2, phot family
           [Halogeometricum borinquense DSM 11551]
 gi|312291946|gb|ADQ66406.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Halogeometricum borinquense DSM 11551]
          Length = 546

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 126/211 (59%), Gaps = 13/211 (6%)

Query: 169 WKWFQKLDS----DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPL 224
           W +F  +D     +G L   F + F + G +   E+ GI  A+VG+++++   +  + PL
Sbjct: 262 WFYFPPIDKYVVIEGPLVW-FYWPFVMEGVALMTEINGIFPAIVGTVWVVFGAVVFAIPL 320

Query: 225 GIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG- 283
           G+ +A++L E++ +G+F+  V+ + + L S PSIVYG+ G A L+   ++  +T+L+ G 
Sbjct: 321 GVGAAVFLTEYAERGWFTKLVEISTDGLWSTPSIVYGLFGLAFLVP--RLGNTTSLLSGM 378

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L+L  M LP ++I +  AL++VP   R A+  LG  K +T+   VLP AMP ++TG+ + 
Sbjct: 379 LVLGFMMLPLVVITSREALKSVPDDYRDASAALGVGKWETIKSVVLPAAMPGVITGAILG 438

Query: 344 LARALGETAPLLFVGMVAFVTD-YPVGVTDI 373
           + R  GETAP+L V     V+D +P   TD+
Sbjct: 439 IGRIAGETAPILLV----MVSDPFPSRATDV 465


>gi|78484883|ref|YP_390808.1| phosphate ABC transporter permease [Thiomicrospira crunogena XCL-2]
 gi|78363169|gb|ABB41134.1| ATP-binding cassette (ABC) superfamily phosphate transporter,
           permease component [Thiomicrospira crunogena XCL-2]
          Length = 548

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 113/205 (55%), Gaps = 16/205 (7%)

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
             F D    F ++         G+  A++G++ M++++     P+G+ +AIY+ E++  G
Sbjct: 273 GFFFDSIGHFLLDEPREANTEGGVFPAIIGTITMVILMAIFVTPMGVIAAIYMSEYARDG 332

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINF-----------FKMPRST-----ALVGG 283
                V+ +INNLA VPSIV+GI G    +             + +P  T      L   
Sbjct: 333 LVLRTVRISINNLAGVPSIVFGIFGLGFFVYIIGGSIDELFYSYALPSPTFGTPALLWAS 392

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L +AL+TLP +I++T   L  +P ++R   L LGA+K +T+   VLP++MPAI+TG  ++
Sbjct: 393 LTMALLTLPVVIVSTQEGLSRIPRALREGGLALGATKSETIMKIVLPMSMPAIMTGLILA 452

Query: 344 LARALGETAPLLFVGMVAFVTDYPV 368
           +ARA GE APL+ VG+V    + P+
Sbjct: 453 VARAAGEVAPLMLVGVVKLAPELPI 477


>gi|90414595|ref|ZP_01222568.1| putative phosphate ABC transporter, permease protein
           [Photobacterium profundum 3TCK]
 gi|90324311|gb|EAS40880.1| putative phosphate ABC transporter, permease protein
           [Photobacterium profundum 3TCK]
          Length = 553

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 136/259 (52%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++M+L++  +  PLG+ +AIYL E++ K  F+  ++  + NLA VPSIVY
Sbjct: 299 GGVFPAIFGTVFMVLLMSIIVTPLGVMAAIYLHEYAGKNGFTKLIRVAVINLAGVPSIVY 358

Query: 261 GILGSAVLIN---------FF--KMPRST-----ALVGGLILALMTLPSIIIATGVALRT 304
           G+ G    +          FF  ++P  T      L   L LA++TLP +I++T   L  
Sbjct: 359 GVFGLGFFVYMVGGTIDDVFFSSQLPTPTFGTPGILWSALTLAILTLPVVIVSTEEGLAR 418

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 419 IPSSVRHGSLALGATQSETLWRIVLPMASPAIMTGLILAVARAAGEVAPLMLVGVVKMAP 478

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+    P        +A RP V   +    LL+  
Sbjct: 479 TLPVDGHFPYVHLDRKFMHLGYHIYDVGFQSP------NVEAARPLV---YATSFLLVTV 529

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N   + +RN  ++++
Sbjct: 530 IVGLNLTAIGIRNHLREKF 548


>gi|54307924|ref|YP_128944.1| putative phosphate ABC transporter, permease protein
           [Photobacterium profundum SS9]
 gi|46912350|emb|CAG19142.1| putative phosphate ABC transporter, permease protein
           [Photobacterium profundum SS9]
          Length = 553

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 136/259 (52%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++M+L++  +  PLG+ +AIYL E++ K  F+  ++  + NLA VPSIVY
Sbjct: 299 GGVFPAIFGTVFMVLLMSIIVTPLGVMAAIYLHEYAGKNGFTKLIRVAVINLAGVPSIVY 358

Query: 261 GILGSAVLIN---------FF--KMPRST-----ALVGGLILALMTLPSIIIATGVALRT 304
           G+ G    +          FF  ++P  T      L   L LA++TLP +I++T   L  
Sbjct: 359 GVFGLGFFVYMVGGTIDDVFFSSQLPTPTFGTPGILWSALTLAILTLPVVIVSTEEGLAR 418

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 419 IPSSVRHGSLALGATQSETLWRIVLPMASPAIMTGLILAVARAAGEVAPLMLVGVVKMAP 478

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             PV                   + D+    P        +A RP V   +    LL+  
Sbjct: 479 TLPVDGHFPYVHLDRKFMHLGYHIYDVGFQSP------NVEAARPLV---YATSFLLVTV 529

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N   + +RN  ++++
Sbjct: 530 IVGLNLTAIGIRNHLREKF 548


>gi|288573458|ref|ZP_06391815.1| phosphate ABC transporter, inner membrane subunit PstA
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288569199|gb|EFC90756.1| phosphate ABC transporter, inner membrane subunit PstA
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 282

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 122/211 (57%), Gaps = 7/211 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++G+L ++++ +  + P+G+A+ I+  E++ +G F++ ++  +  LA VPS+VY
Sbjct: 56  GGISTPIIGTLQLVIVSMVFAIPVGVATGIFFAEYATEGPFTTALRLCVRCLAGVPSVVY 115

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+ G ++ + F     S+ L  GL LA ++LP I+ A+  AL  VP   R A+  LGA+K
Sbjct: 116 GLFGLSLFVVFLNF-GSSLLSAGLTLACLSLPLIVTASETALLAVPQDFRLASYALGANK 174

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QTV   VLP A+P ILTG+ +S+ R  GETAP++F G   F       + D   A P  
Sbjct: 175 WQTVRKVVLPAALPTILTGAILSVGRVAGETAPIIFTGAAFFTPKVATSLFDEVMALPYH 234

Query: 381 IYLWAADAERPFVERT----FGAILLLLIFL 407
           I + A       +E+T    +G +L+L++ +
Sbjct: 235 IMVLATAGTH--IEQTRPIQYGTVLVLILLV 263


>gi|153834642|ref|ZP_01987309.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio harveyi HY01]
 gi|148868954|gb|EDL68008.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio harveyi HY01]
          Length = 557

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNLFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|167624745|ref|YP_001675039.1| phosphate ABC transporter inner membrane subunit PstA [Shewanella
           halifaxensis HAW-EB4]
 gi|167354767|gb|ABZ77380.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           halifaxensis HAW-EB4]
          Length = 550

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 135/255 (52%), Gaps = 35/255 (13%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G+++M++++  +  P G+ +AIYL E++ KG  +  ++  + NLA VPSIVY
Sbjct: 296 GGVFPAIFGTVFMVMLMAVIVMPFGVIAAIYLHEYAKKGPVTKMIRIAVINLAGVPSIVY 355

Query: 261 GILGSAVLINFF-----------KMPRST-----ALVGGLILALMTLPSIIIATGVALRT 304
           G+ G    +  F            +P  T      L   L LA++TLP +I++T   L  
Sbjct: 356 GVFGLGFFVYMFGGTLDQLFYPEALPTPTFGSPGVLWSALTLAILTLPVVIVSTEEGLSR 415

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA+K +T++  ++P+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 416 IPSSVRQGSLALGATKAETLWRIIIPMASPAMMTGLILAVARAAGEVAPLMLVGVVKLAP 475

Query: 365 DYPVGVTDIATAFP----------VQIYLWAADAERPFVERT----FGAILLLLIFLAVI 410
             P+ +      FP          +  +++    + P VE      +    LL+  +  +
Sbjct: 476 TLPIDMN-----FPFVHLERKFMHLGFHIYDVGFQSPNVEAARPLVYATSFLLVSVIVAL 530

Query: 411 NTAMLWLRNRFKKRW 425
           N   + +RN  ++++
Sbjct: 531 NLTAIGVRNHLREKY 545


>gi|323499848|ref|ZP_08104807.1| ABC transporter transmembrane protein [Vibrio sinaloensis DSM
           21326]
 gi|323315089|gb|EGA68141.1| ABC transporter transmembrane protein [Vibrio sinaloensis DSM
           21326]
          Length = 547

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 114/184 (61%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M+LI+  +  PLG+ +A+YL E++    F+  ++  + NLA VPSIVY
Sbjct: 292 GGVFPAMFGTVLMVLIMSIVVMPLGVIAAVYLHEYAKNNAFTRMIRVAVINLAGVPSIVY 351

Query: 261 GI---------LGSAVLINFF--KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+         LG ++   F+  ++P  T    GL+     LA++TLP +I+AT   L  
Sbjct: 352 GVFGLGFFVYTLGGSIDALFYTERLPAPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSR 411

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 412 IPSSVRHGSLALGATQFETMWRIVLPMASPAIITGLILAVARAAGEVAPLMLVGVVKLAS 471

Query: 365 DYPV 368
             PV
Sbjct: 472 TLPV 475


>gi|262276584|ref|ZP_06054393.1| phosphate transport system permease protein PstA [Grimontia
           hollisae CIP 101886]
 gi|262220392|gb|EEY71708.1| phosphate transport system permease protein PstA [Grimontia
           hollisae CIP 101886]
          Length = 531

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 135/259 (52%), Gaps = 43/259 (16%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++ M+L++  +  PLG+ +A+YL E++ K  F+  ++  + NLA VPSIVY
Sbjct: 275 GGVFPAIFGTVLMVLLMSVMVTPLGVLAAVYLHEYAGKNTFTRIIRIAVVNLAGVPSIVY 334

Query: 261 GILGSAVLINFF-----------KMPRSTALVGG-----LILALMTLPSIIIATGVALRT 304
           G+ G    + F             +P  T    G     L LA++TLP +I++T   L  
Sbjct: 335 GVFGLGFFVYFVGGSIDSLFYSDALPNPTFGTPGILWSSLTLAILTLPVVIVSTEEGLAR 394

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P+S+R  ++ LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V    
Sbjct: 395 IPTSVRHGSMALGATQAETLWRIVLPMASPAIMTGLILAIARAAGEVAPLMLVGVVKVAP 454

Query: 365 DYPVG------------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
             P+                   V D+    P        +A RP V   +   LLL+  
Sbjct: 455 ALPLDANFPFLHLDRKFMHLGYHVYDVGFQSP------NIEAARPLV---YATSLLLVTV 505

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N A + +RN  ++++
Sbjct: 506 IVSLNLAAITIRNHLREKY 524


>gi|156973345|ref|YP_001444252.1| hypothetical protein VIBHAR_01032 [Vibrio harveyi ATCC BAA-1116]
 gi|156524939|gb|ABU70025.1| hypothetical protein VIBHAR_01032 [Vibrio harveyi ATCC BAA-1116]
          Length = 557

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 112/184 (60%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            G+  A+ G++++++I+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVY
Sbjct: 302 GGVFPAIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVY 361

Query: 261 GILG--------SAVLINFF---KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G         A + N F   ++P  T    GL+     LA++TLP +I+ T   L  
Sbjct: 362 GVFGLGFFVYTIGASIDNLFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTR 421

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +
Sbjct: 422 IPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLAS 481

Query: 365 DYPV 368
             PV
Sbjct: 482 SLPV 485


>gi|292492327|ref|YP_003527766.1| phosphate ABC transporter inner membrane subunit PstA
           [Nitrosococcus halophilus Nc4]
 gi|291580922|gb|ADE15379.1| phosphate ABC transporter, inner membrane subunit PstA
           [Nitrosococcus halophilus Nc4]
          Length = 550

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 108/184 (58%), Gaps = 16/184 (8%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI  A+ G++ M+LI+  +  P G+ +A+YL E++ +G     ++  +NNLA VPSIVY
Sbjct: 296 GGIFPAIFGTVMMVLIMSVIVTPFGVVAAVYLREYAKQGPLIRIIRIAVNNLAGVPSIVY 355

Query: 261 GILGSAVLINFF-----------KMPRSTALVGGLI-----LALMTLPSIIIATGVALRT 304
           G+ G    + F             +P  T    GL+     LA++T+P +I+AT   L  
Sbjct: 356 GVFGLGFFVYFLGGNVDRWFFPEALPAPTFGTPGLLWASLTLAILTVPVVIVATEEGLSR 415

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P SIR  +L LGA++ +T++  VLP+A PA++TG  +++ARA GE APL+ VG+V    
Sbjct: 416 IPRSIREGSLALGATRAETLWRTVLPMAAPAMMTGLILAVARAAGEVAPLMMVGVVKLAP 475

Query: 365 DYPV 368
             P+
Sbjct: 476 SLPL 479


>gi|90409161|ref|ZP_01217278.1| phosphate ABC transporter, permease protein, putative [Psychromonas
           sp. CNPT3]
 gi|90309733|gb|EAS37901.1| phosphate ABC transporter, permease protein, putative [Psychromonas
           sp. CNPT3]
          Length = 548

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositi