BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780705|ref|YP_003065118.1| phosphate ABC transporter,
permease protein PstA [Candidatus Liberibacter asiaticus str. psy62]
         (425 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254448603|ref|ZP_05062062.1| phosphate ABC transporter, permease protein PstA [gamma
           proteobacterium HTCC5015]
 gi|198261792|gb|EDY86078.1| phosphate ABC transporter, permease protein PstA [gamma
           proteobacterium HTCC5015]
          Length = 426

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 190/426 (44%), Positives = 283/426 (66%), Gaps = 5/426 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +S S  + +L  RY  E  FRFY +++V V F FL++L +SI+SKG  A  QT+I L + 
Sbjct: 4   QSMSKVEAHLARRYAREKRFRFYGLLSVFVGFAFLVVLFTSIISKGYTAFQQTYIQLDVT 63

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           +   I+          +  L A+Y+ L++ AL  +     ++ +  R+  +++S+ A++ 
Sbjct: 64  YDADILGLYDNPT--ESDWLYANYDGLIKAALRERFP-EVTSRSEKRELYKLVSSGAKFS 120

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           +R +L  +  L+G T  + +LA  ++DS LKG++    P    R+ D    W   L  +G
Sbjct: 121 VRDSLDNNEELLGTTATLWVLADDDLDSVLKGHIDRTLPEADRRVKDQHLVWIDSLVENG 180

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN  FF + AS+ PE AG+  A+ GS + +++ + LSFP+G+A+A+YLEEF+ + 
Sbjct: 181 EVEKRFNTVFFTHSASAEPEQAGVWGAIKGSFFTLIVTLVLSFPVGVAAAVYLEEFAPQN 240

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++  ++ NINNLA+VPSIV+G+LG AV +NF  +PRS  LVGGL+L LMTLP+III++ 
Sbjct: 241 RWTDLIEVNINNLAAVPSIVFGLLGLAVFLNFMGLPRSAPLVGGLVLTLMTLPTIIISSR 300

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL+ VP SIR AALG+GAS++QT+FHHVLPLAMP +LTG+ + +A+ALGE+APLL +GM
Sbjct: 301 AALKAVPPSIREAALGMGASRMQTIFHHVLPLAMPGMLTGTIIGMAQALGESAPLLMIGM 360

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAFV + P G+TD AT  PVQI+ WA   ER FVERT  AI++LL FL  +N   ++LR 
Sbjct: 361 VAFVAEVPQGITDPATVLPVQIFQWADLPERGFVERTSAAIMVLLAFLIAMNAFAVYLRK 420

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 421 RFERRW 426


>gi|53804609|ref|YP_113548.1| phosphate ABC transporter permease PstA [Methylococcus capsulatus
           str. Bath]
 gi|53758370|gb|AAU92661.1| phosphate ABC transporter, permease protein PstA [Methylococcus
           capsulatus str. Bath]
          Length = 434

 Score =  396 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 273/426 (64%), Gaps = 5/426 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++  I K +L  R+ +E  FR Y ++++    + L++LL SI  +G  A  QT++ L + 
Sbjct: 12  RTADIVKASLGRRHAAERRFRLYGLMSIGAGILMLVILLVSIFGQGYRAFSQTYVGLDVS 71

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           F   ++DP   R   P  L  ADY  L+++AL        +     R   +++S  A Y 
Sbjct: 72  FDPAVIDPDGGR--SPEALASADYGALLKRALGELFP-DVTERQDKRALHRLISAGASYA 128

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDG 179
           +R  ++  P L+G +  + + A A++D   KGY          RM D +  W  +L ++G
Sbjct: 129 VRDEILAHPELVGHSARIWVAAGADVDLLEKGYFDRSAAEAERRMKDRELAWVDRLKAEG 188

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            L   FN  FF  G S  PE AGIG A++GS Y +L+ + LS P+G+A+AIYLEEF+ + 
Sbjct: 189 RLERRFNAKFFTAGDSRDPEQAGIGGALMGSFYTVLVTLVLSLPIGVAAAIYLEEFAPRN 248

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            +  F++ NINNLA+VPSIV+G+LG AV INF  +PRS+ LVGGL+L LMTLP IIIA  
Sbjct: 249 HWVDFIEVNINNLAAVPSIVFGLLGLAVFINFLGVPRSSPLVGGLVLTLMTLPVIIIAAR 308

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL+ VP SIR AA+G+GAS +QTVFHHV+PLAMP +LTG+ + ++RALGE+APLL +GM
Sbjct: 309 SALKAVPPSIREAAMGVGASPMQTVFHHVVPLAMPGMLTGAIIGMSRALGESAPLLMIGM 368

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P G+ D AT  PVQ+YLWA   ER FVERT  AIL+LL FL ++N   ++LR 
Sbjct: 369 VAFIVDIPHGIFDPATVLPVQVYLWADSPERGFVERTSAAILVLLAFLILMNGTAVYLRR 428

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 429 RFERRW 434


>gi|163797107|ref|ZP_02191062.1| phosphate ABC transporter, permease protein PstA [alpha
           proteobacterium BAL199]
 gi|159177623|gb|EDP62176.1| phosphate ABC transporter, permease protein PstA [alpha
           proteobacterium BAL199]
          Length = 444

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 203/418 (48%), Positives = 277/418 (66%), Gaps = 3/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
           +L+ RY +E  FR Y + ++ V  + L+LL+ SI  KG  A WQT++ + + FSE +++P
Sbjct: 28  HLRRRYAAERRFRLYGLASIAVAGLMLLLLVGSIWQKGHSAFWQTYVEITVTFSEGVLNP 87

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
                +D   L RADY  LVR AL  +   +  +  L RQ   ++ST A + LR+ ++ D
Sbjct: 88  DGGP-VDHHELERADYLSLVRDALKEQFPEATGDRRLRRQLYGIVSTNADFALRRMVLDD 146

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSL+G+   V +  S ++DS  KG++    P +  R+SD +  W+  LD  G +   FN 
Sbjct: 147 PSLVGQRRPVWVKLSDDLDSLAKGHIRRDLPESDRRVSDIELGWYDVLDKAGRIESRFNV 206

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
             F  G S  P  AGI  A++GS+  M I + +SFP+G+ +A+YLEEF+ +   +  ++ 
Sbjct: 207 DLFTAGDSREPVEAGIYGALIGSILTMTITLLVSFPVGVMAAVYLEEFAPRNRLTDVIEV 266

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV +NFF +PRS  LVGGL+LALMTLP+IIIA+  AL+ VP 
Sbjct: 267 NINNLAAVPSIVFGLLGLAVFLNFFGLPRSAPLVGGLVLALMTLPTIIIASRSALKAVPP 326

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AA GLGAS +Q V HHVLPLAMP ILTG+ + +A+ALGETAPLL +GMVAF+ D P
Sbjct: 327 SIREAAFGLGASPLQVVTHHVLPLAMPGILTGTIIGMAQALGETAPLLMIGMVAFIVDIP 386

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            G TD AT  PVQIYLWA   ER FVERT  AIL+LL FL ++N   + LR RF++RW
Sbjct: 387 QGFTDPATVLPVQIYLWADSPERAFVERTSAAILVLLGFLVLMNAVAVLLRKRFERRW 444


>gi|224367299|ref|YP_002601462.1| PstA1 [Desulfobacterium autotrophicum HRM2]
 gi|223690015|gb|ACN13298.1| PstA1 [Desulfobacterium autotrophicum HRM2]
          Length = 425

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 184/426 (43%), Positives = 265/426 (62%), Gaps = 11/426 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++  I  + L+ RY +E  FR Y + A+++  + L +L  SIV+ G  A  QT+I++ + 
Sbjct: 9   RTMDIVNQGLEKRYGAEKRFRRYGLCAIILSLLCLGVLFVSIVANGYTAFQQTYINIDVF 68

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
                +D           L  ADY  +V+K+L              ++   M+S+ A Y 
Sbjct: 69  LDPGEIDESN--------LATADYQGMVKKSLREMFP-QVKERREKKKLYSMVSSGASYD 119

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           L   +   P  IG T+ + + A  + D  +KG++    P    R++D Q  W   L    
Sbjct: 120 LLNYVRKHPEGIGGTISLWVPADDDTDMFMKGHIRRDVPEGDRRLNDAQITWIDTLVEKN 179

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN  FF  G S  PE+AGI  A  GS + +L+ + LSFP+G+ASA+YLEEF+   
Sbjct: 180 RIKKRFNKTFFTAGDSREPELAGIWGAACGSFFTLLVTLILSFPIGVASAVYLEEFAPTN 239

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++ F++ NINNLA+VPSIV+G+LG AV +NFF +PRS+ +VGG +L LMTLP+IIIA  
Sbjct: 240 RWTDFIEVNINNLAAVPSIVFGLLGLAVFLNFFGLPRSSPMVGGFVLTLMTLPTIIIAGR 299

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L++VP SIR AALG+GASK+Q V HHVLPLAMP +LTG+ + +A+ALGETAPLL +GM
Sbjct: 300 ASLKSVPPSIREAALGVGASKIQMVTHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGM 359

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P G +D +T  PVQI+LWA   ER F+ERT  AI++LL+FL  +N A + LR 
Sbjct: 360 VAFIVDIPGGFSDPSTVLPVQIFLWADSPERAFLERTSAAIMVLLLFLITMNAAAVILRK 419

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 420 KFERRW 425


>gi|241202934|ref|YP_002974030.1| phosphate ABC transporter membrane protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240856824|gb|ACS54491.1| phosphate ABC transporter, inner membrane subunit PstA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 440

 Score =  391 bits (1005), Expect = e-107,   Method: Composition-based stats.
 Identities = 228/418 (54%), Positives = 305/418 (72%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEFSE  +DP
Sbjct: 23  GIKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L+ A+Y +L+R A+ ++L+++ ++   +R AS MLS  A   LR  ++ D
Sbjct: 83  NNKRATDPSVLIAANYPVLLRDAIVKQLNVNAASRPDVRDASAMLSKGAPVQLRDMVVAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IGKTV V++LA AN+DSA KG +         +++D Q  W  +L + GAL   FN 
Sbjct: 143 PSIIGKTVNVTVLADANVDSANKGQIDLSVDEKNRKVNDKQVGWMNELKASGALHKQFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+NG SSRPE AG+GVA++GSLY+MLIV+ L+ P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GLFVNGNSSRPEAAGLGVALIGSLYLMLIVLVLALPIGVAASIYLEEFAPKNKLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P
Sbjct: 323 SIRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 383 TTPLDPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|117924838|ref|YP_865455.1| phosphate ABC transporter inner membrane subunit PstA
           [Magnetococcus sp. MC-1]
 gi|117608594|gb|ABK44049.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Magnetococcus sp. MC-1]
          Length = 432

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 197/417 (47%), Positives = 266/417 (63%), Gaps = 4/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           LK R  SE  FR   +  ++V    L++LL++++  G+ A  QT I L I F E ++DP+
Sbjct: 18  LKKRRASETRFRLLGISGIVVALAALVILLTTMLGNGLTAFQQTQIKLKIHFDEQVIDPE 77

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            KR  DP +L  ADY  L    L        S          ++S++A+Y LR  ++  P
Sbjct: 78  GKR--DPKVLSHADYRKLYTNGLYALFPDVKSRRDKSELRKTLISSSAQYALRDVVLEQP 135

Query: 131 SLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
            L+G T E+ L+AS ++D  LKGY     P +   + D    W ++L  +G +   FN  
Sbjct: 136 ELVGTTRELWLVASDDVDMYLKGYFTKDVPESDRPIKDITISWIEQLQHEGRIDKKFNRD 195

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF NG+S  PE AGI  A+VGS   +L+    SFP+G+A+A+YLEEF+ K  ++  ++ N
Sbjct: 196 FFTNGSSQDPEQAGILGALVGSGLTLLVTFLASFPVGLATAVYLEEFAPKNGWTDLIEVN 255

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIV+G+LG AV +N   MPRS  +VGGL LALMTLP+IIIAT  AL+ VP S
Sbjct: 256 INNLAAVPSIVFGLLGLAVFLNVMHMPRSAPVVGGLTLALMTLPTIIIATRAALKAVPPS 315

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R AA GLGAS +Q V HHV+PLAMP ILTG+ + +A+ALGETAPLL +GMVAF+ D P 
Sbjct: 316 LRDAARGLGASPLQVVLHHVVPLAMPGILTGTIIGMAQALGETAPLLMIGMVAFLVDIPH 375

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
             TD AT  PVQIYLWA  AER FVE+T  A L+LL FL ++N   + LR +F++RW
Sbjct: 376 SATDAATVMPVQIYLWADSAERGFVEKTAAATLVLLGFLVLMNLLAVLLRKKFERRW 432


>gi|301063526|ref|ZP_07204058.1| phosphate ABC transporter, permease protein PstA [delta
           proteobacterium NaphS2]
 gi|300442465|gb|EFK06698.1| phosphate ABC transporter, permease protein PstA [delta
           proteobacterium NaphS2]
          Length = 422

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 198/426 (46%), Positives = 276/426 (64%), Gaps = 11/426 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++  I K+ L  RY SE  F+ Y + A+LV  +FL LL  SI+  G  A ++T + L I 
Sbjct: 6   RTIDIVKRGLNKRYRSEKRFKIYGLSAILVSIIFLALLFISIIGTGYSAFFRTVVKLDIT 65

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           F    +            L  A+Y+ LV+K+L      +  +    RQ   ++S+ A + 
Sbjct: 66  FDPESI--------SKETLSTANYSGLVKKSLRGLFP-NVEDRREKRQLYGLVSSGAAFQ 116

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           LR+  M DP +IGKTV V + A+ ++D  +KG +    P +  R++D Q  W  KL  + 
Sbjct: 117 LRRLAMADPGVIGKTVSVWVPANDDVDMLMKGQMERNVPQSERRLTDKQLTWIDKLSGED 176

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            L   FN  FF  G S  PE+AGI  AV+GS Y +++ + LSFP+G+++A+YLEEF+ K 
Sbjct: 177 RLEKRFNTAFFTGGDSREPELAGIWGAVMGSFYTLVVTLLLSFPIGVSAAVYLEEFAPKN 236

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++  ++ NINNLA+VPSIV+G+LG AV +NFF +PRST LVGGL+L LMTLP+IIIA+ 
Sbjct: 237 KWTDLIEVNINNLAAVPSIVFGLLGLAVFLNFFGLPRSTPLVGGLVLTLMTLPTIIIASR 296

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L++VP SIR AALG+GASK Q V HHVLPLAMP ++TG+ + +A+ALGETAPLL +GM
Sbjct: 297 ASLKSVPPSIRDAALGIGASKTQMVSHHVLPLAMPGMMTGTIIGMAQALGETAPLLMIGM 356

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P G TD AT  PVQIYLWA   ER F   T  AI++LL FL  +N+A + LR 
Sbjct: 357 VAFIVDVPHGFTDPATVLPVQIYLWADSPERAFTALTSAAIMVLLAFLIFMNSAAVLLRK 416

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 417 KFERRW 422


>gi|116250316|ref|YP_766154.1| transmembrane component of ABC transporter [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115254964|emb|CAK06038.1| putative transmembrane component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 440

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 227/418 (54%), Positives = 305/418 (72%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEF E  +DP
Sbjct: 23  GIKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFVEKTIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L+ A+Y +L+R A+ ++L+++ S+   +R A+ MLS +A   LR  +M D
Sbjct: 83  NNKRATDPSVLIAANYPVLLRDAIVKQLNVNASSRPDVRDATAMLSKSAPIQLRDMVMAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IGKT+ V++LA AN+DSA KG +         +++D Q  W  +L + GAL   FN 
Sbjct: 143 PSIIGKTINVTVLADANVDSANKGQIDLSVDEKNRKVNDKQVGWMNELKASGALHKQFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+NG SSRPE AG+GVA++GSLY+MLIV+ L+ P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GLFVNGNSSRPEAAGLGVALIGSLYLMLIVLVLALPIGVAASIYLEEFAPKNKLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P
Sbjct: 323 SIRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 383 TTPLDPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|209547779|ref|YP_002279696.1| phosphate ABC transporter inner membrane subunit PstA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533535|gb|ACI53470.1| phosphate ABC transporter, inner membrane subunit PstA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 440

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 229/418 (54%), Positives = 305/418 (72%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y + A+    +FL +LL +++ KG  A  QT I+LPIEF+E  +DP
Sbjct: 23  GIKRRYAAERRFQAYGIAAIAFGLIFLFILLWTVIGKGYTAFQQTAITLPIEFTEKAIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R AS MLS  A   LR  ++ D
Sbjct: 83  SNKRATDPSVLIAANYPVLLRDAIVKQLNINASSKPDVRDASAMLSKGAPIQLRDMVVAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIGKTV V++LA AN+DSA KG +         +++D Q  W  +L + GAL   FN 
Sbjct: 143 PSLIGKTVNVTVLADANVDSANKGQIDLTVDEKNRKVNDKQVGWMNELKASGALHKQFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+NG SSRPE AG+GVA++GSLY+MLIV+ L+ P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GLFVNGNSSRPEAAGLGVALIGSLYLMLIVLVLALPIGVAASIYLEEFAPKNRLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLSVFINFVGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P
Sbjct: 323 SIRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 383 TTPLDPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|218673762|ref|ZP_03523431.1| phosphate ABC transporter, permease protein [Rhizobium etli GR56]
          Length = 439

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 229/418 (54%), Positives = 304/418 (72%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEF+E  +DP
Sbjct: 22  GIKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFTEKTIDP 81

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L+ A+Y +L+R A+ ++L+I+ ++   +R A+ MLS +A   LR  ++ D
Sbjct: 82  DNKRATDPSVLVAANYPVLLRDAIVKQLNINAASRPDVRDATAMLSKSAPIQLRDMVVAD 141

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIGKTV VSLLA AN+DSA KG +         +++D Q  W  +L + GAL   FN 
Sbjct: 142 PSLIGKTVNVSLLADANVDSANKGQIDLSVDEKNRKVNDKQVTWMNQLKASGALHKQFNT 201

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+ G SSRPE AG+GVA+VGS Y+MLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 202 GLFVKGNSSRPEAAGLGVALVGSFYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEV 261

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 262 NINNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 321

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P
Sbjct: 322 SIRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAP 381

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               + +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 382 TTPLEPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 439


>gi|90418938|ref|ZP_01226849.1| permease protein, ABC-type phosphate transporter [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337018|gb|EAS50723.1| permease protein, ABC-type phosphate transporter [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 439

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 220/418 (52%), Positives = 293/418 (70%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y +VA+ +   FL+ LL S+VSKG  A WQT I +P+ FSE ++  
Sbjct: 22  GIKRRYRAERRFKIYGIVAIAIGLFFLVALLWSVVSKGYTAFWQTEIQVPVTFSEEVIGS 81

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
           ++    +P  L+ A+Y  L R  L + L +   + A +++  +++S+  R  LR  ++ D
Sbjct: 82  RQDALDNPTKLMMANYPTLARDGLVQMLGVDAEDRAAVKEVGKLISSGVRVQLRDMVLND 141

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IG T ++ L A + +DSALKG            +SD Q  W  +L   GA+   FN+
Sbjct: 142 PSIIGTTQDIWLYAGSELDSALKGQYDLTVAEGRRPISDRQLGWIDRLQESGAIEKRFNW 201

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSR E AG+GVA+VGSLYMM IV+ L+ P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 202 GLFTFGASSRAETAGVGVAIVGSLYMMGIVLVLALPIGVAASIYLEEFAPKNRFTDLIEV 261

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV IN+F +PRS ALVGGL+L LMTLP+IIIAT  AL+ VP 
Sbjct: 262 NINNLAAVPSIVFGLLGLAVFINWFGLPRSAALVGGLVLTLMTLPTIIIATRAALKAVPP 321

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK+Q VF HVLPLAMP ILTG+ + LA+ALGETAPLL +GMVAFV DYP
Sbjct: 322 SIRSAALGLGASKMQMVFQHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMVAFVADYP 381

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQI++WA +AER FVERT GAI++LL FLAV+N   + LR RF++RW
Sbjct: 382 SSPMDASTALPVQIFMWANEAERAFVERTSGAIMILLAFLAVMNITAILLRRRFERRW 439


>gi|227820731|ref|YP_002824701.1| phosphate ABC transporter, permease protein [Sinorhizobium fredii
           NGR234]
 gi|227339730|gb|ACP23948.1| phosphate ABC transporter, permease protein [Sinorhizobium fredii
           NGR234]
          Length = 440

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 236/418 (56%), Positives = 300/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  FR Y + A+ +   FL +LL S+ SKG  A  QT I+LPIEFSE ++DP
Sbjct: 23  GIKRRYAAERRFRAYGISAIAIGLFFLAVLLWSVASKGYTAFQQTTITLPIEFSEKVIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
           + +R  DP  L+ A+Y +LVR AL ++L I      L++QA+ M+S + R  LR  +  D
Sbjct: 83  KNERATDPKQLMTANYPVLVRDALVKQLGIDPKKRPLVKQATDMVSDSVRTQLRDIVTGD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IGKT+ V+LLA ANIDSA KG +      +  ++ D Q  W  +L   G L   FN 
Sbjct: 143 PSVIGKTIPVTLLADANIDSAFKGQIDLSVEESKRKVKDQQVTWMNELAEAGVLKKSFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE AG+GVA+VGS YMMLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GIFSFGASSRPEAAGVGVALVGSAYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG AV +NF  MPRS ALVGG +L LMTLP+IIIAT  AL+ VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLAVFVNFAGMPRSAALVGGFVLTLMTLPTIIIATRAALKAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK+QT+FHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV DYP
Sbjct: 323 SIRSAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVVDYP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               + +TA PVQIY+WA +AER FVERT GAI++LLIFL ++N   + LR RF++RW
Sbjct: 383 GSPLEPSTALPVQIYMWANEAERAFVERTSGAIIILLIFLIIMNLGAILLRRRFERRW 440


>gi|189500176|ref|YP_001959646.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides BS1]
 gi|189495617|gb|ACE04165.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides BS1]
          Length = 436

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 195/427 (45%), Positives = 276/427 (64%), Gaps = 11/427 (2%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           +K+  I  K LK RY  E  FR Y ++++L    FL  LL+SIV  G  A  QT+I L +
Sbjct: 19  IKAIDIVNKGLKRRYRKEKRFRLYGMLSILASVAFLAFLLTSIVFNGYSAFLQTYIKLDV 78

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
                ++D Q+          R+D+  +++ A+        +     R+   + S+ A +
Sbjct: 79  PLEAGMIDKQEPG--------RSDFQGIIKSAIRSYYP-EVTERQDKRELYALFSSGAAF 129

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSD 178
            LR T++++P   G T+ + +LA  ++D  +KG++    P    R++D Q +W ++L++D
Sbjct: 130 QLRDTVLSNPPEEGTTLSLWVLADDDVDMLMKGHMKRDVPEGSRRLNDKQLRWIERLEAD 189

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
             +   FN  FF  G S  PE+AGI  AV GS+Y ML+ + LSFP+GI +A+YLEEF+ K
Sbjct: 190 KRVEKRFNTTFFSAGDSREPELAGIWGAVKGSIYTMLVTLALSFPIGICAAVYLEEFAPK 249

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
              + F++ NINNLA+VPSIV+G+LG AV +NFF MPRST LVGG++L LMTLP+IIIA+
Sbjct: 250 NLATDFIEVNINNLAAVPSIVFGLLGLAVFLNFFGMPRSTPLVGGIVLMLMTLPTIIIAS 309

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR AALG+G+SK+Q V  HVLPLA+P +LTG+ + +A+ALGETAPLL +G
Sbjct: 310 RAALKAVPPSIREAALGVGSSKLQVVASHVLPLALPGMLTGTIIGMAQALGETAPLLMIG 369

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAF+ D P G TD A   PVQIYLWA   ER FVERT  AI++LL FL  +N   + +R
Sbjct: 370 MVAFIVDIPGGFTDPAAVMPVQIYLWADSPERAFVERTSAAIMVLLAFLISMNAVAVVMR 429

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 430 KRFERRW 436


>gi|327192730|gb|EGE59666.1| phosphate ABC transporter, permease protein [Rhizobium etli
           CNPAF512]
          Length = 440

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 234/418 (55%), Positives = 306/418 (73%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEFSE  +DP
Sbjct: 23  GIKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R AS MLS +A   LR  ++ D
Sbjct: 83  SNKRATDPSVLIAANYPVLLRDAIVKQLNINASSKPDVRDASAMLSKSAPIQLRDMVVAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIGKTV VSLLA ANIDSA KG +         +++D Q  W  +L + GAL   FN 
Sbjct: 143 PSLIGKTVNVSLLADANIDSANKGQIDLTVDEKNRKVNDKQVTWMNQLKASGALQKQFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+NG SSRPE AG+GVA++GSLY+MLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GLFVNGNSSRPEAAGLGVALIGSLYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P
Sbjct: 323 SIRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               + +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 383 ATPLEPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|86356165|ref|YP_468057.1| phosphate ABC transporter, permease protein [Rhizobium etli CFN 42]
 gi|86280267|gb|ABC89330.1| phosphate ABC transporter, permease protein [Rhizobium etli CFN 42]
          Length = 440

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 231/418 (55%), Positives = 307/418 (73%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEF+E  +DP
Sbjct: 23  GIKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFTEKTIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R A+ MLS +A   LR  ++ D
Sbjct: 83  NNKRASDPSVLVAANYPVLLRDAIVKQLNINASSKPDVRDATAMLSKSAPIQLRDMVVAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIGKTV VS+LA ANIDSA KG +         +++D Q  W  +L + GAL  +FN 
Sbjct: 143 PSLIGKTVNVSVLADANIDSANKGQIDLSVDEKNRKVNDKQVNWMNQLKASGALTKEFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+NG SSRPE AG+GVA++GSLY+MLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GLFVNGNSSRPEAAGLGVALIGSLYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P
Sbjct: 323 SIRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               + +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 383 ATPLEPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|190890214|ref|YP_001976756.1| phosphate ABC transporter permease [Rhizobium etli CIAT 652]
 gi|190695493|gb|ACE89578.1| phosphate ABC transporter, permease protein [Rhizobium etli CIAT
           652]
          Length = 440

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 234/418 (55%), Positives = 307/418 (73%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y + A++   VFL +LL +++ KG  A  QT I+LPIEFSE  +DP
Sbjct: 23  GIKRRYAAERRFQAYGIAAIIFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R AS MLS +A   LR  ++ D
Sbjct: 83  SNKRATDPSVLIAANYPVLLRDAIVKQLNINASSKPDVRDASAMLSKSAPIQLRDMVVAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIGKTV VSLLA ANIDSA KG +         +++D Q  W  +L + GAL   FN 
Sbjct: 143 PSLIGKTVNVSLLADANIDSANKGQIDLSVDEKNRKVNDKQVTWMNQLKASGALQKQFNT 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+NG SSRPE AG+GVA++GSLY+MLIV+ LS P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 203 GLFVNGNSSRPEAAGLGVALIGSLYLMLIVLALSLPIGVAASIYLEEFAPKNKLTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V INF  +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 263 NINNLAAVPSIVYGLLGLSVFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV + P
Sbjct: 323 SIRAAALGLGASKMQMVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               + +TA PVQ+Y+WA +AER FVERT GAI++LL+FL V+N   + LR RF++RW
Sbjct: 383 ATPLEPSTALPVQVYMWANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW 440


>gi|153008105|ref|YP_001369320.1| phosphate ABC transporter inner membrane subunit PstA [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559993|gb|ABS13491.1| phosphate ABC transporter, inner membrane subunit PstA
           [Ochrobactrum anthropi ATCC 49188]
          Length = 438

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 237/418 (56%), Positives = 299/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR+Y + A+ +   FL  LL S+ SKG  A WQT + LP++  E ++DP
Sbjct: 21  GLKRRYAAERRFRYYGIAAIAIGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEEKVIDP 80

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M +
Sbjct: 81  GNKRATDPNVLITANYPLLVRNALAEKLGVAATDRPAMRDLGRFYSDGVRIQLRKMVMDN 140

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  V +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 141 PSLIGTTQTVPVLAGADIDSAFKGQIDLSVPETSRKVSDRQVGWMKMLSEEGVMKEAFNT 200

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 201 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFAKKNRFTDMIEV 260

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 261 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 320

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 321 SIRAAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 380

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 381 STPMDPATALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 438


>gi|23502988|ref|NP_699115.1| phosphate ABC transporter permease [Brucella suis 1330]
 gi|23349027|gb|AAN31030.1| phosphate ABC transporter, permease protein [Brucella suis 1330]
          Length = 436

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 236/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  DNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|254713458|ref|ZP_05175269.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           M644/93/1]
 gi|254716186|ref|ZP_05177997.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           M13/05/1]
 gi|261217959|ref|ZP_05932240.1| phosphate ABC transporter [Brucella ceti M13/05/1]
 gi|261321191|ref|ZP_05960388.1| phosphate ABC transporter [Brucella ceti M644/93/1]
 gi|260923048|gb|EEX89616.1| phosphate ABC transporter [Brucella ceti M13/05/1]
 gi|261293881|gb|EEX97377.1| phosphate ABC transporter [Brucella ceti M644/93/1]
          Length = 436

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 236/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDCQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|306843559|ref|ZP_07476160.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO1]
 gi|306276250|gb|EFM57950.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO1]
          Length = 436

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 237/418 (56%), Positives = 299/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKRETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGVMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|222084781|ref|YP_002543310.1| phosphate ABC transporter, permease protein PstA [Agrobacterium
           radiobacter K84]
 gi|221722229|gb|ACM25385.1| phosphate ABC transporter, permease protein PstA [Agrobacterium
           radiobacter K84]
          Length = 444

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 237/418 (56%), Positives = 306/418 (73%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  FR Y + AV    VFLI L+SS+V  G  A  QT I+LPIEF E ++DP
Sbjct: 27  GIKRRYAAERRFRAYGIAAVTFGLVFLIALVSSVVRHGYTAFVQTSITLPIEFVEKVIDP 86

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP +L+ A+Y +LVR AL + L I  ++ AL+R+A+ M+S +AR  LR  +M D
Sbjct: 87  TGKRASDPKVLIAANYPVLVRDALVKALGIDPADRALVREATAMVSDSARSMLRDKVMAD 146

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IGKTV+++LLA ANIDSA KG +   +     ++SD Q  W ++L + GAL   FN 
Sbjct: 147 PSIIGKTVKITLLADANIDSANKGQIDLTANEADRKVSDRQLGWMRQLAASGALHKAFNS 206

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F++G SSRPE AG+GVA++GSLY+ML V+ L+ P+G+A++IYLEEF+ K   +  ++ 
Sbjct: 207 GLFLSGNSSRPEAAGLGVALIGSLYLMLTVLVLALPVGVAASIYLEEFAPKNRLTDLIEV 266

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIVYG+LG +V IN   +PRS +LVGGL+L+LMTLP IIIAT  ALR VP 
Sbjct: 267 NINNLAAVPSIVYGLLGLSVFINVMGLPRSASLVGGLVLSLMTLPMIIIATRSALRAVPP 326

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGAS++Q VFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMVAFV  YP
Sbjct: 327 SIRSAALGLGASRMQVVFHHVLPLAMPGILTGTILGLAHALGETAPLLLIGMVAFVASYP 386

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQIY+WA++AER FVERT GAI++LL FL  +N   + LR RF++RW
Sbjct: 387 TSPLDPATALPVQIYMWASEAERAFVERTSGAIIVLLFFLVAMNIGAILLRRRFERRW 444


>gi|161620050|ref|YP_001593937.1| phosphate ABC transporter, permease protein PstA [Brucella canis
           ATCC 23365]
 gi|254705141|ref|ZP_05166969.1| phosphate ABC transporter, permease protein PstA [Brucella suis bv.
           3 str. 686]
 gi|260567390|ref|ZP_05837860.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 4 str. 40]
 gi|261755845|ref|ZP_05999554.1| phosphate ABC transporter [Brucella suis bv. 3 str. 686]
 gi|161336861|gb|ABX63166.1| phosphate ABC transporter, permease protein PstA [Brucella canis
           ATCC 23365]
 gi|260156908|gb|EEW91988.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 4 str. 40]
 gi|261745598|gb|EEY33524.1| phosphate ABC transporter [Brucella suis bv. 3 str. 686]
          Length = 436

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 236/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  DNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|256370536|ref|YP_003108047.1| phosphate ABC transporter, permease protein [Brucella microti CCM
           4915]
 gi|256000699|gb|ACU49098.1| phosphate ABC transporter, permease protein [Brucella microti CCM
           4915]
          Length = 436

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 235/418 (56%), Positives = 297/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+ID A KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDPAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|62290979|ref|YP_222772.1| phosphate ABC transporter permease [Brucella abortus bv. 1 str.
           9-941]
 gi|82700889|ref|YP_415463.1| binding-protein dependent transport system inner membrane protein
           [Brucella melitensis biovar Abortus 2308]
 gi|163844155|ref|YP_001628560.1| phosphate ABC transporter, permease protein PstA [Brucella suis
           ATCC 23445]
 gi|189025192|ref|YP_001935960.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella abortus S19]
 gi|225853567|ref|YP_002733800.1| phosphate ABC transporter permease PstA [Brucella melitensis ATCC
           23457]
 gi|237816483|ref|ZP_04595476.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           str. 2308 A]
 gi|254690274|ref|ZP_05153528.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 6 str. 870]
 gi|254694761|ref|ZP_05156589.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 3 str. Tulya]
 gi|254696389|ref|ZP_05158217.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254731303|ref|ZP_05189881.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 4 str. 292]
 gi|256045746|ref|ZP_05448624.1| phosphate ABC transporter, permease protein PstA [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256060103|ref|ZP_05450285.1| phosphate ABC transporter, permease protein PstA [Brucella neotomae
           5K33]
 gi|256112465|ref|ZP_05453386.1| phosphate ABC transporter, permease protein PstA [Brucella
           melitensis bv. 3 str. Ether]
 gi|256258527|ref|ZP_05464063.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           bv. 9 str. C68]
 gi|256262949|ref|ZP_05465481.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 2 str. 63/9]
 gi|260546243|ref|ZP_05821983.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus NCTC 8038]
 gi|260563042|ref|ZP_05833528.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 1 str. 16M]
 gi|260755813|ref|ZP_05868161.1| phosphate ABC transporter [Brucella abortus bv. 6 str. 870]
 gi|260759036|ref|ZP_05871384.1| phosphate ABC transporter [Brucella abortus bv. 4 str. 292]
 gi|260760761|ref|ZP_05873104.1| phosphate ABC transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884838|ref|ZP_05896452.1| phosphate ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|261215088|ref|ZP_05929369.1| phosphate ABC transporter [Brucella abortus bv. 3 str. Tulya]
 gi|261324079|ref|ZP_05963276.1| phosphate ABC transporter [Brucella neotomae 5K33]
 gi|265992162|ref|ZP_06104719.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993900|ref|ZP_06106457.1| phosphate ABC transporter [Brucella melitensis bv. 3 str. Ether]
 gi|294851368|ref|ZP_06792041.1| phosphate ABC transporter [Brucella sp. NVSL 07-0026]
 gi|297247366|ref|ZP_06931084.1| phosphate ABC transporter, permease PstA [Brucella abortus bv. 5
           str. B3196]
 gi|306842749|ref|ZP_07475391.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO2]
 gi|62197111|gb|AAX75411.1| phosphate ABC transporter, permease protein [Brucella abortus bv. 1
           str. 9-941]
 gi|82616990|emb|CAJ12099.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis biovar Abortus 2308]
 gi|163674878|gb|ABY38989.1| phosphate ABC transporter, permease protein PstA [Brucella suis
           ATCC 23445]
 gi|189020764|gb|ACD73486.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella abortus S19]
 gi|225641932|gb|ACO01846.1| phosphate ABC transporter, permease protein PstA [Brucella
           melitensis ATCC 23457]
 gi|237788550|gb|EEP62765.1| phosphate ABC transporter, permease protein PstA [Brucella abortus
           str. 2308 A]
 gi|260096350|gb|EEW80226.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus NCTC 8038]
 gi|260153058|gb|EEW88150.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 1 str. 16M]
 gi|260669354|gb|EEX56294.1| phosphate ABC transporter [Brucella abortus bv. 4 str. 292]
 gi|260671193|gb|EEX58014.1| phosphate ABC transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675921|gb|EEX62742.1| phosphate ABC transporter [Brucella abortus bv. 6 str. 870]
 gi|260874366|gb|EEX81435.1| phosphate ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|260916695|gb|EEX83556.1| phosphate ABC transporter [Brucella abortus bv. 3 str. Tulya]
 gi|261300059|gb|EEY03556.1| phosphate ABC transporter [Brucella neotomae 5K33]
 gi|262764881|gb|EEZ10802.1| phosphate ABC transporter [Brucella melitensis bv. 3 str. Ether]
 gi|263003228|gb|EEZ15521.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092823|gb|EEZ16998.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 2 str. 63/9]
 gi|294819957|gb|EFG36956.1| phosphate ABC transporter [Brucella sp. NVSL 07-0026]
 gi|297174535|gb|EFH33882.1| phosphate ABC transporter, permease PstA [Brucella abortus bv. 5
           str. B3196]
 gi|306287093|gb|EFM58598.1| phosphate ABC transporter, permease protein PstA [Brucella sp. BO2]
 gi|326410139|gb|ADZ67204.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis M28]
 gi|326539859|gb|ADZ88074.1| phosphate ABC transporter, permease protein PstA [Brucella
           melitensis M5-90]
          Length = 436

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 236/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|15964265|ref|NP_384618.1| phosphate ABC transporter permease [Sinorhizobium meliloti 1021]
 gi|307307002|ref|ZP_07586741.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium meliloti BL225C]
 gi|307320656|ref|ZP_07600069.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium meliloti AK83]
 gi|15073442|emb|CAC45084.1| Putative phosphate transport system permease ABC transporter
           [Sinorhizobium meliloti 1021]
 gi|306893691|gb|EFN24464.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium meliloti AK83]
 gi|306901942|gb|EFN32541.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium meliloti BL225C]
          Length = 440

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 236/425 (55%), Positives = 305/425 (71%), Gaps = 2/425 (0%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           + S     +K RY +E  FR + + A+ +   FL +LL S+VSKG  A  QT I+LPIEF
Sbjct: 16  AASRRDIGIKRRYAAERRFRAFGMSAIAIGLFFLAVLLWSVVSKGYTAFQQTTITLPIEF 75

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           SE ++DP+ +R  DP  L  A+Y LLVR+AL ++L +  S   L++QA+ M+S +AR  L
Sbjct: 76  SEKVIDPKNERATDPKQLYTANYPLLVREALVKQLGLDPSKRPLVKQAADMVSASARTQL 135

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANV--HRMSDYQWKWFQKLDSDGA 180
           R  ++ DPS+IG+T+ V+LLA ANIDSA KG +    +    ++ D Q  W  +L   G 
Sbjct: 136 RDIVVADPSVIGRTIPVTLLAEANIDSAFKGQIDLSVDETKRKVKDEQVAWMNQLAEAGV 195

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           L   FN G F  GASSRPE AG+GVA++GSLYMMLIV+ LS P+G+A++IYLEEF+ K  
Sbjct: 196 LKKSFNTGIFTFGASSRPEAAGVGVALLGSLYMMLIVLVLSLPIGVAASIYLEEFAPKNR 255

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            +  ++ NINNLA+VPSIVYG+LG AV +NF  MPRS ALVG  +L LMTLP+IIIAT  
Sbjct: 256 LTDLIEVNINNLAAVPSIVYGLLGLAVFVNFAGMPRSAALVGAFVLTLMTLPTIIIATRA 315

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           AL+ VP SIRSAALGLGASK+QT+FHHVLPLAMP ILTG+ + LA ALGETAPLL +GMV
Sbjct: 316 ALKAVPPSIRSAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMV 375

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AFV D+P    + +TA PVQIY+WA +AER FVERT GAI++LLIFL  +N   + LR R
Sbjct: 376 AFVVDFPGSPLEPSTALPVQIYMWANEAERAFVERTSGAIIILLIFLIFMNLGAILLRRR 435

Query: 421 FKKRW 425
           F++RW
Sbjct: 436 FERRW 440


>gi|254700771|ref|ZP_05162599.1| phosphate ABC transporter, permease protein PstA [Brucella suis bv.
           5 str. 513]
 gi|261751280|ref|ZP_05994989.1| phosphate ABC transporter [Brucella suis bv. 5 str. 513]
 gi|261741033|gb|EEY28959.1| phosphate ABC transporter [Brucella suis bv. 5 str. 513]
          Length = 436

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 236/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADAP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|150395349|ref|YP_001325816.1| phosphate ABC transporter inner membrane subunit PstA
           [Sinorhizobium medicae WSM419]
 gi|150026864|gb|ABR58981.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sinorhizobium medicae WSM419]
          Length = 440

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 237/425 (55%), Positives = 304/425 (71%), Gaps = 2/425 (0%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           + S     +K RY +E  FR +   A+ +   FL +LL S+VSKG  A  QT I+LPIEF
Sbjct: 16  AASRRDIGIKRRYAAERRFRAFGFGAIAIGLFFLAVLLWSVVSKGYTAFQQTTITLPIEF 75

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           SE ++DP+ +R  DP  L  A+Y LLVR+AL ++L +  +   L++QA+ M+S +AR  L
Sbjct: 76  SEKVIDPKNERATDPKQLFTANYPLLVREALVKQLGLDQAKRPLVKQATDMVSASARSQL 135

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGA 180
           R  ++ DP++IGKT+ V+LLA ANIDSA KG +         ++ D Q  W   L  +G 
Sbjct: 136 RDIVVADPTVIGKTIPVTLLADANIDSAFKGQIDLTVDEARRKVKDEQVAWMNTLAEEGV 195

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           L   FN G F  GASSRPE AG+GVA++GSLYMMLIV+ LS P+G+A++IYLEEF+ K  
Sbjct: 196 LKKSFNTGIFTFGASSRPEAAGVGVALLGSLYMMLIVLVLSLPIGVAASIYLEEFAPKNR 255

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            +  ++ NINNLA+VPSIVYG+LG AV INF+ MPRS ALVG  +L LMTLP+IIIAT  
Sbjct: 256 LTDLIEVNINNLAAVPSIVYGLLGLAVFINFWGMPRSAALVGAFVLTLMTLPTIIIATRA 315

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           AL+ VP SIRSAALGLGASK+QTVFHHVLPLAMP ILTG+ + LA ALGETAPLL +GMV
Sbjct: 316 ALKAVPPSIRSAALGLGASKMQTVFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMV 375

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AFV D+P    + +TA PVQIY+WA +AER FVERT GAI++LLIFL  +N   + LR R
Sbjct: 376 AFVVDFPGSPLEPSTALPVQIYMWANEAERAFVERTSGAIIILLIFLIFMNLGAILLRRR 435

Query: 421 FKKRW 425
           F++RW
Sbjct: 436 FERRW 440


>gi|254718180|ref|ZP_05179991.1| phosphate ABC transporter, permease protein PstA [Brucella sp.
           83/13]
 gi|265983137|ref|ZP_06095872.1| phosphate ABC transporter [Brucella sp. 83/13]
 gi|306837694|ref|ZP_07470563.1| phosphate ABC transporter, permease protein PstA [Brucella sp. NF
           2653]
 gi|264661729|gb|EEZ31990.1| phosphate ABC transporter [Brucella sp. 83/13]
 gi|306407252|gb|EFM63462.1| phosphate ABC transporter, permease protein PstA [Brucella sp. NF
           2653]
          Length = 436

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 235/418 (56%), Positives = 297/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGVMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE + +GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSSLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|225626509|ref|ZP_03784548.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           str. Cudo]
 gi|254707342|ref|ZP_05169170.1| phosphate ABC transporter, permease protein PstA [Brucella
           pinnipedialis M163/99/10]
 gi|254709116|ref|ZP_05170927.1| phosphate ABC transporter, permease protein PstA [Brucella
           pinnipedialis B2/94]
 gi|256030642|ref|ZP_05444256.1| phosphate ABC transporter, permease protein PstA [Brucella
           pinnipedialis M292/94/1]
 gi|256158644|ref|ZP_05456527.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           M490/95/1]
 gi|256254048|ref|ZP_05459584.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           B1/94]
 gi|260169546|ref|ZP_05756357.1| phosphate ABC transporter, permease protein PstA [Brucella sp.
           F5/99]
 gi|261221188|ref|ZP_05935469.1| phosphate ABC transporter [Brucella ceti B1/94]
 gi|261314825|ref|ZP_05954022.1| phosphate ABC transporter [Brucella pinnipedialis M163/99/10]
 gi|261316616|ref|ZP_05955813.1| phosphate ABC transporter [Brucella pinnipedialis B2/94]
 gi|261759073|ref|ZP_06002782.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. F5/99]
 gi|265987688|ref|ZP_06100245.1| phosphate ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|265997149|ref|ZP_06109706.1| phosphate ABC transporter [Brucella ceti M490/95/1]
 gi|225618166|gb|EEH15209.1| phosphate ABC transporter, permease protein PstA [Brucella ceti
           str. Cudo]
 gi|260919772|gb|EEX86425.1| phosphate ABC transporter [Brucella ceti B1/94]
 gi|261295839|gb|EEX99335.1| phosphate ABC transporter [Brucella pinnipedialis B2/94]
 gi|261303851|gb|EEY07348.1| phosphate ABC transporter [Brucella pinnipedialis M163/99/10]
 gi|261739057|gb|EEY27053.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. F5/99]
 gi|262551617|gb|EEZ07607.1| phosphate ABC transporter [Brucella ceti M490/95/1]
 gi|264659885|gb|EEZ30146.1| phosphate ABC transporter [Brucella pinnipedialis M292/94/1]
          Length = 436

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 235/418 (56%), Positives = 297/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++ W
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERCW 436


>gi|114706440|ref|ZP_01439342.1| ABC transporter, membrane spanning protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538301|gb|EAU41423.1| ABC transporter, membrane spanning protein [Fulvimarina pelagi
           HTCC2506]
          Length = 440

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 221/418 (52%), Positives = 293/418 (70%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y ++A+ +   FL +LL S+VSKG  A WQT I +PI FSE ++  
Sbjct: 23  GIKRRYAAERRFKAYGMIAIGLGIAFLFILLWSVVSKGYTAFWQTEIRVPITFSEEVIGT 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
            ++   + + L+ A+Y  L R  L + L I   N   +  A+ ++S   R  LR  ++ D
Sbjct: 83  AEEGAANQSKLMMANYPQLARDGLIQLLEIDPENSEAVSAANGLVSQGVRMELRDMVLND 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
             +IG T +V L AS+++DSALKG        +   +SD Q ++ ++L+  GAL  +FN+
Sbjct: 143 LQVIGTTEDVWLYASSDLDSALKGSYDLSVEESRRPISDLQLEFIERLEEMGALEQNFNW 202

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSR E AG+GVA++GS YMMLIV+ L+ P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 203 GLFTFGASSRAETAGVGVAIIGSAYMMLIVLALALPIGVAASIYLEEFAPKNRFTDLIEV 262

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+GILG AV IN+F +PRS ALVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 263 NINNLAAVPSIVFGILGLAVFINWFGLPRSAALVGGLVLTLMTLPTIIIATRAALRAVPP 322

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALGLGASK QTVF HVLPLA P ILTG+ + LA+ALGETAPLL +GMVAFV DYP
Sbjct: 323 SIRWAALGLGASKTQTVFQHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVADYP 382

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQIY+WA +AER F ERT GAI++LL FLA++N   ++LR RF++RW
Sbjct: 383 ETPLDAATALPVQIYMWANEAERAFQERTSGAIMILLGFLALMNLTAIFLRRRFERRW 440


>gi|17988270|ref|NP_540904.1| phosphate ABC transporter permease [Brucella melitensis bv. 1 str.
           16M]
 gi|17984039|gb|AAL53168.1| phosphate transport system permease protein psta [Brucella
           melitensis bv. 1 str. 16M]
          Length = 436

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 236/418 (56%), Positives = 298/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL  LL S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCALLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +    P    ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVPETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVFINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAALGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTARPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|90415569|ref|ZP_01223503.1| phosphate ABC transporter, permease protein [marine gamma
           proteobacterium HTCC2207]
 gi|90332892|gb|EAS48062.1| phosphate ABC transporter, permease protein [marine gamma
           proteobacterium HTCC2207]
          Length = 430

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 185/425 (43%), Positives = 276/425 (64%), Gaps = 3/425 (0%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           + +    +K+L  R  SE LFR+Y  +A+ +    + +L + IVSKG GA    ++ L +
Sbjct: 9   VNNLEKIRKSLSRRNRSERLFRWYGRLAIFIGLAAVTVLFTDIVSKGHGAFRIAYLQLEV 68

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
            + + ++        DP  L+  ++  + ++AL ++     +  +  R+   ++S  + +
Sbjct: 69  GYDQDLIGVDN--LTDPEQLILGNWQAVPKQALRQQFP-DVAGRSDKRKLYGLVSNGSGF 125

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
            L+  L+ +P L+G    V +LA  +ID+  K +L       R+SD Q KW  +L   G 
Sbjct: 126 DLKDRLLANPLLLGTRETVWVLADDDIDTYYKSWLDGEPYAARLSDKQVKWIGELHDQGK 185

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           + L FN   F  G S  PE AGI  AV+GSL+ +L+ + LSFP+G+A+AIYLEEF+ K  
Sbjct: 186 IRLQFNSNLFTRGDSREPEQAGIRGAVMGSLFTLLLTLMLSFPVGVAAAIYLEEFAPKNG 245

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           ++ F++ NINNLA+VPSI++G+LG A+ INFF +PRS  +VGGL+L LMTLP+III +  
Sbjct: 246 WTDFIEVNINNLAAVPSIIFGLLGLAIFINFFHVPRSVPIVGGLVLTLMTLPTIIITSRA 305

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           A+++VP SIR AALG+GASK Q V HHVLPLA+P +LTG+ + +A+ALGE+APLL +GMV
Sbjct: 306 AIKSVPPSIREAALGMGASKYQMVMHHVLPLALPGMLTGAIIGMAQALGESAPLLMIGMV 365

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AF+ D P G  D AT  PVQI+LWA   ER F+E+T  AI++LL FL V+NT+ +W+R R
Sbjct: 366 AFIVDIPAGFNDPATVLPVQIFLWADSPERAFIEKTSAAIMVLLSFLIVMNTSAVWVRKR 425

Query: 421 FKKRW 425
            ++RW
Sbjct: 426 LERRW 430


>gi|254427840|ref|ZP_05041547.1| phosphate ABC transporter, permease protein PstA [Alcanivorax sp.
           DG881]
 gi|196194009|gb|EDX88968.1| phosphate ABC transporter, permease protein PstA [Alcanivorax sp.
           DG881]
          Length = 422

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 183/424 (43%), Positives = 267/424 (62%), Gaps = 4/424 (0%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++    +K L  RY +E  F+ + + ++ +  + L+LL + I+ KG  A  +  I LPI 
Sbjct: 3   ETTEKVRKTLARRYRAEKRFKAFGIGSIGIGLMALVLLFTDIIGKGHSAFVEYEIQLPIT 62

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           F   ++D    R  D   L   +Y  ++R ALA +           R  +Q++ST A Y 
Sbjct: 63  FDAEVLDVSDPR--DEDELNYGNYQGVIRDALAERFPT-VEGRQDTRALNQLVSTGAGYA 119

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           LR  L  +P+L+G+T  + LLA  ++D  LK       +   +++ Q  W  +L++ G  
Sbjct: 120 LRDMLREEPTLLGETRTLWLLADDDVDLFLKANEEQREDSR-LNEKQQAWVAELETSGET 178

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            + FN   F  G S  PE AGI  A++GSL+ M++ + LSFP+G+A+A+YLEEF+ K  F
Sbjct: 179 RMVFNQSLFSYGDSREPEQAGILGAILGSLFTMIVTLVLSFPVGVAAAVYLEEFAPKNKF 238

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F++ NINNLA+VPSI++G+LG AV+I  F +PRS  LVGG++L LMTLP++II++  A
Sbjct: 239 TDFIEVNINNLAAVPSIIFGLLGLAVIIGLFGLPRSVPLVGGIVLTLMTLPTVIISSRAA 298

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           ++ VP SIR AA+GLGASK+Q V HHVLPLA+P +LTG+ + +A+ALGETAPLL +GMVA
Sbjct: 299 IKAVPPSIRQAAMGLGASKMQVVLHHVLPLALPGMLTGAIIGMAQALGETAPLLMIGMVA 358

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D P G  D AT  PVQIYLWA   E+ F      AI++LL FL  +NT  + LR R 
Sbjct: 359 FIVDLPAGPLDAATVLPVQIYLWADSPEQSFESLASAAIMVLLAFLITMNTLAVILRKRL 418

Query: 422 KKRW 425
           ++RW
Sbjct: 419 ERRW 422


>gi|110835544|ref|YP_694403.1| phosphate ABC transporter permease [Alcanivorax borkumensis SK2]
 gi|110648655|emb|CAL18131.1| phosphate ABC transporter permease protein [Alcanivorax borkumensis
           SK2]
          Length = 422

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 185/424 (43%), Positives = 268/424 (63%), Gaps = 4/424 (0%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           K+    +K L  RY +E  F+ Y + ++ +  + L+LL + I+ KG  A  +  I LPI 
Sbjct: 3   KTTEKVRKTLARRYRAEKRFKAYGMASIGIGLMALLLLFTDIIGKGHSAFVEYEIQLPIT 62

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           F   ++D    R  D   L   +Y  ++R ALA +      +   +R  +Q++ST A Y 
Sbjct: 63  FDAEVLDVSDPR--DAEQLNYGNYQGVIRDALAERFPG-VESRLDVRSLNQLVSTGAGYA 119

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           LR  L  +P+L+G+T  + LLA  ++D  LK       +   ++D Q  W  +L++ G  
Sbjct: 120 LRDMLREEPALLGETRTLWLLADDDVDLFLKANEEQREDSR-LNDKQQAWVAELEASGET 178

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            + FN   F  G S  PE AGI  A++GSL+ M++ + LSFP+G+A+A+YLEEF+ K  F
Sbjct: 179 RMVFNRSLFSYGDSREPEQAGILGAILGSLFTMIVTLLLSFPIGVAAAVYLEEFAPKNRF 238

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F++ NINNLA+VPSI++G+LG AV+I  F +PRS  LVGG++L LMTLP++II++  A
Sbjct: 239 TDFIEVNINNLAAVPSIIFGLLGLAVIIGLFGLPRSVPLVGGIVLTLMTLPTVIISSRAA 298

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           ++ VP SIR AA+GLGASK+Q V HHVLPLA+P +LTG+ + +A+ALGETAPLL +GMVA
Sbjct: 299 IKAVPPSIRQAAMGLGASKMQVVLHHVLPLALPGMLTGAIIGMAQALGETAPLLMIGMVA 358

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D P    D AT  PVQIYLWA   E+ F      AI++LL FL  +NT  + LR R 
Sbjct: 359 FIVDLPADPLDAATVLPVQIYLWADSPEQSFEALASAAIMVLLAFLITMNTLAVILRKRL 418

Query: 422 KKRW 425
           ++RW
Sbjct: 419 ERRW 422


>gi|319781151|ref|YP_004140627.1| phosphate ABC transporter inner membrane subunit PstA
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167039|gb|ADV10577.1| phosphate ABC transporter, inner membrane subunit PstA
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 438

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 231/418 (55%), Positives = 296/418 (70%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y VVA+ V   FL ++L +IVSKG  A WQT +SLPI F E ++DP
Sbjct: 21  GLKARYAAERRFRIYGVVAISVGLAFLAIMLITIVSKGYTAFWQTTVSLPITFDEKVIDP 80

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L++A+Y  L   AL  KL IS  +  ++++    LS  AR  LR  +  D
Sbjct: 81  SGKRATDPSVLIKANYPKLAENALVAKLGISPDDKPMIQKLKGFLSEGARVQLRDIVAAD 140

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PS+IG T +V++LA+AN+DSA KG +         ++SD Q  W  KL ++GA+   FN 
Sbjct: 141 PSVIGTTRDVNILAAANLDSAFKGQIDLSVEEARRKVSDQQITWMNKLKAEGAMAEHFNS 200

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA++GS YMM+IV+ L+ P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 201 GLFTYGASSRPETSGMGVAIIGSFYMMVIVLLLALPIGVAASIYLEEFAKKNRFTDLIEV 260

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INF  MPRS A VGGL+L LMTLP+IIIAT  AL  VP 
Sbjct: 261 NINNLAAVPSIVFGLLGLAVFINFLGMPRSAAFVGGLVLTLMTLPTIIIATRAALAAVPP 320

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSAALGLGASK+Q VF H+LPLA P ILTG+ + LARALGETAPLL +GMVAFV D P
Sbjct: 321 SIRSAALGLGASKMQMVFQHILPLAAPGILTGTIIGLARALGETAPLLLIGMVAFVADPP 380

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQIY+WA +AER FVER  GAI++LL+FL  +N   + LR RF++RW
Sbjct: 381 TTPFDPATALPVQIYMWANEAERAFVERMSGAIIILLVFLMAMNITAIVLRRRFERRW 438


>gi|148559657|ref|YP_001259938.1| phosphate ABC transporter permease PstA [Brucella ovis ATCC 25840]
 gi|148370914|gb|ABQ60893.1| phosphate ABC transporter, permease protein PstA [Brucella ovis
           ATCC 25840]
          Length = 436

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 234/418 (55%), Positives = 296/418 (70%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ V   FL   L S+ SKG  A WQT + LP++  + ++DP
Sbjct: 19  GLKRRYAAERRFRLYGILAIAVGVFFLCAFLFSVFSKGYTAFWQTTLYLPVKLEQQVIDP 78

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             K   DP +L+ A+Y LLVR ALA KL ++ ++   +R   +  S   R  LRK +M D
Sbjct: 79  GNKHETDPNVLIAANYPLLVRNALAEKLGVARTDRPAMRDIGRFYSDGVRVQLRKMVMDD 138

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIG T  + +LA A+IDSA KG +         ++SD Q  W + L  +G +   FN 
Sbjct: 139 PSLIGTTQTIPVLAGADIDSAFKGQIDLSVSETNRKVSDRQVGWMKTLSDEGIMKQAFNT 198

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F  GASSRPE +G+GVA+VGSLYMMLIV+GLS P+G+A++IYLEEF+ K  F+  ++ 
Sbjct: 199 GLFTFGASSRPETSGLGVALVGSLYMMLIVLGLSLPIGVAASIYLEEFARKNRFTDMIEV 258

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AVLINFF +PRS +LVGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 259 NINNLAAVPSIVFGLLGLAVLINFFGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPP 318

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIRSA LGLGASK Q VFHHVLPLA P ILTG+ + LA ALGETAPLL +GMVAFV D P
Sbjct: 319 SIRSAVLGLGASKTQMVFHHVLPLAAPGILTGTIIGLAHALGETAPLLLIGMVAFVADVP 378

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LL+FLAV+N A + LR RF++RW
Sbjct: 379 ATPMDPSTALPVQIYMWANEAERAFVERTSGAIIVLLLFLAVMNIAAIILRRRFERRW 436


>gi|154250852|ref|YP_001411676.1| phosphate ABC transporter inner membrane subunit PstA [Parvibaculum
           lavamentivorans DS-1]
 gi|154154802|gb|ABS62019.1| phosphate ABC transporter, inner membrane subunit PstA
           [Parvibaculum lavamentivorans DS-1]
          Length = 430

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 190/420 (45%), Positives = 264/420 (62%), Gaps = 11/420 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
              LK RY ++   R Y V A+L     L  L+ +I S  I A+ QT ++L +E     +
Sbjct: 20  DARLKRRYAADKRLRLYGVAAILFALGMLATLVLTIASTAIPAITQTMVTLDVELPAEAI 79

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D    R         A+Y   +  A+AR     D+    +R+  Q+ +++A+Y LR  ++
Sbjct: 80  DAANPR--------EANYQKFINDAIARMFPEVDTPRE-MRELRQLFTSSAQYQLRDRVI 130

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
            DPS+IG TV  +   S   D   KG +    P +  R+SD Q  W+ +L     +   F
Sbjct: 131 EDPSMIGSTVAFTFPLSDIGDQLHKGGIDRDLPRDQRRISDDQIGWYDRLVEQDRISTPF 190

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+G   N  S  PE+AG+  A+VGS Y +LI   +SFP+GI++A+YLEEF+ K  ++  +
Sbjct: 191 NWGLLTNADSRFPELAGLWGALVGSFYALLICFLISFPVGISAAVYLEEFAPKNRWTDLI 250

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+LG AV +NFF MPRS  +VGGL+L+LMTLP+IIIAT  AL+ V
Sbjct: 251 EVNINNLAAVPSIVFGLLGLAVFLNFFGMPRSAPIVGGLVLSLMTLPTIIIATRAALKAV 310

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AA+G+GASK+QTV HHVLPLAMP ILTG+ + LA+ALGETAPLL +GM AF+T 
Sbjct: 311 PPSIREAAIGVGASKMQTVAHHVLPLAMPGILTGTIIGLAQALGETAPLLLIGMNAFITA 370

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P  + + +TA P QIY+WA   ER F  RT  AI++LL FL  +N   +++R RF+KRW
Sbjct: 371 APDSMFNPSTALPTQIYIWADSPERGFTSRTSAAIVVLLGFLVCMNAIAIYMRKRFEKRW 430


>gi|90023393|ref|YP_529220.1| phosphate ABC transporter permease [Saccharophagus degradans 2-40]
 gi|89952993|gb|ABD83008.1| Phosphate transport system permease protein 2 [Saccharophagus
           degradans 2-40]
          Length = 430

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 186/420 (44%), Positives = 275/420 (65%), Gaps = 3/420 (0%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
             +++LK RY +E  F+ + + +V V  + L++L + I+SKG GA  QT++ L +     
Sbjct: 14  KVERSLKKRYAAERRFKAFGIASVGVGILALLILFTEIISKGSGAFTQTYVQLEVHLDAD 73

Query: 66  IVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKT 125
            +        DP  L   DYN ++RKAL ++           R    ++S  A Y ++  
Sbjct: 74  TLGIYD--ATDPQQLAVGDYNAVIRKALLKRF-DGVKTRNDKRALYSLISIGASYQVQNI 130

Query: 126 LMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
           +  DP +IG+T  + +LA  ++D+  K    +   V R+S+ Q +W       G L   F
Sbjct: 131 IEADPGVIGQTQTLWVLADDDLDTYYKSLSDAEPFVGRLSEKQLEWVTSWVEFGQLKRKF 190

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N   F +G SS PE+AGI  A++GSL+ +L+ + LSFP+G+A+A+YLEE++ +  F+ F+
Sbjct: 191 NTILFTSGDSSEPELAGILGALMGSLFTLLVTLSLSFPIGVAAAVYLEEYAGRNKFTDFI 250

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPS+++G+LG A+ +NF +MPRS  LVGGL+L LMTLP+III++  A++ V
Sbjct: 251 EVNINNLAAVPSVIFGLLGLAIFLNFMEMPRSVPLVGGLVLTLMTLPTIIISSRAAIKAV 310

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR A+LG+GASK+Q + HHVLPLAMP +LTG+ + LA+ALGETAPLL +GMVAF+ D
Sbjct: 311 PPSIREASLGMGASKMQMIIHHVLPLAMPGMLTGAIIGLAQALGETAPLLMIGMVAFIVD 370

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P G+TD ++  PVQI+LWA   ER FVERT  AI++LL FL  +NT  +WLR R ++RW
Sbjct: 371 IPAGITDPSSVLPVQIFLWADSPERAFVERTSAAIMVLLAFLITMNTLAIWLRTRLERRW 430


>gi|319898364|ref|YP_004158457.1| phosphate ABC transporter, permease protein [Bartonella
           clarridgeiae 73]
 gi|319402328|emb|CBI75867.1| phosphate ABC transporter, permease protein [Bartonella
           clarridgeiae 73]
          Length = 430

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 222/418 (53%), Positives = 300/418 (71%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y + A+ +   FL+ LL SI+S+G  A +Q  + L +   E ++DP
Sbjct: 13  GLKGRYRAERRFRAYGLSAIFISLFFLVALLWSIISQGYTAFFQNEMILSVYLDEKVIDP 72

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             +R  +P IL+ A+Y LLVR ALA KL +  ++   +R  ++M S + R  LR  +  +
Sbjct: 73  GGQRESNPKILITANYPLLVRNALAEKLGVDQNDQPSMRDINRMFSQSVRVQLRDIITKN 132

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P+LIG T ++ +LA+ANIDSA KG +    P    ++SD Q KW + L +DG L+  FN 
Sbjct: 133 PNLIGTTQKIKVLAAANIDSACKGQIDLHVPEKNRKISDQQIKWMKYLINDGTLYKTFNR 192

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF  GASSRPE +G+GVA++GS YMM+IV+ +S P+GIA+A+YLEE++ K  F+ F++ 
Sbjct: 193 HFFTFGASSRPETSGLGVAMIGSFYMMIIVLVISLPIGIATALYLEEYARKNKFTDFIEI 252

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INF  MPRS + VGGL+LALMTLP+IIIAT  ALR VP 
Sbjct: 253 NINNLAAVPSIVFGLLGLAVFINFMGMPRSASFVGGLVLALMTLPTIIIATRSALRAVPF 312

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+ ALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL +GMVAFV D P
Sbjct: 313 SIRAGALGLGASKTQMVFHHVIPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVVDIP 372

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           +   D ATA PVQI++WA++AER FVE+T GAI++L++FL  +N + + LR RF++RW
Sbjct: 373 MTPMDPATALPVQIFMWASEAERAFVEKTSGAIIILMVFLVFMNISAVILRRRFERRW 430


>gi|240849906|ref|YP_002971295.1| phosphate ABC transporter, permease protein PstA [Bartonella
           grahamii as4aup]
 gi|240267029|gb|ACS50617.1| phosphate ABC transporter, permease protein PstA [Bartonella
           grahamii as4aup]
          Length = 429

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 218/417 (52%), Positives = 302/417 (72%), Gaps = 2/417 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
           +LK RY +E  FR Y ++A+ +   FL  LL SI+S+G  A +Q+ ++L I   E I+DP
Sbjct: 12  SLKRRYWAERRFRAYGLIAIFIGLFFLFTLLWSIISQGYTAFFQSEMTLLIYLDEKIIDP 71

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             +    P +L+ A+Y LLVR ALA+KL+I  ++ A LR+ ++M S   R  LR+ +  +
Sbjct: 72  SGQHKTKPRVLMTANYPLLVRNALAKKLNIDQNDRASLREVNRMFSNGVRVQLREMVTKN 131

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P LIG   +V +LASA+IDSA KG +         ++S+ Q +W ++L  DG L+  FN 
Sbjct: 132 PKLIGTMQKVKVLASADIDSAYKGQIDLRVAEKNRKVSNRQVEWIKRLAHDGTLYKTFNI 191

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFF  GASSRPE AG+GVA++GSLYM+ IV+ +S P+GIA+A+YL E++ K  F+ F++ 
Sbjct: 192 GFFTFGASSRPETAGLGVAIIGSLYMIGIVLLVSLPIGIATALYLAEYARKNKFTDFIEV 251

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG +  +NF  +PRS + VGGL+LALMTLP+IIIAT  ALR VP 
Sbjct: 252 NINNLAAVPSIVFGLLGLSFFVNFLGLPRSASFVGGLVLALMTLPTIIIATRSALRAVPL 311

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK Q +FHHV+PLA P ILTG+ + +A+ALGETAPLL +GMVAFV + P
Sbjct: 312 SIRAAALGLGASKTQMIFHHVVPLAAPGILTGTIIGVAQALGETAPLLLIGMVAFVVNIP 371

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
               D ATA PVQI++WA +AER FVE+T GAI++L+IFLA++N + ++LR RF++R
Sbjct: 372 TTPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLMIFLAIMNISAVFLRRRFERR 428


>gi|121602070|ref|YP_989478.1| phosphate ABC transporter, permease protein PstA [Bartonella
           bacilliformis KC583]
 gi|120614247|gb|ABM44848.1| phosphate ABC transporter, permease protein PstA [Bartonella
           bacilliformis KC583]
          Length = 430

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 220/418 (52%), Positives = 302/418 (72%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y ++A+ +   FL +LL S++S+G  A +Q+ ++L +   E I+DP
Sbjct: 13  GLKRRYWAERRFRAYGLIAIFIGLSFLAILLWSVISRGYTAFFQSEMALSVYLDEKIIDP 72

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             +R ++P IL+ A+Y LL+  ALA KL +  ++  L+R  S+M S   R  LR  ++ +
Sbjct: 73  NGQRMINPKILMTANYPLLISNALATKLGVDHNDQVLMRNVSRMFSHGIRVQLRDMVIKN 132

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P+LIG T ++ +LA+A+IDSA KG +         ++ D + +W + L  DG L+  FNY
Sbjct: 133 PNLIGTTQKIKVLAAADIDSACKGQINLHVTGKNRKIFDQRIEWMKHLTDDGTLYQAFNY 192

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFFI+GASSRPE +G+GVA++GSL+MM+IV+  S P+G+A+AIYLEE+ HK   +  ++ 
Sbjct: 193 GFFISGASSRPETSGLGVAIMGSLFMMIIVLMGSLPIGMATAIYLEEYGHKNKLTDLIEI 252

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSI++G+LG +V IN   MPRS + VGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 253 NINNLAAVPSIIFGLLGLSVFINVCGMPRSASFVGGLVLTLMTLPTIIIATRSALRAVPF 312

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL VGMVAFV + P
Sbjct: 313 SIRAAALGLGASKTQMVFHHVVPLAAPGILTGTIIGLAQALGETAPLLLVGMVAFVANIP 372

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D ATA PVQI++WA +AER FVE+T GAI++L+IFLAV+N A + LR RF++RW
Sbjct: 373 TTPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLMIFLAVMNIAAVLLRRRFERRW 430


>gi|209966523|ref|YP_002299438.1| phosphate ABC transporter, permease protein PstA, putative
           [Rhodospirillum centenum SW]
 gi|209959989|gb|ACJ00626.1| phosphate ABC transporter, permease protein PstA, putative
           [Rhodospirillum centenum SW]
          Length = 437

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 192/426 (45%), Positives = 277/426 (65%), Gaps = 5/426 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            +    +K L+ RY +E  F+ Y +VA+ V  + L++LL +I+  G+GA  QT I L + 
Sbjct: 15  HTSEAAEKRLRRRYAAERRFKAYGIVAIAVACLMLVVLLYTILHNGVGAFTQTAIRLEVT 74

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
                +DP+     +PA   RA +  LV+ AL R+     S     R    ++S  A   
Sbjct: 75  LDAKTIDPKGTG--NPADWDRAAFQDLVQDALYREFP-DVSGRVPKRALRGLISPVAGVF 131

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           L + ++ DP+++G+T E  L AS +I+   KG +    P +   +SD Q  W  +L   G
Sbjct: 132 LYREVLEDPAMVGQTREFWLPASDDINQIRKGRIDRTLPESSRPVSDEQLAWLDRLVEQG 191

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
                FN  FF    S+ PE+AGI  AVVGSLY++++ + L+ P+G+A+A+Y+EEF+ K 
Sbjct: 192 KATSVFNSTFFTASDSNYPELAGIRGAVVGSLYLLIVTVLLALPIGVATAVYMEEFAPKN 251

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            F+  ++ NINNLA+VPSIV+G+LG AV + FF +PRS  LVGG+++ALM+LP+IIIA  
Sbjct: 252 SFTDLIEVNINNLAAVPSIVFGLLGLAVFLGFFGLPRSAPLVGGMVIALMSLPTIIIAAR 311

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL+ VP SIR AALG+GAS++QTV HHVLPLAMP ILTG+ ++LA+ALGETAPLL VGM
Sbjct: 312 AALKAVPPSIREAALGMGASRLQTVMHHVLPLAMPGILTGTIIALAQALGETAPLLMVGM 371

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
            AFVT+ P G+   ++  PVQ+Y+WA   ER FVE T  AI++LL FL ++N A ++LR 
Sbjct: 372 NAFVTEPPSGLLSSSSVLPVQVYIWADAPERGFVELTSAAIMVLLAFLIMMNGAAIYLRK 431

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 432 KFERRW 437


>gi|88799185|ref|ZP_01114765.1| phosphate ABC transporter, permease protein (PstA) [Reinekea sp.
           MED297]
 gi|88778168|gb|EAR09363.1| phosphate ABC transporter, permease protein (PstA) [Reinekea sp.
           MED297]
          Length = 437

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 194/423 (45%), Positives = 265/423 (62%), Gaps = 5/423 (1%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
              K  L  RY  E  FR Y V ++++   FL +LL +I + G    + T I L + +  
Sbjct: 18  ERMKAKLGKRYAKEKRFRAYGVASIVIGLCFLAMLLGTIFTAGWSTFYATEIRLTVTYDA 77

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
             +        D + L+ AD+  LV+ A+  +     S  +  R    ++S+ A Y L+ 
Sbjct: 78  DAIGVSD--LNDESQLMFADWGALVKNAMKERFP-YVSGRSDRRAMYSLVSSVAEYDLKD 134

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDGALF 182
            L  +P L+G T EV L+A   ID+ +KG +    P N  R+SD Q    + L   G L 
Sbjct: 135 RLEANPELLGTTEEVWLMADDEIDALMKGQVDMSVPENERRISDLQNSLVESLIESGELK 194

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
             FN  FF NG S  PE AGI  A++GS + +L+ + LSFP+G+A+AIYLEEF+ K   +
Sbjct: 195 KSFNTTFFTNGDSREPEQAGIRGAMLGSFFTLLVTLALSFPIGVAAAIYLEEFAPKNRLT 254

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NINNLA+VPSIV+G+LG AV IN F +PRS  +VGGL+L LMTLP+III++  A+
Sbjct: 255 EIIEVNINNLAAVPSIVFGLLGLAVFINVFHLPRSAPVVGGLVLTLMTLPTIIISSRSAI 314

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP SIR AALGLGASKVQ V HHVLPLAMP +LTG+ + +A+ALGETAPLL +GMVAF
Sbjct: 315 KAVPPSIREAALGLGASKVQMVMHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGMVAF 374

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           + D P G  D AT  PVQI+LW+   ER FV +T GAI++LL FLA +N   ++LR +F+
Sbjct: 375 IADIPSGPLDSATVLPVQIFLWSDLPERAFVAKTSGAIMVLLGFLAAMNLLAVYLRKKFE 434

Query: 423 KRW 425
            RW
Sbjct: 435 TRW 437


>gi|254480369|ref|ZP_05093616.1| phosphate ABC transporter, permease protein PstA [marine gamma
           proteobacterium HTCC2148]
 gi|214038952|gb|EEB79612.1| phosphate ABC transporter, permease protein PstA [marine gamma
           proteobacterium HTCC2148]
          Length = 428

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 190/425 (44%), Positives = 272/425 (64%), Gaps = 5/425 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           K+ ++ + +LK RY  E  F+ Y  +AVL  FVFL +LL  IVSKG  A  Q HIS+ + 
Sbjct: 7   KNTALIQASLKKRYARERRFQMYGKLAVLAGFVFLFVLLFDIVSKGTPAFTQQHISIAVN 66

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
                +        D   + +AD++ L++ +L         +    RQ  +++S  A Y 
Sbjct: 67  IDVDALGVSSTASQDE--ISKADFSSLIKSSLREMFP-DVKSRGDKRQLYRLVSIGAEYD 123

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           LR  ++ DP+L+GK  ++ +LA +   S LKG +    P    ++ + Q  W  +L   G
Sbjct: 124 LRDKVLADPTLLGKKQDIWMLAHSQAASYLKGQITRVIPEAERKVKNQQMDWLDRLREQG 183

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
                FN  FF  G S  PE+AGI  A+ GSL+ +++   L+FP+G+ +A+YLEEF+ + 
Sbjct: 184 RTKSSFNTTFFTYGDSREPELAGIRAALQGSLFTLMVTFALAFPIGVFAAVYLEEFAPRN 243

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
             +  ++ NINNLA+VPSIV+G+LG AV INFF++PRS  LVGG++L+LMTLP+III + 
Sbjct: 244 RLTDLIEININNLAAVPSIVFGLLGLAVFINFFELPRSAPLVGGIVLSLMTLPTIIITSR 303

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A++ V  SIR AALG+GASK+QTVFHHVLP+AMP ILTGS + +A+ALGE+APLL +GM
Sbjct: 304 AAIQAVSPSIREAALGVGASKLQTVFHHVLPVAMPGILTGSIIGMAQALGESAPLLMIGM 363

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P GVTD +T  PVQIYLWA   ER F E+T  AI++L+ FL ++N   + LR 
Sbjct: 364 VAFIMDVPGGVTDSSTVLPVQIYLWADSPERGFTEKTSAAIMVLMGFLILMNALAIILRK 423

Query: 420 RFKKR 424
           RF+ +
Sbjct: 424 RFELK 428


>gi|46202105|ref|ZP_00053763.2| COG0581: ABC-type phosphate transport system, permease component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 419

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 201/424 (47%), Positives = 273/424 (64%), Gaps = 8/424 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++       L  RY +E  FR   + ++L+   FL+LLL ++V+KG    +QT I++ + 
Sbjct: 4   RTAETVAARLGRRYAAERRFRLLGLASILISAGFLVLLLGTVVAKGWTGFFQTQIAMEVS 63

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           F   ++DP   R  DPAIL  ADY  LVR ALA +L + D + +  R  S ++ST     
Sbjct: 64  FDADVIDPDGNR--DPAILDAADYPALVRNALAARL-VPDGDRSARRDLSALVSTMGAEQ 120

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           LR+ +  DP LIG    V LLAS  +D   KG      N       Q  W  +L+  G +
Sbjct: 121 LRRMVAQDPGLIGAKANVWLLASDKLDMVNKGQATDTLNER-----QLGWLAELNKAGLI 175

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
              FN  FF  G S  PE AGI  AVVGS + +L+ + +SFPLG+A+A+YLEEF+ K  +
Sbjct: 176 RKAFNAQFFTGGDSRAPEQAGIWGAVVGSFFSLLVTLAVSFPLGVATAVYLEEFAPKNRW 235

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NINNLA+VPS+V+G+LG AV +N F +PRS+ + GGL+LAL+ LP+IIIA   A
Sbjct: 236 TDLIEVNINNLAAVPSVVFGLLGLAVFLNVFHLPRSSPVAGGLVLALICLPTIIIAGRAA 295

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+ VP SIR AA GLGAS +Q V HHVLPLAMP +LTG+ + +ARALGETAPLL +GMVA
Sbjct: 296 LKAVPPSIRQAAAGLGASPLQIVAHHVLPLAMPGMLTGTILGMARALGETAPLLMIGMVA 355

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D P    D +   PVQIYLWA  +ER FVE+T  AI++LL+FL V+N A +WLRN+F
Sbjct: 356 FIVDIPKSPLDPSAVLPVQIYLWAGSSERAFVEKTSAAIMVLLLFLVVMNMAAIWLRNKF 415

Query: 422 KKRW 425
           ++RW
Sbjct: 416 ERRW 419


>gi|288940131|ref|YP_003442371.1| phosphate ABC transporter inner membrane subunit PstA
           [Allochromatium vinosum DSM 180]
 gi|288895503|gb|ADC61339.1| phosphate ABC transporter, inner membrane subunit PstA
           [Allochromatium vinosum DSM 180]
          Length = 434

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 211/426 (49%), Positives = 286/426 (67%), Gaps = 5/426 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++  I   +LK RY  E  FR+    AV +  VF++LL + I+ KG  A  QT+I LPIE
Sbjct: 12  RAIDIVNASLKRRYARERRFRWLGATAVTLGMVFVVLLFADIILKGYTAFQQTYIQLPIE 71

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
            +   +DP   R  DPA L RADY  L+R+AL  +     ++    R  + M+S  A   
Sbjct: 72  LAAATIDPDGAR--DPATLARADYMKLIREALRERFP-EVTDRRDRRLLNSMISVGAPDL 128

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           LR+ +M DP+LIG T E+ +LA  +ID  +KGY+    PA+  R+ D    W  +L+++G
Sbjct: 129 LRERVMADPALIGTTQELWILADDDIDMLVKGYIDRNAPASDRRVGDQMIAWVDRLEAEG 188

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN  FF +G S  PE+AGI  A++GS Y +++   LSFP+G+ +A+YLEEF+ K 
Sbjct: 189 RVAKRFNTIFFTHGTSREPELAGIAGALMGSFYTLVLTFLLSFPIGVGAALYLEEFAPKN 248

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++  ++ N+NNLA+VPSIV+G+LG AV I FF +PRST LV  L++ LMTLP+IIIA+ 
Sbjct: 249 RWTDLIEVNVNNLAAVPSIVFGLLGLAVFIGFFGVPRSTPLVAALVMTLMTLPTIIIASR 308

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
           VAL++VP SIR AALG+GAS +QT FHHVLPLA+P ILTGS + +ARALGETAPLL +GM
Sbjct: 309 VALKSVPPSIREAALGVGASPLQTQFHHVLPLALPGILTGSIIGMARALGETAPLLMIGM 368

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           +AF+ D P G  D AT  PVQI+LWA   ER FVERT  AIL+LL FL V+N A + LR 
Sbjct: 369 IAFIVDIPKGFNDAATVLPVQIFLWADSPERGFVERTSAAILVLLAFLFVMNLAAVLLRR 428

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 429 RFERRW 434


>gi|119946058|ref|YP_943738.1| ABC phosphate transporter inner membrane protein, PstA-like protein
           [Psychromonas ingrahamii 37]
 gi|119864662|gb|ABM04139.1| ABC phosphate transporter inner membrane protein, PstA-like protein
           [Psychromonas ingrahamii 37]
          Length = 451

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 179/425 (42%), Positives = 273/425 (64%), Gaps = 4/425 (0%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +    K++LK R   E  FR +  +A+   F+ +++L + I +K   A +Q  I + IEF
Sbjct: 26  NTDRIKQSLKKRNSKEKRFRLWGRLAISFGFLMVVILFADIGTKAYPAFFQHWIKVDIEF 85

Query: 63  SETIVDPQKKRF---MDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR 119
           +   ++ +        +     +A+Y+  V+K+L +      +     R   ++LS +A 
Sbjct: 86  NRQWLNIEPSDSAVQPNMQAFKQANYSTTVKKSLYQMFP-QVTTRGDKRDLMRLLSYSAE 144

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDG 179
           + +   +  +P L+G+TV + LLA  ++DS  K  +    +  R++D Q  W ++L   G
Sbjct: 145 FKIEDLVTANPDLLGQTVSLWLLADDDVDSYFKSGVTVGQSSGRINDKQAMWLKQLFESG 204

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
           A+   FN  FF N  S  PE+AGI  A+ G++  M+IV+ +SFP+G+++A+YLEEF+ K 
Sbjct: 205 AVEKRFNTLFFTNSDSREPELAGIRGALSGTILTMIIVLLISFPIGVSAALYLEEFAPKN 264

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++  ++ NINNLA+VPSIV+G+LG AVLIN F +PRS +LVGG++L+LMTLP+IIIA+ 
Sbjct: 265 RWTDIIEVNINNLAAVPSIVFGLLGLAVLINIFGLPRSASLVGGIVLSLMTLPTIIIASR 324

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +++ VP+SIR AA+GLGAS +Q    HVLP+AMP ILTG+ + LA+ALGETAPLL +GM
Sbjct: 325 ASIKAVPNSIREAAIGLGASDMQVALGHVLPMAMPGILTGTIIGLAQALGETAPLLMIGM 384

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D PV  TD AT  PVQIYLWA   E  F+ +T  AIL+LL FL ++N +   LR+
Sbjct: 385 VAFIVDVPVNFTDAATVMPVQIYLWADSPESAFLAKTSAAILVLLAFLLIMNFSATLLRS 444

Query: 420 RFKKR 424
           +F+K+
Sbjct: 445 KFEKK 449


>gi|83310472|ref|YP_420736.1| ABC-type phosphate transport system [Magnetospirillum magneticum
           AMB-1]
 gi|82945313|dbj|BAE50177.1| ABC-type phosphate transport system [Magnetospirillum magneticum
           AMB-1]
          Length = 431

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 192/426 (45%), Positives = 270/426 (63%), Gaps = 5/426 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++       L  RY +E  FR   + ++L+   FL+LLL ++V+KG     QT I++ + 
Sbjct: 9   RTAETVAARLGRRYAAERRFRILGLASILISAGFLVLLLGTVVAKGWTGFLQTQIAVEVS 68

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           F   ++DP   R  D  +L  ADY  LVR  LA +L + D + +  R  S ++ST     
Sbjct: 69  FDAEVIDPDGTRAPD--VLDAADYPALVRNGLAARL-VPDGDRSARRDLSALVSTMGAEQ 125

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDG 179
           +R+ +  DP +IG    + L AS  +D   KG       A  + ++D Q  W  +L+  G
Sbjct: 126 MRRMVAADPKVIGTRTTLWLTASDKLDMVYKGQAPREVGAAGNVLNDRQLGWLAQLEQAG 185

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN  FF  G S  PE AGI  AVVGS + + + + +SFPLG+A+A+YLEEF+ K 
Sbjct: 186 QIRKAFNLQFFTGGDSRAPEQAGIWGAVVGSFFSLAVTLLISFPLGVATAVYLEEFAAKN 245

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++  ++ NINNLA+VPS+V+G+LG AV +N F +PRS+ + GGL+LAL+ LP+IIIA  
Sbjct: 246 RWTDLIEVNINNLAAVPSVVFGLLGLAVFLNVFHLPRSSPVAGGLVLALICLPTIIIAGR 305

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL+ VP SIR AA GLGAS +Q V HHVLPLAMP +LTG+ + +ARALGETAPLL +GM
Sbjct: 306 AALKAVPPSIRQAAAGLGASPLQIVAHHVLPLAMPGMLTGTILGMARALGETAPLLMIGM 365

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P    D +   PVQIYLWA  +ER FVE+T  AI++LL+FL  +N A +WLRN
Sbjct: 366 VAFIVDIPKSPLDPSAVLPVQIYLWAGSSERAFVEKTSAAIMVLLLFLVAMNMAAIWLRN 425

Query: 420 RFKKRW 425
           +F++RW
Sbjct: 426 KFERRW 431


>gi|16124546|ref|NP_419110.1| phosphate ABC transporter permease [Caulobacter crescentus CB15]
 gi|221233232|ref|YP_002515668.1| phosphate transport system permease protein PstA [Caulobacter
           crescentus NA1000]
 gi|13421432|gb|AAK22278.1| phosphate ABC transporter, permease protein [Caulobacter crescentus
           CB15]
 gi|220962404|gb|ACL93760.1| phosphate transport system permease protein pstA [Caulobacter
           crescentus NA1000]
          Length = 431

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 184/427 (43%), Positives = 269/427 (62%), Gaps = 11/427 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++ S  +  LK R+ +E LF+   V A+++  +FL++L+  IV++G        +S+ + 
Sbjct: 13  QTLSAAEARLKKRHRAERLFKAQGVAAIIIAMIFLVVLVGRIVTQGYSTFQTHTLSVAVY 72

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLR-QASQMLSTTARY 120
            +   +D           L   +Y+ +V +A+ +KL + D +   +  +   ++S    +
Sbjct: 73  LNPERIDTSD--------LSGVNYDYIVAEAVMKKLGVQDDDFGTISTKVQDLVSRDFGF 124

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSD 178
            L   L  D +LIG+TV V+    A+ D   KG +         ++ + Q  W  KL  D
Sbjct: 125 QLLNKLKADQTLIGQTVTVTGPLKADADLYFKGQIERSTDEGDRKLDNQQLDWLDKLQKD 184

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           GA+   FN GFF +  S+ PE AG+  AVVGS  M+LI   +S P+G+ +A+YLEEF+ K
Sbjct: 185 GAITSGFNTGFFTHSDSTEPEQAGVLGAVVGSAMMLLITALISVPVGVLAAVYLEEFAPK 244

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NINNLA+VPSIVYG+LG A+ IN+  +PR + LVGGL+LALM LP++IIAT
Sbjct: 245 NRWTDIIEVNINNLAAVPSIVYGLLGLALFINWLNVPRGSPLVGGLVLALMALPTVIIAT 304

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR AALG+GASK QTVFHHVLPLAMP ++TG+ +SLA ALGETAPLL +G
Sbjct: 305 RSALKAVPPSIREAALGVGASKTQTVFHHVLPLAMPGVMTGAILSLAHALGETAPLLMIG 364

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MV+FV   P G T  AT  PVQ+++W   +ER F ERT  AI++LL+F+ V+N A + LR
Sbjct: 365 MVSFVPGVPEGFTSAATVLPVQVFIWENASERAFHERTAAAIIVLLVFMIVMNAAAVILR 424

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 425 RRFERRW 431


>gi|15887770|ref|NP_353451.1| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
 gi|15155340|gb|AAK86236.1| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
          Length = 440

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 229/427 (53%), Positives = 306/427 (71%), Gaps = 2/427 (0%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           +   +     +K RY +E  FR Y + A+    +FL LLL S+VSKG  A  QT I++P+
Sbjct: 14  VNKATRRDIGIKRRYAAERRFRAYGMAAISFGLLFLFLLLFSVVSKGYTAFQQTMITVPV 73

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           EFSE I+DP+ +R  +PA L+ A+Y ++ R A+A+ L I+ ++ A LR  + ++S + R 
Sbjct: 74  EFSEQIIDPKNERATNPAKLMTANYPVVARDAVAKVLGIAPTDRAGLRAVNLLISDSVRT 133

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSD 178
            LR  ++ DP++IG T  V+LLAS ++DSA KG +   +     R+S+ Q  W  +L   
Sbjct: 134 QLRDIVVADPAVIGTTRTVTLLASGDVDSAFKGQVDLTADEANRRISNQQLGWMNQLAES 193

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G L   FN G FINGASSRPE AG+GVA++GS YMMLIV+ L+ P+G+A++IYLEEF+ K
Sbjct: 194 GQLGKHFNTGIFINGASSRPEAAGVGVALIGSFYMMLIVLVLALPIGVAASIYLEEFAPK 253

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
              +  ++ NINNLA+VPSIVYG+LG +V INF   PRS +LVGGL+L LMTLP+IIIAT
Sbjct: 254 NRLTDLIEVNINNLAAVPSIVYGLLGLSVFINFMGFPRSASLVGGLVLTLMTLPTIIIAT 313

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR+AALGLGASK+QT+FHHVLPLAMP ILTG+ + LA ALGETAPLL +G
Sbjct: 314 RAALKAVPPSIRAAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIG 373

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAFV +YP    D +TA PVQIY+WA +AER FVERT GAI++LL+FL V+N   + LR
Sbjct: 374 MVAFVANYPTTPMDPSTALPVQIYMWANEAERAFVERTSGAIIILLLFLIVMNVGAILLR 433

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 434 RRFERRW 440


>gi|319405128|emb|CBI78734.1| phosphate ABC transporter, permease protein [Bartonella sp. AR
           15-3]
          Length = 430

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 223/418 (53%), Positives = 301/418 (72%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            LK RY +E  FR Y + A+ +   FL +LL SIVS+G  A +Q+ + L +   E ++DP
Sbjct: 13  GLKGRYRAERRFRAYGLSAIFISLFFLAVLLWSIVSQGYTAFFQSEMILSVYLDEKVIDP 72

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
              R  DP IL+ A+Y LLVR ALA+KL +  ++   +R  ++M S + R  LR  ++ +
Sbjct: 73  SGHRKSDPKILITANYPLLVRNALAKKLGVDHNDQISMRDVNRMFSQSVRVQLRDIVIKN 132

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P+LIG   +V +LA+++IDSA KG +    P    ++SD Q KW + L +DG L+  FN 
Sbjct: 133 PNLIGTMQKVKVLAASDIDSAYKGQIDLHVPEKNRKVSDQQIKWMKHLINDGTLYKTFNR 192

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF  GASSRPE +G+GVA++GS YMM+IV+ +S P+GIA+A+YLEE++ K  F+ F++ 
Sbjct: 193 HFFTFGASSRPETSGLGVAMIGSFYMMIIVLVISLPIGIATALYLEEYARKNKFTDFIEI 252

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INF  MPRS + VGGL+LALMTLP+IIIAT  AL+ VP 
Sbjct: 253 NINNLAAVPSIVFGLLGLAVFINFMGMPRSASFVGGLVLALMTLPTIIIATRSALQAVPF 312

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+ ALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL +GMVAFV D P
Sbjct: 313 SIRAGALGLGASKTQMVFHHVIPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVVDIP 372

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           V   D ATA PVQI++WA++AER FVE+T GAI++L+IFL  +N + + LR RF++RW
Sbjct: 373 VTPMDPATALPVQIFMWASEAERSFVEKTSGAIIILMIFLIFMNISAVLLRRRFERRW 430


>gi|49475057|ref|YP_033098.1| phosphate ABC transporter permease [Bartonella henselae str.
           Houston-1]
 gi|49237862|emb|CAF27057.1| Phosphate transport system permease protein [Bartonella henselae
           str. Houston-1]
          Length = 430

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 226/424 (53%), Positives = 311/424 (73%), Gaps = 2/424 (0%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           SFS     LK RY +E  FR Y ++A+ +   FL  LL S++S+G  A +QT ++L I  
Sbjct: 6   SFSRRNIGLKRRYWAERRFRAYGLIAIFIGLFFLFALLWSVISQGYTAFFQTEMTLSIYL 65

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
            E ++DP  +R  +P IL+ A+Y LLVR ALARKL+I  ++ A LR  ++M S + R  L
Sbjct: 66  DEKVIDPSGQRLANPQILITANYPLLVRNALARKLNIDQNDRASLRDINRMFSNSVRVQL 125

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGA 180
           R+ +  +P LIG T ++ +LA+A+IDSA KG +         ++S+ Q +W ++L  DG 
Sbjct: 126 REIVTKNPQLIGTTQKIKVLAAADIDSAYKGQIDLHVAEKNRKISNRQVEWMKRLAYDGT 185

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           L+  FN+GFF  GASSRPE AG+GVA++GS YM++IV+ +S P+GIA+A+YLEE++ K  
Sbjct: 186 LYKTFNFGFFTFGASSRPETAGLGVAIIGSFYMIIIVLVISLPIGIATALYLEEYARKNK 245

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           F+ F++ NINNLA+VPSIV+G+LG AV +NFF +PRS + VGGL+LALMTLP+IIIAT  
Sbjct: 246 FTDFIEVNINNLAAVPSIVFGLLGLAVFVNFFGLPRSASFVGGLVLALMTLPTIIIATRS 305

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           ALR VP SIR+AALGLGASK Q VFHHVLPLA P ILTG+ + +A+ALGETAPLL +GMV
Sbjct: 306 ALRAVPFSIRAAALGLGASKTQVVFHHVLPLAAPGILTGTIIGVAQALGETAPLLLIGMV 365

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AFV + P    D ATA PVQI++WA +AER FVE+T GAI++L+IFL+++N + ++LR R
Sbjct: 366 AFVVNIPATPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLMIFLSIMNISAVFLRRR 425

Query: 421 FKKR 424
           F++R
Sbjct: 426 FERR 429


>gi|294084773|ref|YP_003551531.1| phosphate ABC transporter permease [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664346|gb|ADE39447.1| phosphate ABC transporter permease protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 434

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 172/426 (40%), Positives = 265/426 (62%), Gaps = 6/426 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           ++    ++ +K R   E  FRFY  +A+ +  +FL+ L ++I+SKGI   +Q +++L +E
Sbjct: 13  QATKQVQETIKRRNKQEKRFRFYGRIAIAIALIFLVTLFATILSKGIPGFFQYYVTLDVE 72

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
                +DP+    +    L   D   +VR AL   +       +  R A +M+S+ +   
Sbjct: 73  LDRERLDPKG--DLSTGSLYSGDARGVVRDALFAAVKPEG--RSGKRAAGKMISSGSEER 128

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDG 179
           +RK +  +P L G    +      +IDS L+G++    P    R++D    +   L++ G
Sbjct: 129 IRKFVQENPDLFGTIQPMRFALDDDIDSFLRGFIKRETPEADRRINDRVIGYVDDLNARG 188

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +  + +   F   AS   E+AGI  A VGSL  + + + LSFP+G+A+A+YLEE + K 
Sbjct: 189 RISYNVSDYLFFGSASRDAEMAGIKGAFVGSLMTLAVCLVLSFPIGVATAVYLEEIAKKN 248

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
             + F++ NINNLA+VPS+V+GILG A+ I  F +PRS  L+GG++LALMTLP+III++ 
Sbjct: 249 RITEFIEININNLAAVPSVVFGILGLAIFIGIFGLPRSIPLIGGVVLALMTLPTIIISSR 308

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP S+R AA G+GAS++QT+FHHV+PLA+P +LTG+ + +A+ALGETAPLL +GM
Sbjct: 309 AAIRAVPPSVRDAAYGVGASRMQTIFHHVIPLALPGMLTGTIIGMAQALGETAPLLMIGM 368

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P  V D  T  PVQI++WA  AER F+++T  AI++LL FL  +N   + LR 
Sbjct: 369 VAFIVDIPNSVMDPGTVLPVQIFMWADFAERMFIQKTSAAIIVLLAFLVGMNAFAIVLRK 428

Query: 420 RFKKRW 425
           R ++RW
Sbjct: 429 RLERRW 434


>gi|260430661|ref|ZP_05784633.1| phosphate ABC transporter, permease protein PstA [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418102|gb|EEX11360.1| phosphate ABC transporter, permease protein PstA [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 434

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 182/427 (42%), Positives = 262/427 (61%), Gaps = 11/427 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            +    + +L  R   + L +   + A+   F+ L +L++S+VS G  A  QT I+L + 
Sbjct: 16  NAADAVRASLTRRNRKQKLLQGLGLGAIGFAFLMLFILVASLVSSGYQAFTQTKITLEVY 75

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDS-NHALLRQASQMLSTTARY 120
                + P+         L R  +  +++ +L+  L   D+ + A  +  + +LS  A++
Sbjct: 76  VDPEEIKPE--------KLPRGGFKDVLQASLSELLPEVDTSDRATRKALAGILSNGAQF 127

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSD 178
            LR  ++ DPSLIG+T+ +++  S   D   KG +    P    R+ D++  WF +L + 
Sbjct: 128 DLRDRVVADPSLIGQTITLTVPVSDPYDQLNKGTIDRDTPEQNRRLKDHEIAWFDQLKAK 187

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G +    N G   N  S  PE+AG+  A++GS + + +   +SFPLGI +AIYLEEF+ +
Sbjct: 188 GVISKPLNTGLITNADSRFPELAGLKGALIGSFWALFVCFAISFPLGIGAAIYLEEFAPR 247

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
              S F++ NINNLA+VPS+V+G+L  AV I +F +PRS   VGGL LALMT+P+IIIAT
Sbjct: 248 NKISDFIEVNINNLAAVPSVVFGLLALAVFIGWFGLPRSAPFVGGLTLALMTMPTIIIAT 307

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR AALG+GASK Q VF HVLPLAMP ILTG+ + LA+ALGETAPLL +G
Sbjct: 308 RAALKAVPPSIREAALGIGASKHQVVFGHVLPLAMPGILTGTIIGLAQALGETAPLLLIG 367

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           M AF+T  P G  D ATA P QI++WA   ER FV RT  AIL+LL FL  +N   ++LR
Sbjct: 368 MNAFITSAPDGPFDSATALPTQIFIWADSPERGFVSRTSAAILVLLGFLVTMNAIAIYLR 427

Query: 419 NRFKKRW 425
           N+F++ W
Sbjct: 428 NKFERSW 434


>gi|126731221|ref|ZP_01747028.1| phosphate ABC transporter, permease protein [Sagittula stellata
           E-37]
 gi|126708132|gb|EBA07191.1| phosphate ABC transporter, permease protein [Sagittula stellata
           E-37]
          Length = 451

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 171/435 (39%), Positives = 262/435 (60%), Gaps = 12/435 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S +      K+R  +E  F+ Y + A+     FL++LL +I++ G+ A  QT I +P+  
Sbjct: 17  SLTAADARTKHRNAAEKRFQMYGLAAIGTGIFFLVVLLWAILANGLTAFQQTFIEVPVYL 76

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNH--ALLRQASQMLSTTAR 119
            E  +D    R ++    +    Y  L+++A+  ++     +      +    ++S +A 
Sbjct: 77  DEAKLDKNGNRDIEDIKKVSTFGYQPLIQQAILAQVQDEGFDTPLEDAKDMKALISASAA 136

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             LR  ++ +P  IG+T++  +LAS+ +D   KG +     A    +         ++  
Sbjct: 137 AQLRDYVIANPDRIGQTIDFRILASSRVDGYFKGRVKRDDLARDKNIDAEHLDLVDQMRR 196

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G +   FN  F     +S  RPE AG+GV+++GS +MML+V+ LS P+G+A++IYLEEF
Sbjct: 197 AGLIQKSFNTEFIFGADASESRPEQAGLGVSMLGSFFMMLVVLALSLPIGVAASIYLEEF 256

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + +  ++  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+II
Sbjct: 257 APQNRWTDLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTII 316

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L++VP SIR AALG+GASK+Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 317 ISTRASLKSVPPSIRDAALGVGASKMQAVFHHVLPLAMPGILTGTIIGLAQALGETAPLL 376

Query: 356 FVGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV ++          G     +A P QIY WA  A+  + ER +G I++LL+FL  +
Sbjct: 377 LIGMVGYIATNYPDGIAEGFMSPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLLTM 436

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR RF++RW
Sbjct: 437 NIIAIILRRRFERRW 451


>gi|153870079|ref|ZP_01999552.1| phosphate ABC transporter, permease protein PstA [Beggiatoa sp. PS]
 gi|152073452|gb|EDN70445.1| phosphate ABC transporter, permease protein PstA [Beggiatoa sp. PS]
          Length = 418

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 204/425 (48%), Positives = 277/425 (65%), Gaps = 7/425 (1%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           M +    KK+LK RY  E  FR   ++AVL  F  L++LL  ++ K   A  QT + L I
Sbjct: 1   MNNTEQIKKSLKKRYRQEKRFRLLSLLAVLTGFACLLILLVDMLIKAWPAFIQTEVKLDI 60

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           EFS   ++       +P  L  A++  L++++L +         +  R   +++S  A Y
Sbjct: 61  EFSPEKLNISAN--FEPEELQNANFRSLIKQSLHQLFPT-VRKRSDKRALMRLISVDAEY 117

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
            LR  L  +P L+GKTV + LL   ++D+ LK    S     R+S+ Q  W  +L+  G 
Sbjct: 118 RLRDKLQAEPQLLGKTVPIWLLVDDDVDTYLK----SDKQFGRVSNQQIAWITELEQQGR 173

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
               FNY FF  G S  PE+AGI  AV+GS Y +LI + LSFP+G+ +AIYLEEF+ +  
Sbjct: 174 FQQRFNYWFFQTGDSREPELAGIWGAVMGSFYTLLITLLLSFPIGVMAAIYLEEFAPRNR 233

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           +  FV+ NINNLA+VPSIV+G+LG A+ INFF +PRS  LVGG++LALMTLP+IIIA+  
Sbjct: 234 WIDFVEVNINNLAAVPSIVFGLLGLAIFINFFGVPRSAPLVGGMVLALMTLPTIIIASRS 293

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           A++ VP S+R AALGLGASK+Q  FHHV+PLAMP ILTG+ + LA+ALGETAPLL +GMV
Sbjct: 294 AIKAVPPSMREAALGLGASKIQVAFHHVVPLAMPGILTGTIIGLAQALGETAPLLMIGMV 353

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AF+ D P G+TD AT  P+QIYLWA   ER FV +T  AIL+LL+FL V+N   +WLR +
Sbjct: 354 AFIVDIPQGITDAATVLPIQIYLWADSPERAFVAKTAAAILVLLLFLVVMNGLAVWLRKK 413

Query: 421 FKKRW 425
           F++RW
Sbjct: 414 FERRW 418


>gi|325291855|ref|YP_004277719.1| phosphate ABC transporter, permease protein [Agrobacterium sp.
           H13-3]
 gi|325059708|gb|ADY63399.1| phosphate ABC transporter, permease protein [Agrobacterium sp.
           H13-3]
          Length = 440

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 230/427 (53%), Positives = 305/427 (71%), Gaps = 2/427 (0%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           +   +     +K RY +E  FR Y + A+    +FL LLL S+VSKG  A  QT I++P+
Sbjct: 14  VNKATRRDIGIKRRYAAERRFRGYGLAAISFGLIFLFLLLWSVVSKGHTAFQQTMITVPV 73

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           EFSE I+DP+ +R  +PA L+ A+Y +L R A+A+ L ++ ++ A LR  + M+S + R 
Sbjct: 74  EFSELIIDPKNERATNPAKLMTANYPVLARDAVAKVLGVAPTDKAGLRAVNVMISDSVRT 133

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSD 178
            LR  ++ DPS+IG T  V+LLAS ++DSA KG +         R+S+ Q  W  +L   
Sbjct: 134 QLRDIVVADPSVIGTTRSVTLLASGDVDSAFKGQVDMSGDEANRRISNQQLGWMNQLVES 193

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G L   FN G F+NGASSRPE AG+GVA++GS YMMLIV+ LS P+G+A++IYLEEF+ K
Sbjct: 194 GQLGKHFNTGIFVNGASSRPEAAGVGVALIGSFYMMLIVLVLSLPIGVAASIYLEEFAPK 253

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
              +  ++ NINNLA+VPSIVYG+LG +V INF   PRS +LVGGL+L LMTLP+IIIAT
Sbjct: 254 NRLTDLIEVNINNLAAVPSIVYGLLGLSVFINFMGFPRSASLVGGLVLTLMTLPTIIIAT 313

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR+AALGLGASK+QT+FHHVLPLAMP ILTG+ + LA ALGETAPLL +G
Sbjct: 314 RAALKAVPPSIRAAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIG 373

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAFV +YP    D +TA PVQIY+WA +AER FVERT GAI++LL+FL ++N   + LR
Sbjct: 374 MVAFVANYPTTPMDPSTALPVQIYMWANEAERAFVERTSGAIIILLLFLILMNVGAILLR 433

Query: 419 NRFKKRW 425
            RF++RW
Sbjct: 434 RRFERRW 440


>gi|51245734|ref|YP_065618.1| phosphate ABC transporter, permease protein (PstA) [Desulfotalea
           psychrophila LSv54]
 gi|50876771|emb|CAG36611.1| probable phosphate ABC transporter, permease protein (PstA)
           [Desulfotalea psychrophila LSv54]
          Length = 420

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 180/421 (42%), Positives = 266/421 (63%), Gaps = 11/421 (2%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
           N   L+ RY  +  FR   V A+ V   F+  L S I + G  A  QT I L +E     
Sbjct: 9   NSAKLQSRYRKDRCFRLAGVSAIAVALCFIAFLFSDIFTHGYKAFEQTKIELEVELRPAD 68

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTL 126
              +  R         A+Y  +V+++L        ++    +   +++S  A + ++  +
Sbjct: 69  FVGENLRL--------ANYPAMVKRSLYALFP-EVTDRQDKKSLYRLISPGASFEIQDKV 119

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLD 184
           + DP++IG  ++  + A+ ++D  +KG +    P    R++D Q  W   L ++  + + 
Sbjct: 120 LADPAIIGSRLKFWVPANDDVDMLMKGEIDRSLPQANRRVNDQQLAWIDSLVANNKIEMV 179

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN  FF  G S  PE+AGI  A  GS Y +LI + LSFP+G+A+AIYLEEF+    ++  
Sbjct: 180 FNTTFFTAGDSREPELAGILGAACGSFYTLLITLCLSFPIGVATAIYLEEFAPSNRWTDL 239

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPSI++G+LG AV IN + +PRST LVGGL+L+LMTLP+IIIA+  +L++
Sbjct: 240 IEVNINNLAAVPSIIFGLLGLAVFINIWGIPRSTPLVGGLVLSLMTLPTIIIASRASLKS 299

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AALG+GASK+QT+ HHVLPLAMP +LTG+ + +A+ALGETAPLL +GM+AF+ 
Sbjct: 300 VPPSIREAALGVGASKMQTITHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGMIAFIV 359

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P G+TD +T  PVQIYLWA   ER F E+T  AI++LL+FL  +N A ++LR +F+ +
Sbjct: 360 DIPGGITDPSTVLPVQIYLWADSPERAFSEKTSAAIMILLLFLISMNAAAVFLRKKFETK 419

Query: 425 W 425
           W
Sbjct: 420 W 420


>gi|222147390|ref|YP_002548347.1| phosphate ABC transporter permease protein [Agrobacterium vitis S4]
 gi|221734380|gb|ACM35343.1| phosphate ABC transporter permease protein [Agrobacterium vitis S4]
          Length = 445

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 235/418 (56%), Positives = 307/418 (73%), Gaps = 2/418 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  FR Y +VA+    +FL+LLL+S+VSKG  A  QT I++P+EFSE ++DP
Sbjct: 28  GIKRRYAAERRFRAYGIVAISFGLLFLLLLLTSVVSKGYTAFLQTTITVPVEFSEKLIDP 87

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             +R  +P +L+ A+Y +LVR ALA KL I  SN   ++Q ++M+S   R  LR  ++ D
Sbjct: 88  SNQRATNPDVLVAANYPVLVRNALAAKLKIDTSNRPAMKQLTEMVSDNVRVQLRNMVVAD 147

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P L+GKTV VS+LASA ID+A KG        +  ++SD Q  W   L   GAL   FN 
Sbjct: 148 PLLVGKTVPVSVLASATIDTAFKGQFDLTVDESSRKISDQQIGWMNTLAESGALAKSFNT 207

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           G F+NGASSRPE AG+GVA++G+ YMML V+ L+ P+G+A++IYLEEF+ K  ++  ++ 
Sbjct: 208 GIFVNGASSRPEAAGVGVALIGTAYMMLTVLILALPIGVATSIYLEEFAPKNRWTDLIEV 267

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV INF  +PRS +LVGGL+L LMTLP+IIIAT  AL+ VP 
Sbjct: 268 NINNLAAVPSIVFGLLGLAVFINFAGLPRSASLVGGLVLTLMTLPTIIIATRAALKAVPP 327

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK+QTVFHHVLPLAMP +LTG+ + LA ALGETAPLL +GMVAFV DYP
Sbjct: 328 SIRAAALGLGASKMQTVFHHVLPLAMPGVLTGTIIGLAHALGETAPLLLIGMVAFVADYP 387

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +TA PVQIY+WA +AER FVERT GAI++LLIFL ++N   + LR RF++RW
Sbjct: 388 GTPLDPSTALPVQIYMWANEAERAFVERTSGAIIILLIFLLIMNVGAILLRRRFERRW 445


>gi|163731858|ref|ZP_02139305.1| phosphate ABC transporter, permease protein [Roseobacter litoralis
           Och 149]
 gi|161395312|gb|EDQ19634.1| phosphate ABC transporter, permease protein [Roseobacter litoralis
           Och 149]
          Length = 454

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 184/434 (42%), Positives = 263/434 (60%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        K R  +E  F+ Y ++A+ +  + LI L+ +IVS+G GA  QT ++L +  
Sbjct: 21  SLLTQDARTKKRNAAETRFKAYGMIAISIGLLMLITLVFNIVSRGTGAFQQTFVTLEVSL 80

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARY 120
               +D    R  D    +    Y  L+R A    ++       L  ++ + +LS  A+ 
Sbjct: 81  PADKLDKTGNRNPDEMRKVSTFGYAPLLRTAFEEHIAEKGYETDLSPKEMAGILSGGAQA 140

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSD 178
            LR  ++ DPS++G+ V+   LAS  +D  +KG +      N   +S  Q      L  +
Sbjct: 141 QLRNFVLADPSVVGERVDFEFLASGRVDGYIKGRVSRDSIENDKNISPAQLDLVDLLIEE 200

Query: 179 GALFLDFNYGFFINGASSR--PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G +   FN  F     SS   PE AG+GV++VGSL MML+V+ L+ P+G+A++IYLEEF+
Sbjct: 201 GTVEKRFNLSFITGADSSGARPEAAGMGVSMVGSLVMMLVVLVLALPIGVAASIYLEEFA 260

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III
Sbjct: 261 PKNWITDVIEVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIII 320

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  +L+ VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 321 STRASLKAVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 380

Query: 357 VGMVAFVTDYP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+   P      G+ D  +A P QIY WA  ++  F ER +G I++LL FL  +N
Sbjct: 381 IGMVGFIASNPPDSIAAGLMDPNSAMPAQIYEWAKRSDPAFYERAWGGIIILLGFLVTMN 440

Query: 412 TAMLWLRNRFKKRW 425
           T  + LR RF++RW
Sbjct: 441 TLAVILRRRFERRW 454


>gi|110679871|ref|YP_682878.1| phosphate ABC transporter, permease protein [Roseobacter
           denitrificans OCh 114]
 gi|109455987|gb|ABG32192.1| phosphate ABC transporter, permease protein [Roseobacter
           denitrificans OCh 114]
          Length = 454

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 185/434 (42%), Positives = 262/434 (60%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        K R  +E  F+ Y ++A+ +  + LI L+ +IVS+G GA  QT ++L +  
Sbjct: 21  SLLTQDARTKKRNAAETRFKAYGLIAISIGLLMLITLIFNIVSRGTGAFQQTFVTLEVSL 80

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARY 120
               +D    R  D    +    Y  L+R A    ++       L  ++ + +LS  A+ 
Sbjct: 81  PADKLDKAGNRNPDEMRKVSTFGYAPLLRTAFEEHVAEQGYETDLSPKEMAGILSGGAQA 140

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSD 178
            LR  ++ DPS++G+ V    LAS  +D  LKG +      N   +S  Q     +L   
Sbjct: 141 QLRNFVLADPSVVGQRVAFEFLASGRVDGYLKGRVSRDSIENDKNISPAQLDLVDQLVEA 200

Query: 179 GALFLDFNYGFFINGASSR--PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G +   FN  F     SS   PE AGIGV+++GSL MML+V+ L+ P+G+A++IYLEEF+
Sbjct: 201 GTIEKRFNLAFITGADSSGARPEAAGIGVSMIGSLVMMLVVLVLALPIGVAASIYLEEFA 260

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III
Sbjct: 261 PKNWITDVIEVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIII 320

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  +L+ VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 321 STRASLKAVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 380

Query: 357 VGMVAFVTDYP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+   P      G+ D  +A P QIY WA  ++  F ER +G I++LL FL  +N
Sbjct: 381 IGMVGFIASNPPDSIAAGLMDPNSAMPAQIYEWAKRSDPAFYERAWGGIIILLGFLVSMN 440

Query: 412 TAMLWLRNRFKKRW 425
           T  + LR RF++RW
Sbjct: 441 TLAVILRRRFERRW 454


>gi|295691210|ref|YP_003594903.1| phosphate ABC transporter inner membrane subunit PstA [Caulobacter
           segnis ATCC 21756]
 gi|295433113|gb|ADG12285.1| phosphate ABC transporter, inner membrane subunit PstA [Caulobacter
           segnis ATCC 21756]
          Length = 431

 Score =  355 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 186/426 (43%), Positives = 270/426 (63%), Gaps = 11/426 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +FS     LK R+ +E LF+   V A+++  VFL++L+  IV++G        +S+P+  
Sbjct: 14  AFSAADDRLKKRHRAERLFKAQGVAAIIIAMVFLVVLVGRIVAQGYTTFETHTLSVPVYL 73

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLR-QASQMLSTTARYH 121
           +   +D           L   +Y+ +V +A+ +KL + D +   +  +   ++S    + 
Sbjct: 74  NPDRIDTSD--------LSGVNYDYIVAEAVMKKLGVQDDDLGTVSTKVQDLVSRDFGFQ 125

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDG 179
           L   L  D SLIGKT++VS    A+ D   KG L         ++ + Q  W  +L   G
Sbjct: 126 LLNKLKADQSLIGKTIDVSGPLKADADLYFKGELKRSTAEGDRKLDNQQLDWLDQLQKAG 185

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
           A+   FN+ FF N  S+ PE AG+  AVVGS  M++I   ++ P+G+ +A+YLEEF+ K 
Sbjct: 186 AIKSGFNFAFFTNSDSTEPEQAGVLGAVVGSAMMLIITALIAVPVGVMAAVYLEEFAPKN 245

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++  ++ NINNLA+VPSIVYG+LG A+ IN+  +PRS+ LVGGL+LALM LP++IIAT 
Sbjct: 246 RWTDVIEVNINNLAAVPSIVYGLLGLALFINWLNVPRSSPLVGGLVLALMALPTVIIATR 305

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL+ VP SIR AALG+GASK QTVFHHVLPLAMP ++TG+ +SLA ALGETAPLL +GM
Sbjct: 306 SALKAVPPSIREAALGVGASKTQTVFHHVLPLAMPGVMTGAILSLAHALGETAPLLMIGM 365

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           V+FV   P G T  AT  PVQ+++W   +ER F ERT  AI++LL+F+ ++N A + LR 
Sbjct: 366 VSFVPGVPEGFTGAATVLPVQVFIWENASERAFHERTAAAIIVLLVFMIIMNAAAVILRR 425

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 426 RFERRW 431


>gi|159044084|ref|YP_001532878.1| phosphate transport system permease [Dinoroseobacter shibae DFL 12]
 gi|157911844|gb|ABV93277.1| phosphate transport system permease protein [Dinoroseobacter shibae
           DFL 12]
          Length = 450

 Score =  355 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 190/434 (43%), Positives = 272/434 (62%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S  +       R  +E  F+ Y + AV+   + L+LLL+SI+S G+ A  QT+++L I  
Sbjct: 17  SLLVQDARTAKRNAAEARFKMYGLAAVITGILALVLLLASILSNGLSAFQQTYVTLEIAL 76

Query: 63  SETIVDPQKKRFMD-PAILLRADYNLLVRKALARKLSISDSNHA--LLRQASQMLSTTAR 119
            E  +D    R ++    +    Y  L+  A+  KL+ +         + A  ++S  A 
Sbjct: 77  PEDKLDKSGTRDLEVMRKVSTFGYAPLIATAMEAKLAEAGIEIEGLTAKDAGAIISKDAP 136

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ +P ++G T    LLA+  ID  LKG   + S +    +S  Q +    L  
Sbjct: 137 AQLRDFVLANPQVVGTTQTFELLANGRIDGYLKGRVSMESASLDKNVSPAQLQLTDALLE 196

Query: 178 DGALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
           +GAL   FN+GFF N  +S      AG+GVA++GSLYMM+IV+ L+ P+G+A++IYLEEF
Sbjct: 197 EGALEKRFNWGFFTNPDASGQRPEAAGLGVAIMGSLYMMMIVLCLALPIGVAASIYLEEF 256

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K   +  ++ NI+NLA+VPSIV+GILG A+ INF  +P+S  +VGGL+L LMTLP+II
Sbjct: 257 APKNRLTDLIEVNISNLAAVPSIVFGILGLAIFINFAGLPQSAPIVGGLVLTLMTLPTII 316

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L++VP SIR AALG+GASK+Q VFH+VLPLA P ILTG+ + LA+ALGETAPLL
Sbjct: 317 ISTRASLKSVPPSIRDAALGVGASKMQAVFHNVLPLAAPGILTGTIIGLAQALGETAPLL 376

Query: 356 FVGMVAFV----TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV       P G  D A+A PVQIY W   ++  FVER  GAI++LL+FL ++N
Sbjct: 377 LIGMVAFVREYPAAPPEGFFDPASALPVQIYNWTQRSDPAFVERASGAIIVLLVFLLIMN 436

Query: 412 TAMLWLRNRFKKRW 425
              + LR RF++RW
Sbjct: 437 AVAILLRRRFERRW 450


>gi|319403657|emb|CBI77242.1| phosphate ABC transporter, permease protein [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 430

 Score =  355 bits (912), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 223/417 (53%), Positives = 302/417 (72%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           LK RY +E  FR Y + A+ +   FL +LL SIVS+G  A +Q+ + L +   E ++DP 
Sbjct: 14  LKGRYRAERRFRIYGLSAIFISLFFLAILLWSIVSQGYTAFFQSEMILSVYLDEKVIDPS 73

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            +R  +P IL+ A+Y LLV+ ALA KL +  ++   +R  ++M S + R  LR  ++ +P
Sbjct: 74  GQRESNPKILVTANYPLLVQNALATKLGVDLNHQISMRNVNRMFSQSVRVQLRDIVVKNP 133

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
            LIG T +V +LA+++IDSA KG +    P    ++SD Q +W + L +DG L+  FN  
Sbjct: 134 HLIGTTQKVKVLAASDIDSAYKGQINLHVPEKNRKISDQQIQWMKYLINDGTLYKTFNRH 193

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF  GASSRPE +G+GVA++GSLYMM+IV+ +S P+GIA+A+YLEE++ K  F+ F++ N
Sbjct: 194 FFTFGASSRPETSGLGVAMIGSLYMMIIVLVISLPIGIATALYLEEYARKNKFTDFIEIN 253

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIV+G+LG AV INF  MPRS + VGGL+LALMTLP+IIIAT  ALR VP S
Sbjct: 254 INNLAAVPSIVFGLLGLAVFINFMGMPRSASFVGGLVLALMTLPTIIIATRSALRAVPFS 313

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+ ALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL +GMVAFV D P+
Sbjct: 314 IRAGALGLGASKTQMVFHHVIPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVVDIPI 373

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              D ATA PVQI++WA++AER FVE+T GAI++L+IFL  +N A + LR RF++RW
Sbjct: 374 TPMDPATALPVQIFMWASEAERSFVEKTSGAIIILMIFLIFMNIAAVLLRRRFERRW 430


>gi|319406575|emb|CBI80217.1| phosphate ABC transporter, permease protein [Bartonella sp. 1-1C]
          Length = 430

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 224/417 (53%), Positives = 302/417 (72%), Gaps = 2/417 (0%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           LK RY +E  FR Y + A+ +   FL +LL SIVS+G  A +Q+ + L +   E ++DP 
Sbjct: 14  LKGRYRAERRFRIYGLSAIFISLFFLAILLWSIVSQGYTAFFQSEMILSVYLDEKVIDPS 73

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            +R  +  IL+ A+Y LLV+ ALA KL +  ++   +R  ++M S + R  LR  ++ +P
Sbjct: 74  GQRESNSKILVTANYPLLVQNALATKLGVDLNDQISMRNVNRMFSQSVRVQLRDIVVKNP 133

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
            LIG T +V +LA+++IDSA KG +    P    ++SD Q +W + L +DG L+  FN  
Sbjct: 134 HLIGTTQKVKVLAASDIDSAYKGQINLHVPEKNRKISDQQIQWMKYLINDGTLYKTFNRH 193

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FFI GASSRPE +G+GVA++GSLYMM+IV+ +S P+GIA+A+YLEE++ K  F+ F++ N
Sbjct: 194 FFIFGASSRPETSGLGVAMIGSLYMMIIVLVISLPIGIATALYLEEYARKNKFTDFIEIN 253

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           INNLA+VPSIV+G+LG AV INF  MPRS + VGGL+LALMTLP+IIIAT  ALR VP S
Sbjct: 254 INNLAAVPSIVFGLLGLAVFINFMGMPRSASFVGGLVLALMTLPTIIIATRSALRAVPFS 313

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR+ ALGLGASK Q VFHHV+PLA P ILTG+ + LA+ALGETAPLL +GMVAFV D PV
Sbjct: 314 IRAGALGLGASKTQMVFHHVIPLAAPGILTGTIIGLAQALGETAPLLLIGMVAFVVDIPV 373

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              D ATA PVQI++WA++AER FVE+T GAI++L+IFL  +N A + LR RF++RW
Sbjct: 374 TPMDPATALPVQIFMWASEAERSFVEKTSGAIIILMIFLIFMNIAAVLLRRRFERRW 430


>gi|332305413|ref|YP_004433264.1| phosphate ABC transporter, inner membrane subunit PstA [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172742|gb|AEE21996.1| phosphate ABC transporter, inner membrane subunit PstA [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 440

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 189/425 (44%), Positives = 267/425 (62%), Gaps = 6/425 (1%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +  +  +NL  R  +E  FRFY + A+L  F  L++L S I+ KG GA +QT I L + F
Sbjct: 16  TMDLVNRNLAKRKRAERRFRFYGIGAILFGFACLLILFSDIIGKGHGAFFQTQIQLQVRF 75

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLS---ISDSNHALLRQASQMLSTTAR 119
           +   +            L  A+Y+ ++  AL R       ++      RQ   ++ST A 
Sbjct: 76  NAQQLQITDP--TSKTQLDNANYDAVIENALLRDNGALLDAELPALEKRQLLSLVSTGAV 133

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY-LYSPANVHRMSDYQWKWFQKLDSD 178
           Y L+  L   P  + +TV + L A  ++D+ +K           R+S  Q KW ++   +
Sbjct: 134 YSLKTVLKNAPETLNQTVSIWLTADDDVDNYVKSIGRDGQGFSGRLSLQQQKWVERWVEN 193

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G +   FN  FF  G S  PE AGI  A++GSLYM+L+ IGLSFP+GI++A+YLEE++ +
Sbjct: 194 GQVRQTFNTTFFTEGDSREPEQAGIRSALMGSLYMLLVTIGLSFPIGISAAVYLEEYAPR 253

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
              + F++ NINNLA+VPSI++G+LG A+ I FF MPRS  LVGGL+L LMTLP+III++
Sbjct: 254 NRLTDFIEVNINNLAAVPSIIFGLLGLAIFIGFFDMPRSIPLVGGLVLTLMTLPTIIISS 313

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             A++ VPSSIR AA GLGASK+Q V HHV+PLAMP +LTG+ +  A+ALGETAPLL +G
Sbjct: 314 RAAIKAVPSSIRDAAFGLGASKMQVVLHHVVPLAMPGMLTGAIIGFAQALGETAPLLMIG 373

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAF+ D P  + D ++A PVQI+LWA   ER F+ERT  AI++LL FL  +N   +WLR
Sbjct: 374 MVAFIVDVPADLLDPSSALPVQIFLWADSPERAFIERTSAAIMVLLAFLITMNGLAVWLR 433

Query: 419 NRFKK 423
           +R  +
Sbjct: 434 HRLGR 438


>gi|262277657|ref|ZP_06055450.1| phosphate ABC transporter, permease protein PstA [alpha
           proteobacterium HIMB114]
 gi|262224760|gb|EEY75219.1| phosphate ABC transporter, permease protein PstA [alpha
           proteobacterium HIMB114]
          Length = 420

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 175/420 (41%), Positives = 256/420 (60%), Gaps = 6/420 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +   K RY +E  F+ Y ++A+ +   F+ LL+  + S G  A  +T I L + F    +
Sbjct: 4   ELRRKKRYQAEKRFQLYGIIAISLALFFVGLLVFKVFSDGTSAFSRTMIKLDVTFDANKL 63

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                   D   +  ADY  L+ +   +      SN    +Q  ++LS    +  +   +
Sbjct: 64  GITNVNDKDE--VDNADYYTLIYEEFIKSYPF--SNREEEKQIIKLLSPDYEFEAKNYFL 119

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +   + KTV + L AS + D   KG      P +  R+S+YQ K + +   DG +   F
Sbjct: 120 KNKDQLNKTVTLLLTASDDFDQLHKGNFPRDIPEDRRRLSNYQLKIYDQFLKDGKVEKIF 179

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N   F  G S  PE+AG G A++GSL+ +LI + +SFP+ +A+A+YLEEF+ K   +  +
Sbjct: 180 NNYLFSKGDSRDPELAGFGGAILGSLFTILICLLISFPIALAAAVYLEEFAPKNKLTDLI 239

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+LG  +L+N F++PRST LVGG+ L+LMTLP III    +L+ V
Sbjct: 240 EININNLAAVPSIVFGLLGLGILLNVFELPRSTPLVGGIALSLMTLPRIIIPARASLKAV 299

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR  AL +GASKVQTVFHHV+PLAMP  L+G+ + LA+ALGETAPLL +GMVAFV +
Sbjct: 300 PPSIREGALAMGASKVQTVFHHVVPLAMPGTLSGTIIGLAQALGETAPLLLIGMVAFVVE 359

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P    D + + PVQ+YLW+  AER FVE+T   I++LL FL V+N+  ++ R +F+K+W
Sbjct: 360 LPGSPMDPSASLPVQVYLWSESAERGFVEKTSATIMMLLGFLIVMNSLAVYARQKFEKKW 419


>gi|83952001|ref|ZP_00960733.1| phosphate ABC transporter, permease protein [Roseovarius
           nubinhibens ISM]
 gi|83837007|gb|EAP76304.1| phosphate ABC transporter, permease protein [Roseovarius
           nubinhibens ISM]
          Length = 449

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 181/435 (41%), Positives = 266/435 (61%), Gaps = 12/435 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        + R  +E  FR Y + A+L    FL++L+SSI+  G+GA  Q+ +++P+  
Sbjct: 15  SLVAADARTQKRNRAERRFRAYGMAAILTGLFFLVVLVSSILYNGVGAFQQSFVNVPVYL 74

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHAL--LRQASQMLSTTAR 119
               +D      ++    +    Y  L++  L  ++  S     L   +    +LS +A 
Sbjct: 75  DPAKLDKNGTGDIEEIKKVSTFGYAPLIQDGLLSEVQKSGIETPLTKSKDMKNLLSASAA 134

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             +R  ++ +P  IG+TVE  LLAS+ +D  LKG +     A+   +S  Q     +L  
Sbjct: 135 AEVRDYVVANPEQIGETVEFRLLASSRVDGYLKGRVKREDVADDKNISVEQLDLTDQLRD 194

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G +   FN  F     +S  RPE AGIGV+++GS +MML+V+ LS P+G+A++IYLEEF
Sbjct: 195 AGIVSKGFNLSFITGADASESRPEQAGIGVSMLGSFFMMLVVLVLSLPIGVAASIYLEEF 254

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + +  F+  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+II
Sbjct: 255 APQNRFTDLIEVNISNLAAVPSIVFGILGLAVFIQFAHLPQSAPLVGGLVLTLMTLPTII 314

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L+ VP SIR AALG+GASK+Q++FHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 315 ISTRASLKAVPPSIRDAALGVGASKMQSIFHHVLPLAMPGILTGTIIGLAQALGETAPLL 374

Query: 356 FVGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV ++       +  G  D  +A P QIY WA  A+  + ER +G I++LL+FL  +
Sbjct: 375 LIGMVGYIASNYPDGFASGFLDPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLLTM 434

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR RF++RW
Sbjct: 435 NAIAIILRRRFERRW 449


>gi|109899621|ref|YP_662876.1| phosphate ABC transporter, inner membrane subunit PstA
           [Pseudoalteromonas atlantica T6c]
 gi|109701902|gb|ABG41822.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Pseudoalteromonas atlantica T6c]
          Length = 441

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 191/425 (44%), Positives = 272/425 (64%), Gaps = 6/425 (1%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +  +  +NL  R  +EW FR Y + A+L  F  L++L S I+SKG GA ++T I L + F
Sbjct: 16  TIDLVNRNLAKRKRAEWRFRVYGIGAILFGFACLLILFSDIISKGHGAFFKTQIHLQVHF 75

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARK---LSISDSNHALLRQASQMLSTTAR 119
           +   +   +   ++      A+Y+ +V+ AL      +S +  +    RQ   ++ST A 
Sbjct: 76  NPQRLQVSQPSAIE--QFNNANYDNIVQDALFADNARISPTSLSAVDKRQLLSLISTGAV 133

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKG-YLYSPANVHRMSDYQWKWFQKLDSD 178
           Y LR+ L   PS+  ++V + L    ++D+ +K           R+S  Q  W  +   +
Sbjct: 134 YSLREILTDSPSVFNQSVGIWLTVDDDVDNYVKSLAHGGKGYTGRLSQQQQSWVNRWIEN 193

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G +   FN  FF +G S  PE AGI  A++GSLYM+L+ IGLSFP+GIA+A+YLEE++ K
Sbjct: 194 GQVRQTFNTTFFTSGDSREPEQAGIRSALMGSLYMLLVTIGLSFPIGIAAAVYLEEYAPK 253

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
              + F++ NINNLA+VPSI++G+LG A+ I FF MPRS  LVGGL+L LMTLP+III++
Sbjct: 254 NRATDFIEVNINNLAAVPSIIFGLLGLAIFIGFFDMPRSVPLVGGLVLTLMTLPTIIISS 313

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             A++ VPSSIR AA GLGASK+Q V HHVLPLAMP +LTG+ +  A+ALGETAPLL +G
Sbjct: 314 RAAIKAVPSSIRDAAYGLGASKMQVVLHHVLPLAMPGVLTGAIIGFAQALGETAPLLMIG 373

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAF+ D P  + D ++A PVQI+LW+   ER FVERT  AI++LL FL  +N   +WLR
Sbjct: 374 MVAFIVDVPADLMDPSSALPVQIFLWSDSPERAFVERTSAAIMVLLAFLISMNGLAVWLR 433

Query: 419 NRFKK 423
           +R  +
Sbjct: 434 HRLGR 438


>gi|312115107|ref|YP_004012703.1| phosphate ABC transporter inner membrane protein PstA
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311220236|gb|ADP71604.1| phosphate ABC transporter, inner membrane subunit PstA
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 442

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 198/407 (48%), Positives = 276/407 (67%), Gaps = 4/407 (0%)

Query: 21  FRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAIL 80
           F+ Y ++A+ +   FL++L  +I+  G  A +QT I LPI+F    +DP+  R  +   L
Sbjct: 38  FQAYGLIAIALGMSFLVILFGTIIRDGWTAFFQTSIELPIKFDAAEIDPEGTRNAN--TL 95

Query: 81  LRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVS 140
            +A+Y  L  +AL  +L +  S+ A  + A+ ++S      LR  +  DP +IG T  V 
Sbjct: 96  AQANYQKLANQALYGQLGVDPSSRAQRQAANALISRDVDSQLRAMVAADPKIIGTTQNVW 155

Query: 141 LLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRP 198
           +LAS N+D+  KG +    P    ++SD Q  W  KL + GA+   FN G F N ASS+P
Sbjct: 156 VLASGNVDAFAKGKIDRQLPQQNRQISDQQISWIDKLTASGAMEKSFNSGLFTNTASSQP 215

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSI 258
           E AG+ VA++GS Y+MLIV+ LS PLG+A+AIYLEEF+ +   +  ++ NINNLA+VPSI
Sbjct: 216 ETAGLAVALLGSFYIMLIVVLLSVPLGVAAAIYLEEFAPRNRITDIIEVNINNLAAVPSI 275

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           V+G+LG AV INF  +PRS +LVGGL+L L TLP++IIAT  ++  VP SIR AALG+GA
Sbjct: 276 VFGLLGLAVFINFAGLPRSASLVGGLVLTLRTLPTVIIATRASITAVPPSIREAALGVGA 335

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
           SKVQ+VFHHVLPL++P I+TG+ + L +A+GETAPLL +GMVAFV D P    D ATA P
Sbjct: 336 SKVQSVFHHVLPLSLPGIITGTIIGLVQAIGETAPLLMIGMVAFVVDVPSSPLDPATALP 395

Query: 379 VQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           VQIY+WA +AER FVE+T GA ++LL  LAV+N   + LR R++++W
Sbjct: 396 VQIYMWATEAERGFVEKTAGATIVLLGILAVMNILAMVLRKRYERKW 442


>gi|146329206|ref|YP_001210066.1| ABC-type phosphate-dependent transport system family protein
           [Dichelobacter nodosus VCS1703A]
 gi|146232676|gb|ABQ13654.1| ABC-type phosphate-dependent transport system family protein
           [Dichelobacter nodosus VCS1703A]
          Length = 438

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 197/428 (46%), Positives = 275/428 (64%), Gaps = 8/428 (1%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
               +++LK R+ SE  FR   + ++ +  VFLI+ + SIV     A  QT I L + + 
Sbjct: 13  THFAEQHLKKRHRSERRFRLLGICSLTISLVFLIVFIISIVRDAAPAFSQTEIQLTVNYD 72

Query: 64  ETIVDPQKKRFMDP----AILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR 119
             +++ +     D       L + +YNLL+ +ALA+  S    N   LRQ  ++LS++A+
Sbjct: 73  TDVINLKNIDKNDEHAVEQALFKVNYNLLIERALAKLSSYQGENPNQLRQ--KLLSSSAQ 130

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDS 177
           Y L   L  +P LIGK   + L AS  IDSA +GY+ S        + D   KW Q+L  
Sbjct: 131 YQLMNRLQANPDLIGKQETLWLSASGGIDSAHQGYVDSSIDEANRAVDDQTVKWAQRLHE 190

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            G L    N   F +  S  P+ AG+  A++GS Y +L+ + LSFP+ + +AIYLEEF+ 
Sbjct: 191 QGLLRTSLNTTIFTHTDSRSPQDAGVRGAIIGSAYTLLVTLALSFPIAVLAAIYLEEFAP 250

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K  F+ F++ANINNLA+VPSI++G+LG AV INFF +PRST LVGGL+L LMTLP+III+
Sbjct: 251 KNRFTDFLEANINNLAAVPSIIFGLLGLAVFINFFGLPRSTPLVGGLVLTLMTLPTIIIS 310

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           +  AL+ VP SIR+AALGLGASK+Q  FHHVLPLAMP +LTG+ + +A+ALGETAPLL +
Sbjct: 311 SRAALKAVPPSIRAAALGLGASKMQVTFHHVLPLAMPGMLTGTIIGMAQALGETAPLLMI 370

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAF++D P G+ D A   PVQIYLW+   ER F+ RT  AI++LL FL  +N   + L
Sbjct: 371 GMVAFISDVPNGILDPAAVMPVQIYLWSDLPERAFIARTSFAIIILLFFLIAMNALAVIL 430

Query: 418 RNRFKKRW 425
           R +F+++W
Sbjct: 431 RKKFERKW 438


>gi|71083867|ref|YP_266587.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062980|gb|AAZ21983.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
          Length = 419

 Score =  352 bits (903), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 171/420 (40%), Positives = 260/420 (61%), Gaps = 6/420 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           ++ LK R+ +E  F+ Y + ++L+   F+I LL++I SKG GA  +T I + + F    +
Sbjct: 4   EQRLKKRHNAEKRFKLYGLTSILLAIFFVIFLLNAIFSKGSGAFLKTTIDVEVNFDADTL 63

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +  +   ++   L   DY  L   ++ +   ++       +    + S    Y +R  L+
Sbjct: 64  ELSESPPLED--LENTDYYELAIDSILKVKKVNGLTEE--KLLINLFSPDYEYEIRNFLL 119

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P  + +T  + L AS + D   KG      P    R++++Q   + +L ++G +   F
Sbjct: 120 DNPKALNQTTVLKLTASDDFDQLHKGNYPRELPEERRRINNFQLNLYDELVNEGKVNKIF 179

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N   F  G S  PE+AGIG A+VGS + ++I + LSFP+ IA+++YLEEF+ K   + F+
Sbjct: 180 NSYLFTKGDSRNPELAGIGGALVGSFFTIVITLLLSFPIAIAASVYLEEFAPKNKITDFI 239

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+LG  +L+  F +PRST LV G+ LALMTLP III    +L+ V
Sbjct: 240 EININNLAAVPSIVFGLLGLGILLGTFHLPRSTPLVAGITLALMTLPRIIIPCRASLKAV 299

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR  AL +GASKVQ+V HHVLPLA+P  L+G+ + LA+ALGETAPL+ +GMVAFV D
Sbjct: 300 PPSIREGALAIGASKVQSVTHHVLPLAIPGTLSGTIIGLAQALGETAPLILIGMVAFVVD 359

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P   TD + + PVQ+YLW+  AER FVE+T   I++LL FL  +N   ++LR +F+++W
Sbjct: 360 IPSIPTDPSASLPVQVYLWSEQAERGFVEKTSATIMVLLSFLITLNFIAVYLRQKFERKW 419


>gi|167648504|ref|YP_001686167.1| phosphate ABC transporter inner membrane subunit PstA [Caulobacter
           sp. K31]
 gi|167350934|gb|ABZ73669.1| phosphate ABC transporter, inner membrane subunit PstA [Caulobacter
           sp. K31]
          Length = 433

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 178/426 (41%), Positives = 264/426 (61%), Gaps = 11/426 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           + S  +  LK R+ SE  FR   + A+++  +FL++L+  IV++G        +++P+  
Sbjct: 16  ALSAREALLKKRHRSETWFRVQGIAAIVIAMIFLVMLVGRIVAQGYSTFETHTLTVPVYL 75

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLR-QASQMLSTTARYH 121
           +   +D           L   +Y+ +V +A+ +KL + D +      +   + S      
Sbjct: 76  NPERID--------TTALEGVNYDYIVAEAMMKKLGVQDDDLGTTSGKIMDLTSRDFGSQ 127

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDG 179
           L + +  D SLIGKTV V+    A+ D   KG +         ++ + Q  W  KL ++G
Sbjct: 128 LLQMIKKDRSLIGKTVNVTGSVKADADLYYKGEIQRSTAEGDRKLDNQQLDWLDKLKNEG 187

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN  FF N  S+ PE AG+  AV+GS  M++I   ++ P+G+ +A+YLEEF+ K 
Sbjct: 188 TVKTGFNIKFFTNSDSTEPEQAGVWGAVIGSAMMLIITATIAIPVGVMAAVYLEEFAPKN 247

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            ++  ++ NINNLA+VPSIVYG+LG A+ IN+  +PR + LVGGL++ALM LP++IIAT 
Sbjct: 248 RWTDVIEVNINNLAAVPSIVYGLLGLALFINWLHVPRGSPLVGGLVMALMALPTVIIATR 307

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L+ VP SIR AALG+GASK QTVFHHVLPLAMP ++TG+ +SLA ALGETAPLL +GM
Sbjct: 308 SSLKAVPPSIREAALGVGASKAQTVFHHVLPLAMPGVMTGAILSLAHALGETAPLLMIGM 367

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAFV   P   T  AT  PVQ+++W   +ER F ERT  AI++LL+F+ V+N A + LR 
Sbjct: 368 VAFVPGAPESFTSSATVLPVQVFIWENASERAFHERTAAAIIVLLVFMIVMNAAAVILRR 427

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 428 RFERRW 433


>gi|83591939|ref|YP_425691.1| phosphate ABC transporter permease [Rhodospirillum rubrum ATCC
           11170]
 gi|83574853|gb|ABC21404.1| Phosphate transport system permease protein 2 [Rhodospirillum
           rubrum ATCC 11170]
          Length = 426

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 273/426 (64%), Gaps = 5/426 (1%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            +  + +  LK RY  E  FR   + A+L     L+ L  +I S G+ A   T + L + 
Sbjct: 4   HNTELVRAGLKRRYRQERWFRGLGLAAILTALAMLLTLFVTIFSNGVSAFVTTELVLDVP 63

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
            +   VDPQ  R  DPA+L  A+Y  LV  A++       ++    R    ++S  A Y 
Sbjct: 64  VTAAEVDPQGTR--DPAVLSAANYRKLVSDAMSALFP-EVTDRRERRVLMGIVSDGAAYR 120

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDG 179
           LR  +M DPSLIG+TV +++  S++ D   KG +         R++D Q  +F  L+  G
Sbjct: 121 LRAQVMADPSLIGQTVRLNVPVSSDYDMLAKGLVDRDSLEGDRRLADNQITYFLSLEERG 180

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            +   FN G F  G S +PE+AGI   VVGS+Y++L+ + LSFP+G+A+AIYLEE++ + 
Sbjct: 181 LITKTFNSGLFTEGDSRQPELAGIWGGVVGSVYVLLVTLALSFPIGVATAIYLEEYAPRN 240

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
           +F+  ++ NINNLA+VPSIV+G+LG AV +N F MPRS  +VGGL+L LMTLP+IIIA+ 
Sbjct: 241 WFTDLIEVNINNLAAVPSIVFGLLGLAVFLNVFGMPRSAPVVGGLVLTLMTLPTIIIASR 300

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL +VP SIR AALG+GASK+Q V HHVLPLAMP +LTG+ + +A+ALGETAPLL +GM
Sbjct: 301 AALTSVPPSIREAALGVGASKMQMVTHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGM 360

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           VAF+ D P G    AT  PVQI+LW+   ER FVERT  AI++LL FL ++N   + LR 
Sbjct: 361 VAFIADIPSGPMAPATVLPVQIFLWSDSPERAFVERTSAAIIVLLAFLVLMNAGAVLLRK 420

Query: 420 RFKKRW 425
           +F+++W
Sbjct: 421 KFERKW 426


>gi|114765351|ref|ZP_01444468.1| phosphate ABC transporter, permease protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114542331|gb|EAU45360.1| phosphate ABC transporter, permease protein [Roseovarius sp.
           HTCC2601]
          Length = 452

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 179/434 (41%), Positives = 263/434 (60%), Gaps = 12/434 (2%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
            +      K R  SE  FR Y + A+     FL++LL+SI+S G  A  QT I +P+   
Sbjct: 19  LTAADSRTKKRNASEKRFRAYGLAAIGTGLFFLVVLLTSIISNGSTAFMQTFIEVPVYLD 78

Query: 64  ETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISD--SNHALLRQASQMLSTTARY 120
              +DP   R   D + +    YN L++ A+  ++      +++        ++S +A  
Sbjct: 79  PEALDPNGNRDPADISKVSTFGYNPLIQNAVFEQVQDKGIATDYEDAGDMKALISASAAA 138

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSD 178
            LR  ++ +P LIG+TV+  +LAS+ +D  LKG +          +          L  D
Sbjct: 139 QLRDRVIANPDLIGETVDFQILASSRVDGYLKGRVGRDSITQDRNIDAGHLDIVDALRED 198

Query: 179 GALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G +   FN+ F     +S  RPE AG+GV+++GS +MML+V+ L+ P+G+A++IYLEEF+
Sbjct: 199 GTVHKSFNFAFITGADASESRPEQAGLGVSMLGSFFMMLVVLFLALPIGVAASIYLEEFA 258

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            +  F+ F++ NI+NLA+VPSIV+GILG A  I F  +P+S  LVGGL L LMTLP+I+I
Sbjct: 259 PQNKFTDFIEVNISNLAAVPSIVFGILGLAAFIQFAHLPQSAPLVGGLTLTLMTLPTIVI 318

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  +L+ VP SIR AALG+GASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPLL 
Sbjct: 319 STRASLKAVPPSIRDAALGVGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPLLL 378

Query: 357 VGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV ++          G     +A P QIY WA  A+  + ER +G I++LL+FL V+N
Sbjct: 379 IGMVGYIATNYPEGVISGFMSPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLLVMN 438

Query: 412 TAMLWLRNRFKKRW 425
              + LR +F++RW
Sbjct: 439 VIAIVLRRKFERRW 452


>gi|254420029|ref|ZP_05033753.1| phosphate ABC transporter, permease protein PstA [Brevundimonas sp.
           BAL3]
 gi|196186206|gb|EDX81182.1| phosphate ABC transporter, permease protein PstA [Brevundimonas sp.
           BAL3]
          Length = 434

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 166/424 (39%), Positives = 257/424 (60%), Gaps = 9/424 (2%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
               +  LK R+  E  F++Y  +A+    +FL +L+  IV++G  A +   +++P+   
Sbjct: 18  LDRLRAGLKRRHAKETRFKWYGRLAIAAAMIFLAILMVRIVAQGHTAFYTHTVTVPVYMD 77

Query: 64  ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLR 123
              VD    +  +   +          + L R     D+     RQ   + S+  ++   
Sbjct: 78  PARVDRAYPQGSNFEQMA-------AEQQLKRWGIQDDAAGDASRQMKALFSSELKFVAA 130

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGAL 181
             +     +IG+TV +++  S   D  LKG +   +P +  R++D Q  W  ++ ++G +
Sbjct: 131 DLVAKRSDVIGETVPLAVPLSDEADLYLKGEISKETPEDQRRLTDQQLAWLDRMQAEGVV 190

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
              FN   F NG S++PE+AG+  AVVGS  M+++   ++ PLG+ +A++LEEF+ K   
Sbjct: 191 GSHFNTALFTNGDSTQPELAGVLGAVVGSALMLMVTALIAIPLGVGAAVWLEEFAPKNKL 250

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NINNLA+VPSIVYG+LG A+ IN+  +PR++ +VGGL+LALM LP+++IAT  A
Sbjct: 251 TDIIEVNINNLAAVPSIVYGLLGLALFINWMHLPRASPIVGGLVLALMALPTLVIATRSA 310

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+ VP SIR AAL +GASK QTVF HVLPLAMP ++TG+ +S+A ALGETAPLL +GMV+
Sbjct: 311 LKAVPPSIREAALAMGASKTQTVFSHVLPLAMPGVMTGAIISMAHALGETAPLLLIGMVS 370

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           FV   P  +     A P  IY+W   +ER F ERT  AI++LL+F+ ++NTA + LR RF
Sbjct: 371 FVPGVPHAIDQPVGALPSLIYIWENASERAFHERTAAAIIVLLVFMIIMNTAAIILRRRF 430

Query: 422 KKRW 425
           ++RW
Sbjct: 431 ERRW 434


>gi|262276140|ref|ZP_06053949.1| phosphate transport system permease protein PstA [Grimontia
           hollisae CIP 101886]
 gi|262219948|gb|EEY71264.1| phosphate transport system permease protein PstA [Grimontia
           hollisae CIP 101886]
          Length = 433

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 181/404 (44%), Positives = 267/404 (66%), Gaps = 5/404 (1%)

Query: 24  YCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRA 83
           Y + ++ + F FLI+++++I S+G  A   T I L ++ S  ++        DP +L+ A
Sbjct: 33  YGIASISMAFAFLIVMMTTIFSEGYTAFLTTEIKLQVDLSPEMLGIDGDET-DPKVLMGA 91

Query: 84  DYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLA 143
            Y  ++R+AL  ++++        R   + +S  A Y LR  +++DPSLIG+T+     A
Sbjct: 92  SYRKVLRQALRDEIAVDG--RNQRRALYRFISNGAEYELRNKVVSDPSLIGQTITYWAQA 149

Query: 144 SANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVA 201
             N++   KG +   +P +  +  + Q +W+ +L  +G +   FN  FF +G S  PE+A
Sbjct: 150 GDNLNQYNKGNIKTDAPEDDRQFKNLQIEWYGELKKEGRVRTVFNTKFFTHGDSRDPELA 209

Query: 202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYG 261
           GI  A VGS Y +L+ + LSFP+G+A+AIYLEEF+ +   +  ++ NINNLA+VPSIV+G
Sbjct: 210 GIWGATVGSFYTLLVTLVLSFPIGVAAAIYLEEFAPRNRATELIEININNLAAVPSIVFG 269

Query: 262 ILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKV 321
           +LG AV +N   +PRS  LVGGL+L LMTLP+III++  A++ VP S+R AALG+GASK+
Sbjct: 270 LLGLAVFLNVADLPRSAPLVGGLVLTLMTLPTIIISSRAAIKAVPPSVRDAALGVGASKM 329

Query: 322 QTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQI 381
           Q V HHVLPLAMP +LTG+ + +A+ALGETAPLL +GMVAF+ D P G  D ATA PVQI
Sbjct: 330 QMVLHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGMVAFIVDVPSGPLDAATALPVQI 389

Query: 382 YLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           YLWA + E+ F E T GAI++LL FLA++N   + +R R ++RW
Sbjct: 390 YLWAENPEKGFAENTSGAIMVLLAFLALMNACAVIMRKRLERRW 433


>gi|163867537|ref|YP_001608736.1| phosphate ABC transporter, permease protein [Bartonella tribocorum
           CIP 105476]
 gi|161017183|emb|CAK00741.1| phosphate ABC transporter, permease protein [Bartonella tribocorum
           CIP 105476]
          Length = 429

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 211/404 (52%), Positives = 297/404 (73%), Gaps = 2/404 (0%)

Query: 23  FYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLR 82
            Y ++A+ +   FL  LL SI+S+G  A +Q+ ++L I   E I+DP  +R   P +L+ 
Sbjct: 25  AYGLIAIFIGLFFLFALLWSIISQGYTAFFQSEMTLSIYLDEKIIDPSGQRQTKPQVLIT 84

Query: 83  ADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLL 142
           A+Y LLVR ALA+KL ++ ++ A LR  ++M S   R  LR+ +  +P LIG T ++ +L
Sbjct: 85  ANYPLLVRNALAKKLDVNQNDRASLRDINRMFSNGVRVQLREMVTKNPKLIGTTQKIKVL 144

Query: 143 ASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEV 200
           A+A+IDSA KG +         ++S+ Q +W ++L  DG L+  FN GFF  GASSRPE+
Sbjct: 145 AAADIDSAYKGQIDLHVAEKNRKVSNRQVEWIKRLAHDGTLYKTFNIGFFTFGASSRPEI 204

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
           AG+GVA++GSLYM+ IV+ +S P+GIA+A+YLEE++ K  F+ F++ NINNLA+VPSIV+
Sbjct: 205 AGLGVAIIGSLYMIGIVLLVSLPIGIATALYLEEYARKNKFTDFIEVNINNLAAVPSIVF 264

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+LG +V +NF  +PRS + VGGL+LALMTLP+IIIAT  ALR VP SIR+AALGLGASK
Sbjct: 265 GLLGLSVFVNFLGLPRSASFVGGLVLALMTLPTIIIATRSALRAVPLSIRAAALGLGASK 324

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            Q +FHHV+PLA P ILTG+ + +A+ALGETAPLL +GMVAFV + P    D ATA PVQ
Sbjct: 325 TQMIFHHVVPLAAPGILTGTIIGVAQALGETAPLLLIGMVAFVVNIPTTPMDPATALPVQ 384

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           I++WA +AER FVE+T GAI++L++FLA++N + ++LR RF++R
Sbjct: 385 IFMWAGEAERAFVEKTSGAIIVLMMFLAIMNISAVFLRRRFERR 428


>gi|163736448|ref|ZP_02143867.1| Phosphate transport system permease protein 2 [Phaeobacter
           gallaeciensis BS107]
 gi|161390318|gb|EDQ14668.1| Phosphate transport system permease protein 2 [Phaeobacter
           gallaeciensis BS107]
          Length = 456

 Score =  348 bits (894), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 184/434 (42%), Positives = 267/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S     +  + R  +E  FR Y + A+ V  + L +L+ +IVS+G GA  QT I+L +E 
Sbjct: 23  SLLQQSERTRKRNAAERRFRGYGISAITVGLLMLAVLVFTIVSRGTGAFQQTFITLDVEL 82

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARY 120
            E+ +D    R +D    +    Y  L++ A+  K++    +  L  +  + +LS  A  
Sbjct: 83  LESKLDKSGTRDLDAIKKVTTFGYAPLIKNAVQAKVAELGIDTDLKAKAMAGILSKNAAA 142

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPA--NVHRMSDYQWKWFQKLDSD 178
            LR  ++ +P  IG+TV    LAS+ +D  LKG +   +  N   +S  Q      L + 
Sbjct: 143 QLRAYVVENPDQIGQTVTFRFLASSRVDGYLKGRVSRDSIVNDKSISPAQLDLVDALVAA 202

Query: 179 GALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
                 FN  F     +S  RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+
Sbjct: 203 EVAAKTFNLDFITGADASDARPEAAGMGVSMMGSLFMMLVVLALALPIGVAASIYLEEFA 262

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP++II
Sbjct: 263 PKNWITDVIEVNISNLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTVII 322

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  +L++VP SIR AALG+GAS++Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 323 STRASLKSVPPSIRDAALGVGASRMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 382

Query: 357 VGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+          G+    +A P QIY WA  A+  F ER +G I++LLIFL  +N
Sbjct: 383 IGMVGFIASNAPETIADGLLAPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMN 442

Query: 412 TAMLWLRNRFKKRW 425
           T  + LR RF++RW
Sbjct: 443 TVAVILRRRFERRW 456


>gi|254780705|ref|YP_003065118.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040382|gb|ACT57178.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 425

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 425/425 (100%), Positives = 425/425 (100%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI
Sbjct: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY
Sbjct: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
           HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA
Sbjct: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF
Sbjct: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV
Sbjct: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV
Sbjct: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR
Sbjct: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420

Query: 421 FKKRW 425
           FKKRW
Sbjct: 421 FKKRW 425


>gi|149202578|ref|ZP_01879550.1| ABC phosphate transporter, inner membrane subunit PstA [Roseovarius
           sp. TM1035]
 gi|149143860|gb|EDM31894.1| ABC phosphate transporter, inner membrane subunit PstA [Roseovarius
           sp. TM1035]
          Length = 450

 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 196/434 (45%), Positives = 271/434 (62%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        K R   E  FR   +VAV +  + L+ LL+SI++ G+ +  QT++ L +  
Sbjct: 17  SLLTQDARTKQRNAKEARFRMMGLVAVTIGVLSLVGLLASILASGLSSFQQTYVELEVYL 76

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISD--SNHALLRQASQMLSTTAR 119
               +D    R  D  A +    Y  L+  A+   +  +   S+ A  + A +++S  A 
Sbjct: 77  DPAKLDKNGNRNRDDIAKVSTFGYTPLIEAAMVAAIERTGVTSDVANAKAAGELISKEAP 136

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ +P  IG+TV   LLA+  ID   KG   + S A    +S  Q +  Q+L  
Sbjct: 137 ATLRDFVLANPDRIGETVPFDLLAAGRIDGFFKGRVTMESAALDRNVSPEQLQLAQQLKD 196

Query: 178 DGALFLDFNYGFFINGA--SSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G L   FN+ FF       +RPE AG+GVA++GS YMMLIV+ LS PLG+A++IYLEEF
Sbjct: 197 AGILTTKFNWAFFTAPDASDTRPEAAGLGVAIIGSAYMMLIVLVLSLPLGVAASIYLEEF 256

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  ++  ++ NI+NLA+VPSIV+GILG A+ IN   +P+S  +VGGL+L LMTLP+II
Sbjct: 257 APKNRWTDLIEVNISNLAAVPSIVFGILGLAIFINMVGLPQSAPIVGGLVLTLMTLPTII 316

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT  AL++VP SIR AALG+GASK+Q +FHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 317 IATRAALKSVPPSIRDAALGVGASKMQAIFHHVLPLAMPGILTGAIIGLAQALGETAPLL 376

Query: 356 FVGMVAFVTDYPVGV----TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV +YP G      D A A PVQ+Y W    +  FVER  GAI++LL+FL ++N
Sbjct: 377 LIGMVAFVREYPAGPPEGFFDPAAALPVQVYNWTQRGDPAFVERASGAIIVLLVFLVIMN 436

Query: 412 TAMLWLRNRFKKRW 425
            A + LR RF++RW
Sbjct: 437 IAAILLRRRFERRW 450


>gi|254476625|ref|ZP_05090011.1| phosphate transport system permease protein 2 [Ruegeria sp. R11]
 gi|214030868|gb|EEB71703.1| phosphate transport system permease protein 2 [Ruegeria sp. R11]
          Length = 448

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 186/434 (42%), Positives = 271/434 (62%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S   +    + R  +E  FR Y + A+ V  + L +L+++IV +G GA  QT ++L +E 
Sbjct: 15  SLLQHSARTRKRNAAERRFRAYGIAAISVGLLMLCVLVTTIVGRGTGAFQQTFVTLEVEL 74

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARY 120
            E+ +D    R +D    +    Y  ++R A+  K++    +  L  ++ + +LS  A  
Sbjct: 75  LESKLDKSGTRDIDAIKKVTTFGYAPIIRAAVEAKVAELGIDSPLKAKEMAGILSKDAAA 134

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSD 178
            LR+ ++ +P  IG+TVE   LAS+ +D  +KG +     AN   +S  Q      L S 
Sbjct: 135 TLREFVIANPDQIGETVEFRFLASSRVDGYMKGRVSRDSIANDKSISPEQLDLVDALVSA 194

Query: 179 GALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G +   FN  F     +S  RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+
Sbjct: 195 GVVEKTFNLAFITGADASDARPEAAGMGVSMLGSLFMMLVVLALALPIGVAASIYLEEFA 254

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP++II
Sbjct: 255 PKNWLTDIIEVNISNLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTVII 314

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  AL+ VP SIR AALG+GAS++Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 315 STRAALKAVPPSIRDAALGVGASRMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 374

Query: 357 VGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+          G+    +A P QIY WA  A+  F ER +G I++LLIFL  +N
Sbjct: 375 IGMVGFIASNAPETIADGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMN 434

Query: 412 TAMLWLRNRFKKRW 425
           T  + LR RF++RW
Sbjct: 435 TVAVILRRRFERRW 448


>gi|119387033|ref|YP_918088.1| phosphate ABC transporter, inner membrane subunit PstA [Paracoccus
           denitrificans PD1222]
 gi|119377628|gb|ABL72392.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Paracoccus denitrificans PD1222]
          Length = 447

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 184/434 (42%), Positives = 274/434 (63%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S  +     + R  +E  FR Y + A+++  + L++LL +IV+ G+GA  QT++ +P+  
Sbjct: 14  SLLVADPRTRKRNAAEARFRAYGLGAIVISMIMLVILLFTIVTGGVGAFRQTYLEIPVAL 73

Query: 63  SETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISDSNHAL--LRQASQMLSTTAR 119
               +D    R   D   +L   Y  ++ ++L + ++      A    +  S ++S  A 
Sbjct: 74  DAAQLDKNGNRDPADIRKVLTLTYGKILEQSLQQAIADKGIAVAELSAKDVSNLISKEAS 133

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ DP LIG+TVE  +L +  +D   KG   + S A     S  Q +    L +
Sbjct: 134 AQLRNRVLADPELIGQTVEARVLVNGRVDGYYKGRVSMESAARDANTSPAQLQLADALKA 193

Query: 178 DGALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G L  ++N+ F  +  +S      AG+G+A++GSLYMML+V+ L+ P+G+A++IYLEEF
Sbjct: 194 QGMLATEWNWSFLTSPDASDQRPEAAGVGIAILGSLYMMLVVLALAVPIGVAASIYLEEF 253

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  ++  ++ NI+NLA+VPSIV+GILG A  INF  +P+S  +VGGL+L LMTLP+II
Sbjct: 254 APKNRWTDIIEVNISNLAAVPSIVFGILGLAAFINFAGLPQSAPIVGGLVLTLMTLPTII 313

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT  AL+ VP SIR AALG+GASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 314 IATRAALKAVPPSIRDAALGVGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPLL 373

Query: 356 FVGMVAFVTDY----PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV ++    P G+ + A+A PVQ+Y W   A+  F+ER  GAI++LL FL  +N
Sbjct: 374 LIGMVAFVKNFPSAPPDGLFEPASALPVQVYNWTQRADPAFIERASGAIIVLLAFLLCMN 433

Query: 412 TAMLWLRNRFKKRW 425
              + LR +F++RW
Sbjct: 434 LLAILLRRKFERRW 447


>gi|118589314|ref|ZP_01546720.1| phosphate ABC transporter, permease protein [Stappia aggregata IAM
           12614]
 gi|118438014|gb|EAV44649.1| phosphate ABC transporter, permease protein [Stappia aggregata IAM
           12614]
          Length = 450

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 175/433 (40%), Positives = 264/433 (60%), Gaps = 15/433 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        K R  +E  F+ Y ++A+ +   FL+ LL +I+S G+GA  QT + + +  
Sbjct: 23  SILELDPLTKKRNAAEARFKLYGIIAIGIGLFFLVALLWAILSNGLGAFSQTFVKVDVPL 82

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARYH 121
           ++  +D       + +++  + Y  ++  A A++L+ ++    +  +   ++ S+ A   
Sbjct: 83  NQQQID-----DAEKSVVKTSKYRAIIDDAFAKELAGANITTEMSAKDLQKLFSSGAAAT 137

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDG 179
           +R   + +P  +G TV   L+AS+ +D  LKG +     A    +         ++ S G
Sbjct: 138 VRDYALANPDKVGTTVTFELIASSRVDGYLKGRVKREDLAEDKNLDAAHLDLVDQMKSAG 197

Query: 180 ALFLDFNYGFFINGA--SSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            L   FN+ F        SRPE AGIG +++GSL+MML+V+ LS P+G+A++IYLEEF+ 
Sbjct: 198 LLEKRFNWSFITGTDASDSRPEQAGIGASMIGSLFMMLVVLFLSLPIGVAASIYLEEFAP 257

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           +  F+  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+
Sbjct: 258 QNKFTDLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIIS 317

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  +L+ VP SIR AALG+GASK+Q++FHHVLPLAMP ILTG+ + LA+ALGETAPLL +
Sbjct: 318 TRASLKAVPPSIRDAALGIGASKMQSIFHHVLPLAMPGILTGTIIGLAQALGETAPLLLI 377

Query: 358 GMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           GMV F+          G     +A P QIY WA  A+  F ER +G I++LL+FL  +N 
Sbjct: 378 GMVGFIASNFPDGVAAGFFSPNSAMPAQIYEWAKRADPAFYERAWGGIIVLLVFLMTMNI 437

Query: 413 AMLWLRNRFKKRW 425
             + LR RF++RW
Sbjct: 438 IAIILRRRFERRW 450


>gi|83942437|ref|ZP_00954898.1| phosphate ABC transporter, permease protein [Sulfitobacter sp.
           EE-36]
 gi|83846530|gb|EAP84406.1| phosphate ABC transporter, permease protein [Sulfitobacter sp.
           EE-36]
          Length = 446

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 186/435 (42%), Positives = 268/435 (61%), Gaps = 11/435 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            S          R  +E  F+ Y + A+ V  + L +LL++I+ +G+GA  QT ++L ++
Sbjct: 12  HSLLKPDARTVKRNRAEARFKSYGIAAIAVGLLMLAILLTTIIGRGVGAFQQTFLTLNVQ 71

Query: 62  FSETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTAR 119
             E  +D    R +D    +    Y  L+  AL  K++ +     L  +  + +LS  A 
Sbjct: 72  LLEEKLDKNGNRNLDEIKKVSTFGYAPLMAAALEAKVAETGITTDLKPKDMAGILSKDAA 131

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             LR  ++ +P LIG  VE   L ++ +D  +KG +     AN   +S  Q      L +
Sbjct: 132 AQLRDFVLDNPELIGTAVEFKFLTNSRVDGYMKGRVTRDSIANDKSISAEQLDLVDALVA 191

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
           DGAL   FN  F     +S  RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF
Sbjct: 192 DGALEKRFNIDFITGADASDARPEAAGMGVSMLGSLFMMLVVLALALPIGVAASIYLEEF 251

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K   +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+II
Sbjct: 252 APKNLLTDIIEVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTII 311

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L++VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL
Sbjct: 312 ISTRASLKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLL 371

Query: 356 FVGMVAFVTDYP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV F+   P      G+ D  +A P QIY WA  A+  F ER +G I++LL+FL  +
Sbjct: 372 LIGMVGFIASNPPDGIASGLMDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITM 431

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR RF++RW
Sbjct: 432 NAIAVMLRRRFERRW 446


>gi|163743306|ref|ZP_02150687.1| phosphate ABC transporter, permease protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161383494|gb|EDQ07882.1| phosphate ABC transporter, permease protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 451

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 183/434 (42%), Positives = 265/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        + R  +E  FR Y + A+ V  + L +L+ +IVS+G G   QT I+L +E 
Sbjct: 18  SLLQQSDRTRKRNAAERRFRGYGIAAITVGLLMLAVLVFTIVSRGTGGFQQTFITLDVEL 77

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARY 120
            E+ +D    R +D    +    Y  L++ A+  K++    +  L  +  + +LS  A  
Sbjct: 78  LESKLDKSGTRDLDAIKKVTTFGYAPLIKNAVQAKVAELGIDTDLKAKAMAGILSKNAAA 137

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPA--NVHRMSDYQWKWFQKLDSD 178
            LR  ++ +P  IG+TV    LAS+ +D  LKG +   +  N   +S  Q      L + 
Sbjct: 138 QLRAYVVENPDQIGQTVTFRFLASSRVDGYLKGRVSRDSIVNDKSISPAQLDLVDALVAA 197

Query: 179 GALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
                 FN  F     +S  RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF+
Sbjct: 198 EVAAKTFNLDFITGADASDARPEAAGMGVSMMGSLFMMLVVLALALPIGVAASIYLEEFA 257

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP++II
Sbjct: 258 PKNWITDVIEVNISNLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTVII 317

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  +L++VP SIR AALG+GAS++Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 318 STRASLKSVPPSIRDAALGVGASRMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 377

Query: 357 VGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+          G+    +A P QIY WA  A+  F ER +G I++LLIFL  +N
Sbjct: 378 IGMVGFIASNAPETIADGLLAPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMN 437

Query: 412 TAMLWLRNRFKKRW 425
           T  + LR RF++RW
Sbjct: 438 TVAVILRRRFERRW 451


>gi|254466624|ref|ZP_05080035.1| phosphate transport system permease protein 2 [Rhodobacterales
           bacterium Y4I]
 gi|206687532|gb|EDZ48014.1| phosphate transport system permease protein 2 [Rhodobacterales
           bacterium Y4I]
          Length = 452

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 184/426 (43%), Positives = 268/426 (62%), Gaps = 11/426 (2%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
            + R  +E  FR Y + A+    V L++L+++IVSKG GA  QT ++L +E  E+ +D +
Sbjct: 27  TRKRNAAEARFRGYGIAAITAGLVMLLILVTTIVSKGTGAFQQTFVTLNVELLESKLDKK 86

Query: 71  KKRFM-DPAILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARYHLRKTLMT 128
            +R + D   +    Y  +++ A+   +     + +L  +  + +LS      LR  ++ 
Sbjct: 87  GERNIEDIKKVTTFGYAPIIKGAMEATVEELGIDTSLKAKDLAGVLSKDVAAQLRDYVIA 146

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYSPA--NVHRMSDYQWKWFQKLDSDGALFLDFN 186
           +P  IG+TVE   LAS+ +D  LKG +   +  N   +S  Q      L + G L   FN
Sbjct: 147 NPDQIGQTVEFRFLASSRVDGYLKGRVTRDSIVNDKNISAEQLDLVDALAAAGVLEKTFN 206

Query: 187 YGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
             F     +S  RPE AGIGV+++GSL+MM +V+ L+ P+G+A++IYLEEF+ + + +  
Sbjct: 207 LDFITGADASDARPEAAGIGVSMLGSLFMMFVVLALALPIGVAASIYLEEFAPQNWLTDM 266

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +L++
Sbjct: 267 IEVNISNLAAVPSIVFGILGLAVFINYMHLPTSAPLVGGLVLTLMTLPTIIISTRASLKS 326

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV F+ 
Sbjct: 327 VPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVGFIA 386

Query: 365 D-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
                    G+    +A P QIY WA  A+  F ER +G I++LLIFL  +NT  + LR 
Sbjct: 387 SNAPETIADGLLAPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMNTLAVILRR 446

Query: 420 RFKKRW 425
           RF++RW
Sbjct: 447 RFERRW 452


>gi|319408037|emb|CBI81691.1| phosphate ABC transporter, permease protein [Bartonella
           schoenbuchensis R1]
          Length = 430

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 205/408 (50%), Positives = 292/408 (71%), Gaps = 2/408 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            L+ RY +E  FR Y +VA+ +   FLI+LL SIVS+G  A + + ++L I   E ++DP
Sbjct: 13  GLRRRYWAERRFRAYGLVAIFIGLFFLIILLWSIVSQGYTAFFHSEMTLSIYLDEKVIDP 72

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             +R  +P +L+ A+Y LLVR ALA KL +  ++ A +R  ++M S   R  LR  ++ +
Sbjct: 73  GGQRATNPKVLITANYPLLVRNALATKLGVDYNDRAAMRDINRMFSGNVRVQLRDMVVKN 132

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P+LIG T ++ +LA+A++D   K  +         ++S+ Q +W ++L  D  L+  FN 
Sbjct: 133 PNLIGTTQKIKILAAADVDLVYKRQINLQVAEEKRKVSNRQVEWIRRLIDDNTLYKTFNR 192

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFF  G+SSRPE +G+GVA++GS YMM IV+ ++ P+G+A+A+YLEE++ K  F+ F++ 
Sbjct: 193 GFFTFGSSSRPETSGLGVAIIGSFYMMFIVLAVALPIGVATALYLEEYARKNTFTDFIEI 252

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA++PSI++G+LG +V INF  MPRS + VGGL+L LMTLP+IIIAT  ALR VP 
Sbjct: 253 NINNLAAIPSIIFGLLGLSVFINFLGMPRSASFVGGLVLTLMTLPTIIIATRSALRAVPL 312

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK Q VFHHV+PLA+P ILTG+ + LA+ALGETAPLL +GMVAFV + P
Sbjct: 313 SIRTAALGLGASKTQVVFHHVVPLAVPGILTGTIIGLAQALGETAPLLLIGMVAFVANIP 372

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
               D ATA PVQI++WA +AER FVE+T GAI++L++FLAV+N + +
Sbjct: 373 TTPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLMVFLAVMNISAV 420


>gi|56696823|ref|YP_167185.1| phosphate ABC transporter, permease protein [Ruegeria pomeroyi
           DSS-3]
 gi|56678560|gb|AAV95226.1| phosphate ABC transporter, permease protein [Ruegeria pomeroyi
           DSS-3]
          Length = 450

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 183/429 (42%), Positives = 267/429 (62%), Gaps = 11/429 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
               + R  +E  FR Y + A+L+  + L +L+ +IVS+G GA  QT ++L +E  E+ +
Sbjct: 22  DARTRRRNRAEARFRAYGMGAILIGLMMLAVLVFTIVSRGTGAYTQTFVTLDVELLESKL 81

Query: 68  DPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARYHLRKT 125
           D +  R ++    +    Y  L+  A    +  +    AL  +  + +LS  A   LR  
Sbjct: 82  DKKGTRDIEAIKKVSTFGYAPLINAAFETAMDKAGIETALKPKDQAAILSKRAAAQLRDY 141

Query: 126 LMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDGALFL 183
           ++ DP  IG+TV    LA++ +D  LKG +     AN   +S  Q  +  +L + G +  
Sbjct: 142 VIADPERIGQTVSFRFLANSRVDGYLKGRVTRESIANDKSISTEQLDFVDQLIAAGMIRK 201

Query: 184 DFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            FN  F +   +S      AG+GV++VGSL+MML+V+ L+ P+G+A++IYLEEF+ K + 
Sbjct: 202 TFNLDFILGSDASDQRPEAAGMGVSMVGSLFMMLVVLVLALPIGVAASIYLEEFAPKNWL 261

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III+T  +
Sbjct: 262 TDVIEVNISNLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTIIISTRAS 321

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L++VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMV 
Sbjct: 322 LKSVPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIGMVG 381

Query: 362 FVTDYP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           F+   P      G+    +A P QIY WA  A+  F ER +G I++LL+FL  +NT  + 
Sbjct: 382 FIASNPPDGIAAGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLVTMNTLAVI 441

Query: 417 LRNRFKKRW 425
           LR RF++RW
Sbjct: 442 LRRRFERRW 450


>gi|163761274|ref|ZP_02168349.1| ABC phosphate transporter, inner membrane subunit PstA [Hoeflea
           phototrophica DFL-43]
 gi|162281431|gb|EDQ31727.1| ABC phosphate transporter, inner membrane subunit PstA [Hoeflea
           phototrophica DFL-43]
          Length = 432

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 185/431 (42%), Positives = 265/431 (61%), Gaps = 11/431 (2%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
              +  + R  +E  FR   + AV+   + L+ L++SI+S G+ +  QT+ISL +     
Sbjct: 2   KVGERTRKRNAAEKRFRMMGLAAVIFGLLALVGLMASILSNGLSSFNQTYISLDVYLDPA 61

Query: 66  IVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHA--LLRQASQMLSTTARYHL 122
            +D    R  +    +       L++ A+   +            ++A+ ++S  A   L
Sbjct: 62  KLDKNGNRAPEDLKKITTFTIQPLIKTAMQDMMQERGFAAEGVNAKEAAALVSKEAPADL 121

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSDGA 180
           R+ ++ +P  IG+T+   LLAS  ID   KG   + S A    +S  Q     +L   G 
Sbjct: 122 RRFVLANPDQIGETISFDLLASGRIDGYFKGRVTMESAALDRNISPEQLVLADRLKDAGI 181

Query: 181 LFLDFNYGFFINGA--SSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           + L FN+ FF       +RPE AG+GVA++GS YMMLIV+ LS P+G+A++IYLEEF+ K
Sbjct: 182 MDLRFNWSFFTAPDASDTRPEAAGLGVAILGSAYMMLIVLALSLPIGVAASIYLEEFAPK 241

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI NLA+VPSIV+GILG A+ INF  +P+S  +VG L+L LMTLP+IIIAT
Sbjct: 242 NRWTDLIEVNIANLAAVPSIVFGILGLALFINFIGLPQSAPVVGALVLTLMTLPTIIIAT 301

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             AL+ VP SIR AALG+GASK+Q +FHHVLPLA P ILTG+ + LA+ALGETAPLL +G
Sbjct: 302 RAALKAVPPSIRDAALGIGASKMQAIFHHVLPLAAPGILTGAIIGLAQALGETAPLLLIG 361

Query: 359 MVAFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           MVAFV +YP     G  D A+A PVQ+Y W    +  F+ER  GAI++LL+FL ++N   
Sbjct: 362 MVAFVREYPGAPPEGFFDPASALPVQVYNWTQRGDPAFIERASGAIIVLLVFLVIMNAVA 421

Query: 415 LWLRNRFKKRW 425
           + LR RF++RW
Sbjct: 422 ILLRRRFERRW 432


>gi|304394456|ref|ZP_07376377.1| phosphate ABC transporter, permease protein PstA [Ahrensia sp.
           R2A130]
 gi|303293366|gb|EFL87745.1| phosphate ABC transporter, permease protein PstA [Ahrensia sp.
           R2A130]
          Length = 419

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 189/425 (44%), Positives = 272/425 (64%), Gaps = 12/425 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           + SI +     R  +E  F+ Y + A+++   FL L+++SIV +G GA  Q+ I+L +  
Sbjct: 5   ASSILRSGPTKRSKAETRFKMYGLAAIILSLGFLALMVTSIVVRGTGAFQQSFITLDVAI 64

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
              +         D   +   ++  +++KAL  +   +  +    R   +++S+TA + +
Sbjct: 65  PADV---------DVNDINAPNWGGVLKKALRERFPDA-KSRNDKRSLYRLVSSTAEFTV 114

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGA 180
           R  +  +P+LIG T  +++ AS++ID  +KG +    P N  R++D Q  W   L   G 
Sbjct: 115 RDAVAANPALIGTTAPIAIRASSDIDMLIKGNVDLELPENQRRVTDQQAAWLTDLQQAGV 174

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           +   FN  FF  G S  PE AGI  AVVGS   +++   L+FPLG  +A+YLEEF+ KG 
Sbjct: 175 VETSFNKQFFTGGDSREPEQAGIWGAVVGSFLSLMVCFTLAFPLGTLAAVYLEEFAPKGR 234

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            S  ++ NINNLA+VPSIV+G+LG A+ +NFF +PRST LVGG++LALMTLP+IIIA+  
Sbjct: 235 ISQIIEVNINNLAAVPSIVFGLLGLAIFLNFFDLPRSTPLVGGMVLALMTLPTIIIASRA 294

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           +LR VP SIR AA GLGASKVQT FHHV+PLA+P +LTGS + +A+ALGETAPLL +GMV
Sbjct: 295 SLRAVPPSIREAAYGLGASKVQTTFHHVVPLAIPGMLTGSIIGMAQALGETAPLLMIGMV 354

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           AF+ D P GV D ATA PVQI+LWA   +R F+E+T  AI++LL FL ++N   + LR +
Sbjct: 355 AFIVDIPSGVLDAATALPVQIFLWADAPDRGFLEKTSAAIMVLLGFLIIMNIIAIVLRKK 414

Query: 421 FKKRW 425
            + RW
Sbjct: 415 LEVRW 419


>gi|85703114|ref|ZP_01034218.1| ABC phosphate transporter, inner membrane subunit PstA [Roseovarius
           sp. 217]
 gi|85672042|gb|EAQ26899.1| ABC phosphate transporter, inner membrane subunit PstA [Roseovarius
           sp. 217]
          Length = 449

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 190/433 (43%), Positives = 268/433 (61%), Gaps = 10/433 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        K R   E  FR   +VAV +  + L+ LL+SI++ G+ +  QT+I L +  
Sbjct: 17  SLLTQDARTKQRNAKEARFRMMGLVAVTIGLLSLVGLLTSILASGLSSFQQTYIELEVYL 76

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHA-LLRQASQMLSTTARY 120
               +D    R  +  A +    Y  L+  A+   +    +      + A +++S  A  
Sbjct: 77  DPAKLDKTGNRNPEDIAKVSTFGYAPLIDAAMGAAIERVGAATDINAKAAGELISKEAPA 136

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSD 178
            LR  ++ +   IG+TV+  LLA+  ID   KG   + + A    +S  Q +   +L   
Sbjct: 137 SLRDFVLANIDRIGETVQFDLLAAGRIDGFFKGRVTMETAALDRNISPEQLQLADQLKEA 196

Query: 179 GALFLDFNYGFFINGA--SSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G L   FN+ FF       +RPE AG+GVA++GS+YMMLIV+ L+ PLG+A++IYLEEF+
Sbjct: 197 GILTTKFNWAFFTAPDASDTRPEAAGLGVAIIGSIYMMLIVLVLALPLGVAASIYLEEFA 256

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K  ++  ++ NI+NLA+VPSIV+GILG A+ IN   +P+S  +VGGL+L LMTLP+III
Sbjct: 257 PKNRWTDLIEVNISNLAAVPSIVFGILGLAIFINMVGLPQSAPIVGGLVLTLMTLPTIII 316

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           AT  AL++VP SIR AALG+GASK+Q +FHHVLPLAMP ILTG+ + LA+ALGETAPLL 
Sbjct: 317 ATRAALKSVPPSIRDAALGVGASKMQAIFHHVLPLAMPGILTGAIIGLAQALGETAPLLL 376

Query: 357 VGMVAFVTDYPVGV----TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           +GMVAFV +YP G      D A A PVQ+Y W    +  FVER  GAI++LL+FL ++N 
Sbjct: 377 IGMVAFVREYPGGPPEGFFDPAAALPVQVYNWTQRGDPAFVERASGAIIVLLVFLVLMNI 436

Query: 413 AMLWLRNRFKKRW 425
           A + LR RF++RW
Sbjct: 437 AAILLRRRFERRW 449


>gi|329890387|ref|ZP_08268730.1| phosphate ABC transporter, permease protein PstA [Brevundimonas
           diminuta ATCC 11568]
 gi|328845688|gb|EGF95252.1| phosphate ABC transporter, permease protein PstA [Brevundimonas
           diminuta ATCC 11568]
          Length = 431

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 171/424 (40%), Positives = 259/424 (61%), Gaps = 9/424 (2%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
               K  L+ RY  E  FR+Y   A+ V   FL++LL SIV++G  A +   ++LP+   
Sbjct: 15  TQRLKSRLRARYARETRFRWYGRAAIGVALAFLVILLGSIVTQGYTAFYAHTVTLPVYMD 74

Query: 64  ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLR 123
              +D    +  +   +       +  + + R     D+          +LS+  ++   
Sbjct: 75  PARIDRSYPQGANFEQI-------VAEQQIRRLGIQDDAQGTKASTMKALLSSELKFQAA 127

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGAL 181
           K +   PSL+G+TV V+   S + +  LKG +    P +  R+++ Q  W  ++ + GA+
Sbjct: 128 KMIARQPSLLGQTVPVAAPLSDDAEMYLKGKITRDQPEDQRRVTNEQMDWLDRMKASGAV 187

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
              FN   F  G S++PE+AG+  AVVGS  M+++   ++ P+G+ +A++LEE+S +   
Sbjct: 188 RAHFNSALFTKGDSTQPELAGLLGAVVGSALMLMVTALIAIPVGVGAAVWLEEYSPRNRI 247

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           ++ ++ NINNLA+VPSIVYG+LG A+ INF  +PR++ LVGGL+LALM LP+IIIAT  +
Sbjct: 248 TAIIEVNINNLAAVPSIVYGLLGLALFINFMHLPRASPLVGGLVLALMALPTIIIATRSS 307

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+ VP SIR AAL +GAS+ QTVF HVLPLAMP ++TG+ +S+A ALGETAPLL +GM++
Sbjct: 308 LKAVPPSIREAALAMGASRTQTVFGHVLPLAMPGVMTGAIISMAHALGETAPLLLIGMIS 367

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           FV   P  + +   A P  IY+W   +ER F ERT  AIL+LL F+ V+N A + LR RF
Sbjct: 368 FVPGVPHAIDEPVGALPSLIYIWENASERAFHERTAAAILVLLAFMIVMNAAAVLLRRRF 427

Query: 422 KKRW 425
           ++RW
Sbjct: 428 ERRW 431


>gi|328544895|ref|YP_004305004.1| phosphate ABC transporter permease PstA [polymorphum gilvum
           SL003B-26A1]
 gi|326414637|gb|ADZ71700.1| Phosphate ABC transporter, permease protein PstA [Polymorphum
           gilvum SL003B-26A1]
          Length = 432

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 180/420 (42%), Positives = 262/420 (62%), Gaps = 12/420 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           K   K RY ++   +FY + A+ +   FL++L SS+V  G  A  QT +++ I      V
Sbjct: 23  KARRKSRYAADTRLKFYGLTAISMAIGFLLILFSSLVLTGYKAFVQTMVTVEIRLDPEQV 82

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +           +  A +  +V+ ALA        + A  RQ  Q+ +  A++ +R  ++
Sbjct: 83  NRDD--------IFNAPWRTIVQSALADLEP--GLDQADRRQFLQIFTPNAQFLVRDRVI 132

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P +IG+TV  +   +  +D   KG +    P +  R++D Q  W+  L+  G +   F
Sbjct: 133 ANPDMIGRTVSFTFPLADPLDQLAKGEVDRSLPEDRRRVNDKQIGWYDGLNERGLISQPF 192

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N G F+N  S  PE+AG+  A+ GS + +L+   LSFP GIA+AIYLEEF+ K   +  +
Sbjct: 193 NTGLFLNADSRFPELAGLAGAISGSFWALLVCFLLSFPAGIAAAIYLEEFAPKNRITDLI 252

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPS+V+G+LG AV +  F +PRS  LVGG++LALMTLP+III T  +L++V
Sbjct: 253 EVNINNLAAVPSVVFGLLGLAVFLGLFGLPRSAPLVGGMVLALMTLPTIIIVTRASLKSV 312

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           PSSIR AALG+GASK +T+ HH+LPL+MP ILTG+ + LA+ALGETAPLL +GM AF+T 
Sbjct: 313 PSSIREAALGIGASKHETIIHHILPLSMPTILTGTIIGLAQALGETAPLLLIGMNAFITS 372

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              GV + +TA P QI++WA   ER FV RT  AIL+LL FL  +N   ++LR RF++RW
Sbjct: 373 PTTGVLEASTALPTQIFIWADSPERGFVARTSAAILVLLGFLLAMNAIAIFLRQRFERRW 432


>gi|84684962|ref|ZP_01012862.1| phosphate ABC transporter, permease protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667297|gb|EAQ13767.1| phosphate ABC transporter, permease protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 443

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 187/435 (42%), Positives = 269/435 (61%), Gaps = 12/435 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        K R  +E  FR Y ++A+ +  VFL+ LLS+IV +GI A  QT ++LPI  
Sbjct: 9   SLYDVDARTKKRNAAEKRFRIYGMIAIGLGLVFLVALLSTIVVRGIPAFQQTKLTLPIAL 68

Query: 63  SETIVDPQKKRFMD-PAILLRADYNLLVRKALARKLSISDSNH--ALLRQASQMLSTTAR 119
            E  +D    R ++    +    YN L+ +ALA  L  +   +     +    +LS++A 
Sbjct: 69  PEETLDKSGVRDIEVMKKVSTFGYNPLIEQALADALDANGIENPFEDAKGLKPILSSSAA 128

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             +R  ++ +P L+G T    +LA++ +D  LKG +     A  + +    +     L  
Sbjct: 129 AVVRDEVLANPELVGTTHTFEILAASRVDGYLKGRVTRESVARDNNIDAAHFDVVDALRD 188

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G +   FN+ F     +S  RPE AGIGV+++GSL+MM +V+GLS P+G+A++IYLEEF
Sbjct: 189 AGIIAKGFNFDFITGADASESRPEQAGIGVSMLGSLFMMFVVLGLSLPIGVAASIYLEEF 248

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + +  F+  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+II
Sbjct: 249 ATQNRFTDIIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTII 308

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L+ VP SIR AALG+GASK+QTVFHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 309 ISTRASLKAVPPSIREAALGIGASKMQTVFHHVLPLAMPGILTGTIIGLAQALGETAPLL 368

Query: 356 FVGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV ++          G  D  +A P QIY WA  A+  + ER +G I++LL+FL  +
Sbjct: 369 LIGMVGYIASNYPDGVASGFLDPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLMTM 428

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR RF++RW
Sbjct: 429 NILAVILRRRFERRW 443


>gi|149914853|ref|ZP_01903382.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           AzwK-3b]
 gi|149811041|gb|EDM70878.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           AzwK-3b]
          Length = 452

 Score =  342 bits (877), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 178/436 (40%), Positives = 268/436 (61%), Gaps = 12/436 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +S +      + R  +E  FR Y + AV    +FL++LL SI+  G+GA  QT I +P+ 
Sbjct: 17  RSLNTVDARTRQRNRAEARFRAYGIAAVATGLLFLVILLGSILFNGVGAFQQTFIKVPVY 76

Query: 62  FSETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALLR--QASQMLSTTA 118
                +D   +R ++    +    Y  L+++ L   +  +D    L +     QM+S +A
Sbjct: 77  LDPAKLDKSGERDIEAIKKVSTFGYTPLIQQGLFDVVQAADIETPLAKPGDMKQMISPSA 136

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPA--NVHRMSDYQWKWFQKLD 176
              +R T++ +P LIG+TV+  +LAS+ +D  LK  ++         +          L 
Sbjct: 137 AAQVRDTVIDNPDLIGQTVDFRILASSRVDGYLKDRVFREDVVRDKNIDVEHLDIVDGLV 196

Query: 177 SDGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
           + G +  +FN  F     +S  RPE AG+GV+++GS +MML+V+ LS P+G+A++IYLEE
Sbjct: 197 ASGIVAKEFNLSFITGADASESRPEQAGLGVSILGSFFMMLVVLALSLPIGVAASIYLEE 256

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           F+ +  F+  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL L LMTLP+I
Sbjct: 257 FAPQNRFTDLIEVNISNLAAVPSIVFGILGLAVFIQFAHLPQSAPLVGGLTLTLMTLPTI 316

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           +I+T  +L++VP SIR AALG+GASK+Q VFHHVLP+AMP ILTG+ + LA+ALGETAPL
Sbjct: 317 VISTRASLKSVPPSIRDAALGVGASKMQAVFHHVLPMAMPGILTGTIIGLAQALGETAPL 376

Query: 355 LFVGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           L +GMV ++       +  G  D  +A P QI+ WA  A+  + ER +G I++LL+FL  
Sbjct: 377 LLIGMVGYIATNYPDGFASGFMDPNSAMPAQIFEWAKRADPAYYERAWGGIIILLVFLMT 436

Query: 410 INTAMLWLRNRFKKRW 425
           +N   + LR RF++RW
Sbjct: 437 MNIIAIILRRRFERRW 452


>gi|83953657|ref|ZP_00962378.1| phosphate ABC transporter, permease protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83841602|gb|EAP80771.1| phosphate ABC transporter, permease protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 446

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 186/435 (42%), Positives = 268/435 (61%), Gaps = 11/435 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            S          R  +E  F+ Y + A+ V  + L +LL++I+ +G GA  QT ++L ++
Sbjct: 12  HSLLKPDARTVKRNRAEARFKSYGIAAIAVGLLMLAILLTTIIGRGAGAFQQTFLTLNVQ 71

Query: 62  FSETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTAR 119
             E  +D    R +D    +    Y  L+  AL  K++ +     L  +  + +LS  A 
Sbjct: 72  LLEQKLDKNGNRNLDEIKKVSTFGYAPLMAAALEAKVAEAGITTDLKPKAMAGILSKDAA 131

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             LR  ++ +P LIG  VE   L ++ +D  +KG +     AN   ++  Q      L +
Sbjct: 132 AQLRDFVLDNPELIGTAVEFEFLTNSRVDGYMKGRVTRDSIANDKSINAEQLDLVDALVA 191

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
           DGAL   FN  F I   +S  RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF
Sbjct: 192 DGALEKRFNIDFIIGADASDARPEAAGMGVSMLGSLFMMLVVLALALPIGVAASIYLEEF 251

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K   +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+II
Sbjct: 252 APKNLLTDIIEVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTII 311

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L++VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL
Sbjct: 312 ISTRASLKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLL 371

Query: 356 FVGMVAFVTDYP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV F+   P      G+ D  +A P QIY WA  A+  F ER +G I++LL+FL  +
Sbjct: 372 LIGMVGFIASNPPDGIASGLMDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITM 431

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR RF++RW
Sbjct: 432 NAIAVMLRRRFERRW 446


>gi|89054782|ref|YP_510233.1| phosphate ABC transporter permease [Jannaschia sp. CCS1]
 gi|88864331|gb|ABD55208.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Jannaschia sp. CCS1]
          Length = 457

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 196/440 (44%), Positives = 272/440 (61%), Gaps = 16/440 (3%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +S   +      R  +E  FR Y + AV V  + LI+LL+SI+  G+ A  QT+IS P+ 
Sbjct: 18  RSLFASDARTAKRNRAERRFRVYGMAAVGVGILALIVLLASILGNGLSAFKQTYISYPLV 77

Query: 62  FSETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTAR 119
            SE  +DP   R   + A +    Y  ++  +L   L      H +  R+ + MLS  A 
Sbjct: 78  LSEDRLDPDGNRDPAEMARVTTFGYLPVLALSLEAFLEAEGIEHEMGGRELAAMLSEEAP 137

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             +R  ++ +P L+G+T++  +L    ID   KG   + S      +S  Q    Q L  
Sbjct: 138 AQVRAMVLANPDLLGQTIDAEILLGGRIDGFFKGRVTMESAERDRNVSVNQLLLAQALAE 197

Query: 178 DGALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G + + FN+ F     +S      AG+GVA++GSLYMM++V+ L+ P+G+A++IYLEEF
Sbjct: 198 RGEVVIRFNWDFITWPDASGSRPEAAGLGVAIIGSLYMMIVVLVLALPIGVAASIYLEEF 257

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K   +  ++ NI+NLA+VPSIVYGILG AV INF +  +S+ LVGGL+L LMTLP+II
Sbjct: 258 APKNRLTDVIEVNISNLAAVPSIVYGILGLAVFINFMEFNQSSPLVGGLVLTLMTLPTII 317

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT  +LR VP SIR AALGLGASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 318 IATRASLRAVPPSIRQAALGLGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPLL 377

Query: 356 FVGMVAFVTDYPVGVT----------DIATAFPVQIYLWAADAERPFVERTFGAILLLLI 405
            +GMVAFV +YP  V+          D ATA PVQ+Y W   ++  FVER  GAI++LL+
Sbjct: 378 LIGMVAFVREYPDLVSTHSNAFPLMGDGATALPVQVYSWTQRSDPAFVERASGAIIVLLL 437

Query: 406 FLAVINTAMLWLRNRFKKRW 425
           FL  +N   + LR RF++RW
Sbjct: 438 FLLAMNAIAILLRRRFERRW 457


>gi|49473894|ref|YP_031936.1| phosphate ABC transporter permease [Bartonella quintana str.
           Toulouse]
 gi|49239397|emb|CAF25735.1| Phosphate transport system permease protein [Bartonella quintana
           str. Toulouse]
          Length = 430

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 216/410 (52%), Positives = 299/410 (72%), Gaps = 2/410 (0%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  FR Y ++A+ +   FL  LL SI+S+G  A +Q+ ++L I   E ++DP
Sbjct: 13  GIKRRYWAERRFRAYGLIAIFIGLFFLFALLWSIMSQGYAAFFQSEMTLSIYLDEKVIDP 72

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             +R  +P +L+ A+Y LLV+ ALA KL I  +N   LR  ++M S + R  LR+ +  +
Sbjct: 73  SGQRETNPQVLITANYPLLVQNALATKLGIDQNNRVALRDVNRMFSNSVRVQLREMVTKN 132

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P LIGKT ++ +LA+ANID+A KG +         ++S+ Q +W ++L  DG L+  FN+
Sbjct: 133 PKLIGKTQKIKVLAAANIDAAYKGQIDLHVAEKNRKVSNRQVEWMRRLAYDGTLYKTFNF 192

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFF  GASSRPE AG+GVA++GS YM+ IV+ +S P+GIA+A+YLEE++ K  F+ F++ 
Sbjct: 193 GFFTFGASSRPETAGLGVAIIGSFYMIAIVLVISLPIGIATALYLEEYARKNKFTDFIEV 252

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV +NFF +PRS + VGGL+LALMTLP+IIIAT  ALR VP 
Sbjct: 253 NINNLAAVPSIVFGLLGLAVFVNFFGLPRSASFVGGLVLALMTLPTIIIATRSALRAVPL 312

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR+AALGLGASK Q VFHHV+PLA P ILTG+ + +A+ALGETAPLL +GMVAFV + P
Sbjct: 313 SIRAAALGLGASKTQMVFHHVVPLAAPGILTGTIIGVAQALGETAPLLLIGMVAFVANIP 372

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
               D ATA PVQI++WA +AER FVE+T GAI++LL+FL+V+N + ++L
Sbjct: 373 ATPMDPATALPVQIFMWAGEAERAFVEKTSGAIIVLLVFLSVMNISAVFL 422


>gi|149376560|ref|ZP_01894321.1| phosphate ABC transporter, permease protein [Marinobacter algicola
           DG893]
 gi|149359227|gb|EDM47690.1| phosphate ABC transporter, permease protein [Marinobacter algicola
           DG893]
          Length = 424

 Score =  340 bits (872), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 179/421 (42%), Positives = 260/421 (61%), Gaps = 5/421 (1%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
            I +++LK RY  E  FR Y ++A+ +    L++L   I+ KG     +T I++ +E   
Sbjct: 9   EIVRQSLKRRYRKERRFRAYGILAIAIALSALVVLFVDIIGKGYTGFTKTTITMEVELDG 68

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
            ++        D   +  AD+   + +AL +++    +          +L+  A   LR 
Sbjct: 69  EMMYLDD--ATDKKQIKMADFVEPLLQALIKQVP--GATEENRDAVRDLLNPYASNELRD 124

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            L  +P  +G T  +++LA  ++D  +K +    A   ++SD Q +W  +L     +   
Sbjct: 125 MLEQNPEWLGTTQTLTVLAHTDVDVYVK-HAGDDAYSIKLSDRQQRWVDQLVEKEVVQTS 183

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN  FF +G S  P  AGI  A+VGSL  ML+ + LSFP+G+A+AIYLEEF+ +   + F
Sbjct: 184 FNDVFFSSGDSRDPSRAGILGAIVGSLLTMLVTLVLSFPIGVAAAIYLEEFAPQNKLTDF 243

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPSI++G+LG AV IN F MPRS  +VGGL+L LMTLP+III++  A+++
Sbjct: 244 IEVNINNLAAVPSIIFGLLGLAVFINLFGMPRSVPVVGGLVLTLMTLPTIIISSRAAIKS 303

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AA G+GASK+Q V HHVLPLAMP +LTGS + +A+ALGETAPLL +GMVAF+ 
Sbjct: 304 VPPSIREAAEGIGASKMQVVLHHVLPLAMPGMLTGSIIGMAQALGETAPLLLIGMVAFIV 363

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P G  D AT  PVQ++LWA   E  F+ER   AI++LL FL  +N   +WLR R ++R
Sbjct: 364 DVPDGFFDSATVLPVQVFLWAGSPELAFIERASAAIMVLLAFLVSMNALAIWLRKRLERR 423

Query: 425 W 425
           W
Sbjct: 424 W 424


>gi|302382811|ref|YP_003818634.1| phosphate ABC transporter inner membrane subunit PstA
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302193439|gb|ADL01011.1| phosphate ABC transporter, inner membrane subunit PstA
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 431

 Score =  340 bits (872), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 189/423 (44%), Positives = 262/423 (61%), Gaps = 9/423 (2%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
           S+ K+ LK RY  E  F+ Y ++A+ V   FL+LLL  I+ +G  A +   I++P+    
Sbjct: 16  SLLKRGLKARYAREGRFKLYGLLAIGVAMSFLLLLLGRIIEQGHTAFYANQITVPVYMDP 75

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
             +D    +  +   +       + +++LAR     D           +LS+  ++    
Sbjct: 76  ARIDRAYPQGTNFQQM-------VAQQSLARMGVTDDERGTKTTAYRALLSSELKFRAAA 128

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALF 182
            +  +P+LIG+TV V+   S   D   KG +    PA+  ++SD Q  W   L  DGA+ 
Sbjct: 129 MIRENPALIGQTVTVTAPVSDEADLYYKGEVTRETPADQRKVSDQQMAWLDGLKRDGAVS 188

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
             FN   F NG S+ PE+AG+  AVVGS  M+L+   L+ PLG+ +A+YLEEFS KG  +
Sbjct: 189 TTFNTLLFTNGDSTEPELAGVLGAVVGSALMLLVTAALAIPLGVGAAVYLEEFSKKGRIT 248

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NINNLA+VPSIVYG+LG A+ IN+  +PRS+ LVGGL+LALM LP+IIIAT  AL
Sbjct: 249 DLIEVNINNLAAVPSIVYGLLGVALFINWAHLPRSSPLVGGLVLALMALPTIIIATRSAL 308

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP SIR AAL +GAS+ QTVFHHVLPLAMP +LTG+ +S+A ALGETAPLL +GMV+F
Sbjct: 309 KAVPPSIREAALAMGASRTQTVFHHVLPLAMPGVLTGTIISMAHALGETAPLLLIGMVSF 368

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           V   P  VT    A P  +Y+W   +ER F ERT  AIL+LL F+ V+N A + LR RF+
Sbjct: 369 VPGIPHSVTAPTGALPSLVYIWENASERAFHERTAAAILVLLAFMIVMNAAAILLRRRFE 428

Query: 423 KRW 425
           +RW
Sbjct: 429 RRW 431


>gi|126737845|ref|ZP_01753575.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           SK209-2-6]
 gi|126721238|gb|EBA17942.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           SK209-2-6]
          Length = 448

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 183/435 (42%), Positives = 267/435 (61%), Gaps = 11/435 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            S        + R  +E  FR + + A++V  + LILL+++IVSKG GA  QT I++ +E
Sbjct: 14  NSLLTETARTRKRNAAERRFRAFGIAAIMVGLLMLILLVTTIVSKGTGAFQQTFITVNVE 73

Query: 62  FSETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTAR 119
             E+ +D +  R ++    +    Y  L++ A+   ++      +L  +  + +LS +A 
Sbjct: 74  LLESKLDKKGNRNIEEIKKVTTFGYAPLLKTAMKDLVADLSIETSLKSKHLAALLSKSAV 133

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPA--NVHRMSDYQWKWFQKLDS 177
             LR  ++ +P  IGKTVE   LA + +D  LKG +   +  N   +S  Q      L +
Sbjct: 134 AELRAYVIANPDQIGKTVEFRFLAQSRVDGYLKGRVTRESVVNDKNISAEQLDLVDALVA 193

Query: 178 DGALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G +   FN  F +   +S      AGIGV++ GSL+MM++V+ L+ P+G+A++IYLEEF
Sbjct: 194 VGTIEKTFNLDFILGSDASDQRPEAAGIGVSMAGSLFMMMVVLALALPIGVAASIYLEEF 253

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + + + +  ++ NI NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+II
Sbjct: 254 APRNWLTDIIEVNIANLAAVPSIVFGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTII 313

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  AL+ VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL
Sbjct: 314 ISTRAALKAVPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLL 373

Query: 356 FVGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV F+          G+    +A P QIY WA  A+  F ER +G I++LL+FL  +
Sbjct: 374 LIGMVGFIASNAPETIAEGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLVTM 433

Query: 411 NTAMLWLRNRFKKRW 425
           NT  + LR RF++RW
Sbjct: 434 NTIAVILRRRFERRW 448


>gi|226952526|ref|ZP_03822990.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. ATCC 27244]
 gi|294649821|ref|ZP_06727223.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Acinetobacter haemolyticus ATCC 19194]
 gi|226836753|gb|EEH69136.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. ATCC 27244]
 gi|292824304|gb|EFF83105.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 465

 Score =  339 bits (870), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 186/438 (42%), Positives = 265/438 (60%), Gaps = 22/438 (5%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
            +K+L  R+  E  FRF    AV++   F+ LL  SI+SKG+ A WQ  I++P+ F   I
Sbjct: 31  IQKSLAKRHRKEKTFRFLGFSAVMLGLAFVALLFVSILSKGLPAFWQNTITIPVYFDPAI 90

Query: 67  VDPQKKRFMDPAI---------------LLRADYNLLVRKALARKLSISDSNHALLRQAS 111
           +D                          +  AD++ L+  A+ +K            +  
Sbjct: 91  IDAGAPPKRQAGETPARFQERYVEWQTQMGMADWDALITNAIVKKDPAVAPQRD---ELI 147

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +  +PSLIGKT ++ +LA ANID  L G +    P    ++S    
Sbjct: 148 GIYTSSESYRLRDMVFANPSLIGKTQDIKILADANIDVWLAGNIDRSLPDEQQQLSPELR 207

Query: 170 KWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           +   +L +DG +   FN  FF+N  S      +G+  A +GSL+MMLIVI +S P+G+AS
Sbjct: 208 QLADQLKADGVIKNTFNTDFFVNPDSRSSPATSGLAGAFMGSLFMMLIVILISIPIGVAS 267

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           A+YLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+L
Sbjct: 268 AVYLEEFAPKNVMTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPISAPLVGGLVLSL 327

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGAS+VQTVFHHVLPLA+P ILTG+ + +A+AL
Sbjct: 328 MTLPTVIITTRASLKAVPPSIRQAALGLGASRVQTVFHHVLPLALPGILTGAIIGVAQAL 387

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D +TA PVQI+LW  +  R F E RT  AI++LL  +
Sbjct: 388 GETAPLLLIGMSAFVASVPASPLDQSTALPVQIFLWQGNELRNFFEGRTAAAIIVLLALM 447

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 448 IGLNSLAIWLRKKFEVRW 465


>gi|163746357|ref|ZP_02153715.1| Phosphate transport system permease protein 2 [Oceanibulbus
           indolifex HEL-45]
 gi|161380242|gb|EDQ04653.1| Phosphate transport system permease protein 2 [Oceanibulbus
           indolifex HEL-45]
          Length = 451

 Score =  339 bits (870), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 186/434 (42%), Positives = 266/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S  +     K R  +E  F+ Y +VA+ +  + L+ LL +IVS+G GA  QT ++L +  
Sbjct: 18  SLLVQDGRTKRRNAAEGRFKLYGIVAITIGLLMLLTLLFTIVSRGTGAFQQTFVTLSVPL 77

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARY 120
            E  +D    R ++    +    Y  L++ A   K+  +     L  +  + +LS  A  
Sbjct: 78  LEDKLDKNGNRDLEEIKKVSTFGYAPLLKAAFETKVEDTGIETELKSKAMADILSKDAAA 137

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSD 178
            LR  ++ +P LIG  VE   L ++ +D  LKG +     AN   +S  Q      L +D
Sbjct: 138 QLRDHVLANPELIGSVVEFEFLTNSRVDGYLKGRVTRESIANDKNISAEQLDLVDALVAD 197

Query: 179 GALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G+L   FN  F     +S  RPE AG+GVA++GS  MML+V+ L+ P+G+A++IYLEEF+
Sbjct: 198 GSLAKRFNLDFITGADASDARPEAAGMGVAMIGSFAMMLVVLVLALPIGVAASIYLEEFA 257

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III
Sbjct: 258 PKNWITDIIEVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTIII 317

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  +L++VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 318 STRASLKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 377

Query: 357 VGMVAFVTDYP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+   P      G+    +A P QIY WA  A+  F ER +G I++LL+FL  +N
Sbjct: 378 IGMVGFIASNPPESIAEGLMSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLISMN 437

Query: 412 TAMLWLRNRFKKRW 425
              + LR RF++RW
Sbjct: 438 AIAVLLRRRFERRW 451


>gi|331006820|ref|ZP_08330080.1| Phosphate transport system permease protein PstA [gamma
           proteobacterium IMCC1989]
 gi|330419372|gb|EGG93778.1| Phosphate transport system permease protein PstA [gamma
           proteobacterium IMCC1989]
          Length = 429

 Score =  338 bits (868), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 166/428 (38%), Positives = 254/428 (59%), Gaps = 7/428 (1%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           +K+     + L  RY +E  FR Y ++++    + ++ L ++I+ KG+      ++ + +
Sbjct: 6   IKTIDKVNRTLGKRYRAEKRFRLYGMLSIGFGLLCVLFLFTNIIGKGLSGFTYHYLQISV 65

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLS-TTAR 119
           E   T ++      ++   +L  +Y+ +V++          S+      A ++LS     
Sbjct: 66  EMDATTLEISDTSDLN--QILAGNYSAVVKRGAYEYF--DVSSRRDKSAARKLLSVDGTG 121

Query: 120 YHLRKTL-MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHR-MSDYQWKWFQKLDS 177
           Y L+    +    +I     V  L    +D  LK             S+ Q +W      
Sbjct: 122 YLLQDRFKVDAKEIINTKSMVWALVDDKVDFYLKRLGEPGEPGKHEFSEKQLQWIHAAVE 181

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            G L   FN+ FF NG S+  E AGI  AV+GS Y++L+ + LSFP+GIA+AIYLEE++ 
Sbjct: 182 SGDLQKRFNWAFFNNGDSAHSEEAGIRGAVMGSFYLLLVTLALSFPIGIATAIYLEEYAP 241

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K  ++  ++ NINNLA+VPSI++G+LG A+ + FF  PRST LVGG +L LMTLP+III+
Sbjct: 242 KNKWTDLIEVNINNLAAVPSIIFGLLGLAIFLAFFGFPRSTPLVGGFVLTLMTLPTIIIS 301

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           +  +++ VP SIR AA GLG+SK+Q   HHVLPLAMP +LTG+ + LA+ALGE+APLL +
Sbjct: 302 SRASIKAVPPSIREAAYGLGSSKMQVTLHHVLPLAMPGMLTGTIIGLAQALGESAPLLMI 361

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GM AF+ + P GV+D ATA P+QI+ W  +A+  F E+   AIL+LL+FL V+NT  +W 
Sbjct: 362 GMAAFIPEVPTGVSDPATALPMQIFQWFRNADAGFSEKASAAILVLLMFLIVMNTLAVWA 421

Query: 418 RNRFKKRW 425
           R R ++RW
Sbjct: 422 RRRLERRW 429


>gi|255263961|ref|ZP_05343303.1| phosphate ABC transporter, permease protein PstA [Thalassiobium sp.
           R2A62]
 gi|255106296|gb|EET48970.1| phosphate ABC transporter, permease protein PstA [Thalassiobium sp.
           R2A62]
          Length = 441

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 194/433 (44%), Positives = 273/433 (63%), Gaps = 10/433 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        + R  +E  F+ Y + AV+   + L +LL+SI+S G+GA  QT +++ I  
Sbjct: 9   SLLTEDARTRKRNRAESRFKAYGLTAVIASVLALFMLLASILSNGLGAFQQTFVTINIAL 68

Query: 63  SETIVDPQKKRFMD-PAILLRADYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARY 120
            E  +D    R  +  A +    Y  L+R  L + L+ +        +    ++S  A  
Sbjct: 69  PEDKLDKSGVRDPEVMAKVSTFGYTPLIRDGLVQTLANAGIETDQSAKALLGLISKEAPA 128

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDSD 178
            LR  ++ +P L+G+TV + LLA+  ID   KG   + S A     S    +  Q+L  D
Sbjct: 129 ALRYRVLANPDLVGQTVSMELLANGRIDGFFKGRVTMESAALDKNTSPEILQVAQQLADD 188

Query: 179 GALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G +   FN+GF     +S      AG+GVA++GSLYMM++V+ L+ PLG+A++IYLEEF+
Sbjct: 189 GLMTTRFNWGFLTKPDASDQRPESAGLGVAILGSLYMMIVVLALALPLGVAASIYLEEFA 248

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
              + +  ++ NI+NLA+VPSIVYGILG A+ INF  +P+S  LVGGL+L LMTLP+III
Sbjct: 249 PNNWITDLIEVNISNLAAVPSIVYGILGLAIFINFAGLPQSAPLVGGLVLTLMTLPTIII 308

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  AL++VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 309 STRAALKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 368

Query: 357 VGMVAFVTDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           +GMVAFV +YP     G TD ATA PVQI+ W   A+  FVER FGAI+ LL+FL  +N 
Sbjct: 369 IGMVAFVKEYPEIGIEGFTDPATALPVQIFNWTQRADPAFVERAFGAIITLLVFLLFMNL 428

Query: 413 AMLWLRNRFKKRW 425
             ++LR +F++RW
Sbjct: 429 LAIFLRRKFERRW 441


>gi|311696278|gb|ADP99151.1| phosphate ABC transporter, permease protein PstA [marine bacterium
           HP15]
          Length = 424

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 176/421 (41%), Positives = 260/421 (61%), Gaps = 5/421 (1%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
            I +++LK RY  E  FR Y ++A+ +    L++L + I+ KG     +T I++ ++   
Sbjct: 9   EIVRQSLKRRYRKERRFRAYGILAIAIALGALLILFTDIIGKGYTGFVKTTITMDVQLDG 68

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
            ++        D   +  AD+   + +AL +++    +     +Q  ++++  A   LR 
Sbjct: 69  EMMYLDDP--TDERQIKMADFVEPLVQALIKEIP--GATEDDRKQVRELINPYASVTLRD 124

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            L  +P  +G T  ++ L   ++D  +K +    A   +++D Q  W   L   G +   
Sbjct: 125 ALKANPEWLGTTQTMTFLTHTDVDVYVK-HAGDDAYSIKLNDQQKAWVDDLLERGIIETS 183

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN  FF  G S  P  AGI  A+VGSL  M + + LSFP+G+A+AIYLEEF+ +  F+ F
Sbjct: 184 FNDVFFSGGDSRDPSKAGILGAIVGSLLTMFVTLILSFPIGVAAAIYLEEFAPQNKFTDF 243

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPSI++G+LG AV IN F MPRS  +VGGL+L LMTLP+III++  A+++
Sbjct: 244 IEVNINNLAAVPSIIFGLLGLAVFINLFGMPRSVPVVGGLVLTLMTLPTIIISSRAAIKS 303

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AA G+GASK+Q V HHVLPLAMP +LTGS + +A+ALGETAPLL +GMVAF+ 
Sbjct: 304 VPPSIREAAEGIGASKMQVVLHHVLPLAMPGMLTGSIIGMAQALGETAPLLLIGMVAFIV 363

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P G  D AT  PVQ++LWA   E  F+ER   AI++LL FL  +N   +W+R R ++R
Sbjct: 364 DVPDGFFDSATVLPVQVFLWAGSPELAFIERASAAIMVLLAFLISMNALAIWMRKRLERR 423

Query: 425 W 425
           W
Sbjct: 424 W 424


>gi|315121870|ref|YP_004062359.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495272|gb|ADR51871.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 427

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 338/427 (79%), Positives = 383/427 (89%), Gaps = 2/427 (0%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           MKSFS+NKK LK RYISE+LFRF CV+AVL+V  FLI+ L SIVSKGIG LWQTHISLPI
Sbjct: 1   MKSFSVNKKKLKSRYISEFLFRFSCVIAVLIVLAFLIIFLYSIVSKGIGTLWQTHISLPI 60

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
           EFSETI+DP K RF DP+IL +A+YNLLV+ ALARKL ISDS H++L Q S+M+S+T RY
Sbjct: 61  EFSETIIDPNKNRFKDPSILQKANYNLLVQMALARKLGISDSEHSMLAQVSEMISSTVRY 120

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSD 178
            LR TL+ DPSLIGKTVE+ LLASANIDSALKGY+    PA V ++SD Q KWF++L +D
Sbjct: 121 RLRNTLLADPSLIGKTVEMPLLASANIDSALKGYIDFSLPATVRKISDDQLKWFRQLVAD 180

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           G++   FNYGFF+NGASSRPE AGIGVA+VGSLYM+LIVI LSFP+GIASAIYLEEF+ K
Sbjct: 181 GSISFHFNYGFFVNGASSRPESAGIGVAIVGSLYMILIVIALSFPVGIASAIYLEEFAPK 240

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
            FFSSF+QANINNLASVPS+VYGILGSA+L+NFF+MPRST+LVGGLILA+MTLPSIIIA 
Sbjct: 241 NFFSSFIQANINNLASVPSVVYGILGSAMLVNFFQMPRSTSLVGGLILAIMTLPSIIIAA 300

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
           GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLA+PAILTGSTVSLARALGETAPLLFVG
Sbjct: 301 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAVPAILTGSTVSLARALGETAPLLFVG 360

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           MVAFVTDYP G+TDIATAFPVQ+YLW +DAER FVE+TFG+ILLLL+FLAVINT MLWLR
Sbjct: 361 MVAFVTDYPEGITDIATAFPVQVYLWTSDAERLFVEKTFGSILLLLVFLAVINTVMLWLR 420

Query: 419 NRFKKRW 425
           NRF+K W
Sbjct: 421 NRFRKHW 427


>gi|259416460|ref|ZP_05740380.1| phosphate ABC transporter, permease protein PstA [Silicibacter sp.
           TrichCH4B]
 gi|259347899|gb|EEW59676.1| phosphate ABC transporter, permease protein PstA [Silicibacter sp.
           TrichCH4B]
          Length = 441

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 182/435 (41%), Positives = 265/435 (60%), Gaps = 11/435 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            S        K R  +E  F+ Y + A+ V  + L++L+++I SKG+GA  QT I+L +E
Sbjct: 7   NSLLELTDRTKRRNAAETRFKAYGIAAIAVGLLMLVVLVTTIFSKGLGAFQQTFITLQVE 66

Query: 62  FSETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTAR 119
             E  +D    R +D    +    Y  ++R A+  +++       L  +  + +LS  A 
Sbjct: 67  LLEEKLDKNGNRDLDDIKKVTTFGYAPIIRNAVESRVTELGVETPLKAKDMAGLLSKDAA 126

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             LR+ ++ +P  IGKTVE   LA + +D  LKG +      N   +S  Q        +
Sbjct: 127 ATLREFVIANPDEIGKTVEFRFLAQSRVDGYLKGRVSRDSIENDKNISAEQLDLVDAFVA 186

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
              +   FN  F +   +S  RPE AG+GV+++GSL+MM +V+ L+ P+G+A++IYLEEF
Sbjct: 187 ADVIEKTFNLDFILGADASDARPEAAGMGVSMLGSLFMMFVVLALALPIGVAASIYLEEF 246

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + + + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+II
Sbjct: 247 APQNWLTDIIEVNISNLAAVPSIVFGILGLAVFINYMHLPTSAPLVGGLVLTLMTLPTII 306

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L+ VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL
Sbjct: 307 ISTRASLKAVPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLL 366

Query: 356 FVGMVAFVT-----DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV F+          G+    +A P QIY WA  A+  F ER +G I++LL+FL  +
Sbjct: 367 LIGMVGFIASNAPDSIASGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITM 426

Query: 411 NTAMLWLRNRFKKRW 425
           NT  + LR RF++RW
Sbjct: 427 NTLAVILRRRFERRW 441


>gi|260772583|ref|ZP_05881499.1| phosphate transport system permease protein PstA [Vibrio
           metschnikovii CIP 69.14]
 gi|260611722|gb|EEX36925.1| phosphate transport system permease protein PstA [Vibrio
           metschnikovii CIP 69.14]
          Length = 456

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 187/443 (42%), Positives = 272/443 (61%), Gaps = 22/443 (4%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           K+     K+LK R+ SE  F+ + + AV +   F+++L  S+ SKGI A WQ  +SL + 
Sbjct: 17  KTQLRIAKSLKKRHASERRFKAFGMGAVGLALSFVLILFVSVFSKGIPAFWQATVSLNVY 76

Query: 62  FSETIVDPQKKR---------------FMDPAILLRADYNLLVRKALARKLSISDSNHAL 106
           F   +++ + K                      +   ++N ++  +LA+++  +      
Sbjct: 77  FDPEVINIEPKPVQLSGESAGEFQQRMLAWQGQVGMVNFNRIIVNSLAKEIPEAPRYQ-- 134

Query: 107 LRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRM 164
            R A +++++  R+ LR  L+ DPSLIGKT+ + LLA AN+D  LKG +    P +  ++
Sbjct: 135 -RDALRLITSGERFALRDMLVNDPSLIGKTLRLDLLADANVDVWLKGNIDRDLPDSRQQL 193

Query: 165 SDYQWKWFQKLDSDGALFLDFNYGFFINGASSRP-EVAGIGVAVVGSLYMMLIVIGLSFP 223
           S     W  +L   G +   F+   F+N  S      AG+  A +GS++MMLIV+ LS P
Sbjct: 194 SARTRAWADELADRGVIQNKFSTALFMNVDSRSSLASAGLAGAFMGSVFMMLIVMVLSVP 253

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
           +G+ASAIYLEEF+ K   + F++ NINNLA+VPSIV+G+LG++V I +FK+P S   VGG
Sbjct: 254 IGVASAIYLEEFAPKNKLTDFIEVNINNLAAVPSIVFGLLGASVFILWFKLPLSAPFVGG 313

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L+L LMTLP++IIAT   L+ +P SIR AALG+GASK Q VFHHVLPLA+P ILTG+ + 
Sbjct: 314 LVLTLMTLPTVIIATRSTLKAIPPSIRQAALGIGASKTQAVFHHVLPLALPGILTGAILG 373

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILL 402
           +A+ALGETAPLL +GM +FV   P    D +TA PVQI+LW  +  R F E RT  AI++
Sbjct: 374 IAQALGETAPLLLIGMNSFVASIPSTPMDQSTALPVQIFLWQGNELRNFFEARTSAAIIV 433

Query: 403 LLIFLAVINTAMLWLRNRFKKRW 425
           LL  +  +N   +WLR RF+ RW
Sbjct: 434 LLALMISLNALAIWLRRRFETRW 456


>gi|330813173|ref|YP_004357412.1| phosphate transport system permease protein PstA [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486268|gb|AEA80673.1| phosphate transport system permease protein PstA [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 420

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 162/420 (38%), Positives = 261/420 (62%), Gaps = 6/420 (1%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           ++ LK RY +E  F+ Y +++V    +F+ +L+  + S+G GA  +T I L ++ S+  +
Sbjct: 4   EQRLKKRYSAEKRFKAYGIISVCAALLFVGILVFKVFSEGSGAFVKTAIQLELDLSKEKL 63

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           +               D+    ++ + +            ++   + S+   Y ++  ++
Sbjct: 64  NL--PEKPSKEDFENIDFYDFAQQHILKIYPA--ITTKEKKELLTLFSSDFEYEVKDFIL 119

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
           ++ +LIG+ V   + A++++D   KG      P    ++S++Q   +  L  +  +   F
Sbjct: 120 SNKNLIGQKVFFKITAASDLDQMHKGNYTRDIPEERRKVSNFQLTIYDFLLKENKISKIF 179

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N   F NG S  PE+AGIG A++GS + +++ + +SFP+ + +A+YLEEF+ K  F+ F+
Sbjct: 180 NNYLFSNGDSRNPEIAGIGGAMLGSFFSIIVCLIISFPIALLAAVYLEEFAPKNAFTDFI 239

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+LG  +L+N F++PRST+LVGG+ LALMTLP III    +L+ V
Sbjct: 240 EININNLAAVPSIVFGLLGLGILLNVFELPRSTSLVGGITLALMTLPRIIIPCRASLKAV 299

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR  AL +GASKVQ+V HHV+PLAMP  L+G+ + LA+ALGETAPLL +GMVAFV  
Sbjct: 300 PPSIREGALAVGASKVQSVMHHVVPLAMPGTLSGTIIGLAQALGETAPLLLIGMVAFVVQ 359

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P    D +++ PVQ+YLW+  AER FVE+T   I++LL FL  +N+  ++ R +F+K+W
Sbjct: 360 VPGTPMDPSSSLPVQVYLWSESAERGFVEKTSATIMMLLGFLIAMNSIAVYARQKFEKKW 419


>gi|126736261|ref|ZP_01752003.1| Phosphate transport system permease protein 2 [Roseobacter sp.
           CCS2]
 gi|126714082|gb|EBA10951.1| Phosphate transport system permease protein 2 [Roseobacter sp.
           CCS2]
          Length = 439

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 192/436 (44%), Positives = 272/436 (62%), Gaps = 13/436 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S   +    K R  +E  F+ Y + A++V  + L +LL+S+++ G+ +  QT ISLPIE 
Sbjct: 4   SLLASDARTKKRNAAEARFKAYGLSAIVVAMLALAILLTSVLTNGLSSFQQTFISLPIEL 63

Query: 63  SETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISDSNHAL-LRQASQMLSTTARY 120
           +E  VD Q  R   + A      Y  L+R A+  ++        L  +    M+S  A  
Sbjct: 64  AEERVDKQGNRDPAEMARTTTIGYAPLLRAAIVAEVERQGLTTELSDKDLGDMISKEAAA 123

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYL--YSPANVHRMSDYQWKWFQKLDSD 178
            +R  ++ +P L+G+T+   LLA+  ID   KG +   + A     S       Q L   
Sbjct: 124 TVRNRVLANPDLVGETITFDLLAAGRIDGYFKGRVTLETAALDGNTSPEALMVAQALADA 183

Query: 179 GALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G +   FN+ FF    +S      AG+GVA++GSLYMML+V+ L+ P+G+AS+IYLEEF+
Sbjct: 184 GVIETKFNWNFFTAPDASVQRPEAAGLGVAILGSLYMMLVVLFLALPIGVASSIYLEEFA 243

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K   +  ++ NI+NLA+VPSIVYGILG A+ INF +  +S+ LVGGL+L LMTLP+III
Sbjct: 244 PKNRITDIIEVNISNLAAVPSIVYGILGLAIFINFMEFNQSSPLVGGLVLTLMTLPTIII 303

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  AL++VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 304 STRAALKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 363

Query: 357 VGMVAFVTDYPVGVT-------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +GMVAFV +YP   T       + +TA PVQ+Y W   ++  FVER  GAI+ LL+FL +
Sbjct: 364 IGMVAFVREYPAAYTPEAGLFGEASTALPVQVYNWTQRSDPAFVERASGAIITLLVFLLI 423

Query: 410 INTAMLWLRNRFKKRW 425
           +N   ++LR RF++RW
Sbjct: 424 MNAVAIYLRRRFERRW 439


>gi|99081101|ref|YP_613255.1| phosphate ABC transporter permease [Ruegeria sp. TM1040]
 gi|99037381|gb|ABF63993.1| Phosphate transport system permease protein 2 [Ruegeria sp. TM1040]
          Length = 455

 Score =  336 bits (861), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 185/434 (42%), Positives = 268/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        K R  +E  F+ Y + A+ V  + L++L+++IVSKG GA  QT I+LP+E 
Sbjct: 22  SLLELSDRTKRRNAAETRFKAYGIAAIAVGLLMLVVLVTTIVSKGTGAFQQTFITLPVEL 81

Query: 63  SETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARY 120
            E+ +D    R + D   +    Y  ++R A+  K++      +L  +  + +LS  A  
Sbjct: 82  LESKLDKNGNRDIEDIKKVTTFGYAPIIRNAVEAKVTDLGVETSLKAKDMAGLLSKNAAA 141

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSD 178
            LR+ ++ +P  IG TVE   LA + +D  LKG +      N   +S  Q      L + 
Sbjct: 142 TLREFVIANPDQIGTTVEFRFLAQSRVDGYLKGRVSRDSIENDKNISVEQLDLVDALVAA 201

Query: 179 GALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
             +   FN  F +   +S  RPE AG+GV+++GSL+MM +V+ L+ P+G+A++IYLEEF+
Sbjct: 202 NVIEKTFNLDFILGSDASDARPEAAGMGVSMLGSLFMMFVVLALALPIGVAASIYLEEFA 261

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            + + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+III
Sbjct: 262 PQNWITDIIEVNISNLAAVPSIVFGILGLAVFINYMHLPTSAPLVGGLVLTLMTLPTIII 321

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  +L+ VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 322 STRASLKAVPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 381

Query: 357 VGMVAFVT-----DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+          G+    +A P QIY WA  A+  F ER +G I++LL+FL  +N
Sbjct: 382 IGMVGFIASNAPDSIASGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITMN 441

Query: 412 TAMLWLRNRFKKRW 425
           T  + LR RF++RW
Sbjct: 442 TLAVILRRRFERRW 455


>gi|254455835|ref|ZP_05069264.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082837|gb|EDZ60263.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 423

 Score =  335 bits (859), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 172/420 (40%), Positives = 260/420 (61%), Gaps = 4/420 (0%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           ++ L  RY SE  F+FY   A+++  +FL + L  I S G  A  +T I++PI +    +
Sbjct: 5   EEFLNKRYKSEKRFQFYGKSAIVLALLFLAIFLFKIFSTGYTAFQKTWITIPINYDPEFM 64

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                +      L  ++Y  +  ++ A      ++N   +    +M +      ++  ++
Sbjct: 65  YLDADQKPSIQDLEDSEYFDVGIESFAAL--DQNANEDQITDIKRMFAFIFEEEIKYHIL 122

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
           ++P   GK VEV L AS ++D   KG      P    R++DYQ K F KL ++G +  +F
Sbjct: 123 SNPDDFGKIVEVKLTASDDLDQVFKGNYPRELPEERRRVTDYQLKIFDKLSAEGKVKSNF 182

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N+ FF N  S   E+AGI  + +GSL+ +L+ + +SFP+ + +AIYLEEF+ K   + F+
Sbjct: 183 NFSFFTNADSREAELAGIASSFMGSLFSILVCLAVSFPVALLAAIYLEEFAPKNRLTDFI 242

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NINNLA+VPSIV+G+LG  VL+  F +PRST LVGG+ L+LMTLP+IIIA   +L+ V
Sbjct: 243 EVNINNLAAVPSIVFGLLGLGVLLAVFGLPRSTPLVGGITLSLMTLPTIIIAARASLKAV 302

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AAL +GAS++QT  HH +PL++P  L+G+ + LA+ALGETAPL+ +GMVAFV  
Sbjct: 303 PPSIREAALAMGASRMQTTLHHTVPLSLPGTLSGTIIGLAQALGETAPLILIGMVAFVNT 362

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P    D A + PVQIY+WA  AER FVE+    I++LLIFL ++N     +R++F+K+W
Sbjct: 363 IPGSPMDPAASLPVQIYIWAESAERGFVEKVSACIMVLLIFLVLMNLVAQMVRHKFEKKW 422


>gi|254788384|ref|YP_003075813.1| phosphate ABC transporter permease PstA [Teredinibacter turnerae
           T7901]
 gi|237683888|gb|ACR11152.1| phosphate ABC transporter, permease protein PstA [Teredinibacter
           turnerae T7901]
          Length = 430

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 184/413 (44%), Positives = 262/413 (63%), Gaps = 4/413 (0%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +  + +++L  R  SEW F+     +V V  + L++L + I+  GIGA  Q+ I + IEF
Sbjct: 12  TAELVERSLAKRRASEWRFKQMGRASVAVGIIALLILFTQIIGNGIGAFRQSFIHMEIEF 71

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
               +       ++   L  A+++ +VR  L              R+   + S  A + L
Sbjct: 72  DPDTL---GMTEVNHEQLALANFDGIVRNGLRELFP-EVKGRREKRELYSIASYGAGFKL 127

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
           R  L  DP L+G+ V V LL   ++D+ +K          R+S+ Q K   KL   GAL 
Sbjct: 128 RDMLAADPGLLGQRVSVKLLVDDDVDTYVKSLRAGDPYEDRISEAQRKRIDKLLESGALK 187

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
           LDFN GFF +  S+ PE AGI  A++GSL+ +L+   LSFP+G+A+AIYLEE++ +   +
Sbjct: 188 LDFNTGFFTSADSAEPEQAGILGALLGSLFTLLVTGSLSFPIGVAAAIYLEEYAKRSRLT 247

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ NINNLA+VPS+++G+LG A+ +NFF MPRS  LVGGL+L LMTLP+III++  A+
Sbjct: 248 DFIEVNINNLAAVPSVIFGLLGLAIFLNFFNMPRSMPLVGGLVLTLMTLPTIIISSRAAI 307

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP SIR AALG+GASK+Q +  HVLPLAMP +LTG+ + +A+ALGETAPLL +GMVAF
Sbjct: 308 KAVPPSIREAALGMGASKMQMILQHVLPLAMPGMLTGAIIGMAQALGETAPLLMIGMVAF 367

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
           + + P G+TD AT  PVQI+LWA   ER FVERT  AI++LL FL  +NT  +
Sbjct: 368 IAEVPAGITDPATVLPVQIFLWADSPERAFVERTSAAIMVLLAFLITMNTLAI 420


>gi|50084403|ref|YP_045913.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. ADP1]
 gi|49530379|emb|CAG68091.1| high-affinity phosphate transport protein (ABC superfamily,
           membrane) [Acinetobacter sp. ADP1]
          Length = 465

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 185/439 (42%), Positives = 265/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
             +K+L  R+  E  FR +   AV++   F+ LL  SI+ KG+ A WQT +++P+ F  T
Sbjct: 30  KIEKSLASRHRKEKTFRIFGFSAVVLGLFFVALLFGSILVKGLPAFWQTSLTVPVYFDPT 89

Query: 66  IVDPQKKRFMDPA---------------ILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           I++   K                      +   D++ L+   + +K     S        
Sbjct: 90  IINAGPKPTQAAGESPAHFQERYVDWQTKMGMVDWDSLIVNGMIKKDPALASKRDD---L 146

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPSL+GK  ++  LA AN+D  L G +    P +  ++S   
Sbjct: 147 SSLYTSSEAYRLRDMVFKDPSLVGKREDIKFLADANVDVWLTGKIDRSLPDDQQQLSPEV 206

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K   +L++ G L   FN   F N  S      +G+  A +GSL+MMLIVI +S P+G+A
Sbjct: 207 RKLADQLEAKGMLTHSFNTNLFTNPDSRSSPATSGLAGAFMGSLFMMLIVIFISIPIGVA 266

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ +   +  ++ NINNLA+VPSIV+G+LG+A+ IN+ ++P S  LVGGL+L+
Sbjct: 267 SAIYLEEFAKQNILTDVIEVNINNLAAVPSIVFGLLGAAIFINWMQLPLSAPLVGGLVLS 326

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P ILTG+ + +A+A
Sbjct: 327 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGILTGAIIGVAQA 386

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D +TA PVQI+LW  +  R F E RT  AI++LL  
Sbjct: 387 LGETAPLLLIGMSAFVASIPTSPLDQSTALPVQIFLWQGNELRNFFEARTSAAIIVLLAM 446

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 447 MIGLNSLAIWLRKKFEVRW 465


>gi|169795177|ref|YP_001712970.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii AYE]
 gi|184158972|ref|YP_001847311.1| phosphate ABC transporter permease [Acinetobacter baumannii ACICU]
 gi|213158159|ref|YP_002320210.1| phosphate ABC transporter, permease protein [Acinetobacter
           baumannii AB0057]
 gi|239501140|ref|ZP_04660450.1| phosphate ABC transporter, permease protein [Acinetobacter
           baumannii AB900]
 gi|260556657|ref|ZP_05828875.1| phosphate ABC transporter, permease PstA [Acinetobacter baumannii
           ATCC 19606]
 gi|301345428|ref|ZP_07226169.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii AB056]
 gi|301511733|ref|ZP_07236970.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii AB058]
 gi|301596642|ref|ZP_07241650.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii AB059]
 gi|332857058|ref|ZP_08436364.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6013150]
 gi|169148104|emb|CAM85967.1| high-affinity phosphate transport protein (ABC superfamily,
           membrane) [Acinetobacter baumannii AYE]
 gi|183210566|gb|ACC57964.1| ABC-type phosphate transport system, permease component
           [Acinetobacter baumannii ACICU]
 gi|193077951|gb|ABO12864.2| high-affinity phosphate transport protein [Acinetobacter baumannii
           ATCC 17978]
 gi|213057319|gb|ACJ42221.1| phosphate ABC transporter, permease protein [Acinetobacter
           baumannii AB0057]
 gi|260409916|gb|EEX03216.1| phosphate ABC transporter, permease PstA [Acinetobacter baumannii
           ATCC 19606]
 gi|332726873|gb|EGJ58387.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6013150]
          Length = 465

 Score =  333 bits (855), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 185/439 (42%), Positives = 265/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K+L  R+  E  FRF  + AV++   F+ LL  SI++KG+ A WQT +++P+ F   
Sbjct: 30  VIEKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPK 89

Query: 66  IVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                ++R++D    +   D++ L+   +  K     S        
Sbjct: 90  VIDAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDSLIVNGMIAKDPSLASQRD---YL 146

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++    
Sbjct: 147 SSLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEI 206

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K    L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI +S P+G+A
Sbjct: 207 RKLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVA 266

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+
Sbjct: 267 SAIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLS 326

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A A
Sbjct: 327 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHA 386

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 387 LGETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 446

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 447 MIGLNSLAIWLRKKFEVRW 465


>gi|197103970|ref|YP_002129347.1| putative phosphate transport system permease ABC transporter
           protein [Phenylobacterium zucineum HLK1]
 gi|196477390|gb|ACG76918.1| putative phosphate transport system permease ABC transporter
           protein [Phenylobacterium zucineum HLK1]
          Length = 433

 Score =  333 bits (855), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 189/406 (46%), Positives = 255/406 (62%), Gaps = 11/406 (2%)

Query: 23  FYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLR 82
           +Y  +A++    FL +LL  IV++G  A     IS+P+      VDP             
Sbjct: 36  WYGRLAIIAALSFLAVLLGRIVTQGYTAFLDYRISVPVYVDPARVDPADPMG-------- 87

Query: 83  ADYNLLVRKALARKLSISDSNHALLR-QASQMLSTTARYHLRKTLMTDPSLIGKTVEVSL 141
           A+Y+LLV  A+  +L   D     L  +A Q+LST   + L   +  DP ++G+TV V  
Sbjct: 88  ANYDLLVADAVLARLGEQDDARGTLSGKAMQLLSTDLGFQLLDKVRADPGVVGQTVTVEG 147

Query: 142 LASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPE 199
              A+     KG + +       ++ D Q  W  +L   G +   FN GF     S+ PE
Sbjct: 148 SVRADAGLYYKGAVDAELAQEDRKLDDQQIAWLDRLQDQGLVSSGFNTGFLTRSDSTEPE 207

Query: 200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIV 259
            AG+  AVVGS  M+L+   LS P+G+ +A+YLEEFS K  ++S ++ NINNLA+VPSIV
Sbjct: 208 QAGVLGAVVGSAMMLLVTALLSVPIGVLAAVYLEEFSPKNRWTSVIEVNINNLAAVPSIV 267

Query: 260 YGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGAS 319
           YG+LG AV IN+  +PRS+ LVGGL+LALM+LP++IIAT  AL+ VP SIR AALG+GAS
Sbjct: 268 YGLLGLAVFINWLAVPRSSPLVGGLVLALMSLPTVIIATRSALKAVPPSIREAALGVGAS 327

Query: 320 KVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPV 379
           K QTVFHHVLPLAMP ++TGS +SLA ALGETAPLL VGMV+FV   P G TD AT  PV
Sbjct: 328 KTQTVFHHVLPLAMPGVMTGSILSLAHALGETAPLLMVGMVSFVPGVPAGFTDAATVLPV 387

Query: 380 QIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           Q+++W   +ER F ERT  AI++LL+F+ V+N   + LR RF++RW
Sbjct: 388 QVFIWENASERAFHERTAAAIIVLLVFMIVMNLVAIVLRRRFERRW 433


>gi|332869996|ref|ZP_08438972.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6013113]
 gi|332732496|gb|EGJ63747.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6013113]
          Length = 465

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 184/439 (41%), Positives = 265/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K+L  R+  E  FRF  + AV++   F+ LL  SI++KG+ A WQT +++P+ F   
Sbjct: 30  VIEKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPK 89

Query: 66  IVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                ++R++D    +   D++ L+   +  K     S        
Sbjct: 90  VIDAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDSLIVNGMIAKDPSLASQRD---YL 146

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPS+IGK   ++ L  AN+D  LKG +    P +  ++    
Sbjct: 147 SSLYASSEAYRLRDMVFADPSIIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEI 206

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K    L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI +S P+G+A
Sbjct: 207 RKLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVA 266

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+
Sbjct: 267 SAIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLS 326

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A A
Sbjct: 327 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHA 386

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 387 LGETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 446

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 447 MIGLNSLAIWLRKKFEVRW 465


>gi|260549705|ref|ZP_05823922.1| phosphate ABC transporter [Acinetobacter sp. RUH2624]
 gi|260407222|gb|EEX00698.1| phosphate ABC transporter [Acinetobacter sp. RUH2624]
          Length = 465

 Score =  333 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 186/439 (42%), Positives = 265/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K+L  R+  E  FR   + AV++   F+ LL  SI++KG+ A WQT +++P+ F   
Sbjct: 30  VIEKSLAKRHRKEKAFRIAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPK 89

Query: 66  IVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                ++R++D    +   D++ L+   +  K    +S        
Sbjct: 90  VIDAGPLPVRAQGETPAHYQERYVDWQTKMGMVDWDSLIVNGIVAKDPSLESQRD---SL 146

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
             + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++    
Sbjct: 147 RSLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEI 206

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K    L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI +S P+G+A
Sbjct: 207 RKLADDLKAKGILENTFNTNLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVA 266

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K F +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+
Sbjct: 267 SAIYLEEFASKNFITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLS 326

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLAMP I+TGS + +A A
Sbjct: 327 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLAMPGIMTGSIIGVAHA 386

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 387 LGETAPLLLIGMSAFVASIPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 446

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 447 MIGLNSLAIWLRKKFEVRW 465


>gi|215482725|ref|YP_002324923.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii AB307-0294]
 gi|332874753|ref|ZP_08442623.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6014059]
 gi|213987888|gb|ACJ58187.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii AB307-0294]
 gi|322508954|gb|ADX04408.1| pstA [Acinetobacter baumannii 1656-2]
 gi|323518940|gb|ADX93321.1| ABC-type phosphate transport system, permease component
           [Acinetobacter baumannii TCDC-AB0715]
 gi|332737014|gb|EGJ67971.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           baumannii 6014059]
          Length = 456

 Score =  332 bits (852), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 185/439 (42%), Positives = 265/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K+L  R+  E  FRF  + AV++   F+ LL  SI++KG+ A WQT +++P+ F   
Sbjct: 21  VIEKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPK 80

Query: 66  IVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                ++R++D    +   D++ L+   +  K     S        
Sbjct: 81  VIDAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDSLIVNGMIAKDPSLASQRD---YL 137

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++    
Sbjct: 138 SSLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEI 197

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K    L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI +S P+G+A
Sbjct: 198 RKLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVA 257

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+
Sbjct: 258 SAIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPFVGGLVLS 317

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A A
Sbjct: 318 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHA 377

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 378 LGETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 437

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 438 MIGLNSLAIWLRKKFEVRW 456


>gi|254463115|ref|ZP_05076531.1| phosphate ABC transporter, permease protein PstA [Rhodobacterales
           bacterium HTCC2083]
 gi|206679704|gb|EDZ44191.1| phosphate ABC transporter, permease protein PstA [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 432

 Score =  332 bits (852), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 178/429 (41%), Positives = 260/429 (60%), Gaps = 11/429 (2%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
               K R  +E  FR Y + A+      LILLL +I  KG+GA  QT ++L +   E  +
Sbjct: 4   DARTKKRNAAETRFRAYGIAAIGAGLAMLILLLVTIFGKGLGAFQQTFVTLNVPLLEEKL 63

Query: 68  DPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARYHLRKT 125
           D    R ++    +    Y  L++KA+   L+       L  ++ + +LS +A   LR  
Sbjct: 64  DKNGTRDLEKIKKVSTFGYAPLLKKAMEETLTEYGIETNLKSKKQAALLSKSAAAQLRNY 123

Query: 126 LMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDGALFL 183
           ++ +  +IG+TVE + LA+A +D  LK  +     AN   ++  Q      L +   +  
Sbjct: 124 VLANTDMIGETVEFTFLANARVDGYLKDRVTRESIANDKSINAAQLDMVDALLAAEVIEK 183

Query: 184 DFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            FN  F     +S      AG+GV+++GS +MML+V+ L+ P+G+A++IYLEEF+ K + 
Sbjct: 184 RFNLSFITGADASDQRPEAAGMGVSMLGSFFMMLVVLALALPIGVAASIYLEEFAPKNWI 243

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NI+NLA+VPSIV+GILG AV IN   +P+S  LVGGL+L LMTLP+III+T  +
Sbjct: 244 TDIIEVNISNLAAVPSIVFGILGLAVFINSVHLPQSAPLVGGLVLTLMTLPTIIISTRAS 303

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L++VP SIR AALG+GASK+Q+VFHHVLPLA P I TG+ + LA+ALGETAPLL +GM+ 
Sbjct: 304 LKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGIFTGTIIGLAQALGETAPLLLIGMIG 363

Query: 362 FVT-----DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           F+          G  D  +A P QIY WA  A+  F ER +G I++LL+FL  +NT  + 
Sbjct: 364 FIASNAPDSVASGFLDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLITMNTIAVI 423

Query: 417 LRNRFKKRW 425
           LR RF++RW
Sbjct: 424 LRRRFERRW 432


>gi|262372060|ref|ZP_06065339.1| phosphate ABC transporter, permease PstA [Acinetobacter junii
           SH205]
 gi|262312085|gb|EEY93170.1| phosphate ABC transporter, permease PstA [Acinetobacter junii
           SH205]
          Length = 464

 Score =  332 bits (850), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 180/439 (41%), Positives = 268/439 (61%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + + +L  R+  E +FR     AV++   F+ LL  SI+++G+ A WQ+ +++P+ F  T
Sbjct: 29  VIQSSLAKRHRKEKMFRLGGFSAVVIGLAFVALLFGSILARGLPAFWQSSMTVPVYFDPT 88

Query: 66  IVD----PQKKRFMDPA-----------ILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           I++    P+      PA            +   D++ L+   +  K    +S        
Sbjct: 89  IINAGPKPKPTAGESPAHFEERFVAWQTEMGMVDWDALIVNGIVAKDPALESQRD---YL 145

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           + M +++  Y LR  ++ +P+LIG   E+  LA AN+D  L G +    P +  ++    
Sbjct: 146 TGMYTSSEAYRLRDMVLANPALIGTKQELKFLADANVDVWLSGNIDRSLPDDQQQLDPEV 205

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            +   +L++ G +   FN   F++  S     ++G+  A +GSL+MMLIVI +S P+G+A
Sbjct: 206 RQLADQLEAKGIIESTFNTNLFVSPDSRSSPAISGLAGAFMGSLFMMLIVIVISIPIGVA 265

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I + ++P S  LVGGL+L+
Sbjct: 266 SAIYLEEFAPKNMMTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMQLPLSAPLVGGLVLS 325

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TGS + +A A
Sbjct: 326 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGSIIGVAHA 385

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 386 LGETAPLLLIGMSAFVASVPTSPLDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 445

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 446 MIGLNSLAIWLRKKFEVRW 464


>gi|254504060|ref|ZP_05116211.1| phosphate ABC transporter, permease protein PstA [Labrenzia
           alexandrii DFL-11]
 gi|222440131|gb|EEE46810.1| phosphate ABC transporter, permease protein PstA [Labrenzia
           alexandrii DFL-11]
          Length = 449

 Score =  332 bits (850), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 168/433 (38%), Positives = 250/433 (57%), Gaps = 14/433 (3%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +S        K R  SE  F+ Y + A+L+  VFL+++  SI+S+GI A  +T +++   
Sbjct: 22  RSLYATDDLTKKRNASEKRFQAYGITAILIGLVFLVVMAYSIISEGIPAFTRTVLTVEFT 81

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
            ++   D       +  +     Y  +  +A++ +    +        A + +       
Sbjct: 82  VTQEQFD-----DAESQLFKTRAYEAVFTEAMSSQFQQKNIQVPFDIAAIERIVGKPGST 136

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDG 179
           +R+    +P  +G+ V   L AS+ +D  + G L      +   +          L   G
Sbjct: 137 IREFYRANPDQLGQPVVFELAASSRVDGYMNGRLTRDNITDSRFLMKSDLDLVDVLVESG 196

Query: 180 ALFLDFNYGFFINGAS--SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            +   FN+ F     S    P  AGIG +VVGS +MML+V+ LS P+G+A++IYLEEF+ 
Sbjct: 197 IIETVFNWPFITGADSGVDNPGGAGIGASVVGSFFMMLVVLFLSLPIGVAASIYLEEFAP 256

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           +   +  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  +VGGL+L LMTLP+III+
Sbjct: 257 QNRITDLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPIVGGLVLTLMTLPTIIIS 316

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  +L+ VP SIR AALG+GASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +
Sbjct: 317 TRASLKAVPPSIRDAALGVGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLI 376

Query: 358 GMVAFVT-----DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           GMV FV       +  G  D  +A P QIY WAA ++  F E+ +G I++LL+FL  +N 
Sbjct: 377 GMVGFVARGYPDGFVSGFMDPNSAMPAQIYTWAARSDFAFYEKAWGGIIVLLVFLLTMNI 436

Query: 413 AMLWLRNRFKKRW 425
             + LR RF++RW
Sbjct: 437 IAIILRRRFERRW 449


>gi|260426144|ref|ZP_05780123.1| phosphate ABC transporter, permease protein PstA [Citreicella sp.
           SE45]
 gi|260420636|gb|EEX13887.1| phosphate ABC transporter, permease protein PstA [Citreicella sp.
           SE45]
          Length = 450

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 177/435 (40%), Positives = 258/435 (59%), Gaps = 12/435 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S + +    K R  SE  FR Y + A+     FL++LLS+I+S GIGA  QT I +P+  
Sbjct: 16  SLTASDARTKRRNASEKRFRIYGLAAIGAGLFFLVVLLSAIISNGIGAFQQTFIQVPVYL 75

Query: 63  SETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISD--SNHALLRQASQMLSTTAR 119
               +D    R   D A +    Y  L++  L + +  +   +++        ++S +A 
Sbjct: 76  DPATLDKNGNRDPADLAKVSTFGYTPLIQTGLYQLVRDAGIETDYEDAGDMKALISASAA 135

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             +R   +  P  IG TV+  +LAS+ +D  LKG +     A    +          L  
Sbjct: 136 AKVRDWTLAHPDRIGDTVDFEILASSRVDGYLKGRVTRESIAEDRNIDAGHLDLTDALRE 195

Query: 178 DGALFLDFNYGFFINGASSRPE--VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            GAL   FN  F     +S      AG+GV+++GS +MML+V+ L+ P+G+A++IYLEEF
Sbjct: 196 SGALHKSFNAEFIFGSDASESRAEQAGLGVSMLGSFFMMLVVLFLALPIGVAASIYLEEF 255

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + +  F+ F++ NI+NLA+VPSIV+GILG A  I F  +P+S  +VGGL+L LMTLP+II
Sbjct: 256 ASQNKFTDFIEVNISNLAAVPSIVFGILGLAAFIQFAHLPQSAPIVGGLVLTLMTLPTII 315

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L+ VP SIR AALG+GASK+Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 316 ISTRASLKAVPPSIRDAALGVGASKMQAVFHHVLPLAMPGILTGTIIGLAQALGETAPLL 375

Query: 356 FVGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV ++          G     +A P QIY WA  A+  + ER +G I++LL+FL ++
Sbjct: 376 LIGMVGYIATNYPDGLVSGFMSPNSAMPAQIYEWAKRADPAYYERAWGGIIILLVFLLIM 435

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR +F++RW
Sbjct: 436 NVIAIVLRRKFERRW 450


>gi|126664595|ref|ZP_01735579.1| phosphate ABC transporter, permease protein [Marinobacter sp.
           ELB17]
 gi|126630921|gb|EBA01535.1| phosphate ABC transporter, permease protein [Marinobacter sp.
           ELB17]
          Length = 425

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 177/421 (42%), Positives = 261/421 (61%), Gaps = 4/421 (0%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
            I +K+LK RY +E  FR Y ++A+ +    L +L + I+SKG     +T I+L +    
Sbjct: 9   EIVRKSLKRRYRTERRFRLYGILAIFIALASLFILFADIISKGHTGFVKTTITLDVTLDS 68

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
            ++       +D      AD+   +  AL  ++  + ++ A  R+  + L T A   +R 
Sbjct: 69  GMMYLDDPTDLD--QWSSADFKAPIIAALQAQVPQA-ASAAEKRELGRFLGTFADSEIRD 125

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            L  +P L+  T  +       +   +K +  +P    ++S+ Q  W  +L   G +   
Sbjct: 126 LLTKNPELLNTTQTIEFPTHDRVSVYVK-HADNPQYSIKLSEQQQLWVDELLQKGIIDTS 184

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN   F  G S  P  AG+  A+VGSL  ML+ + +SFP+GIA+A+YLEEF+ +   + F
Sbjct: 185 FNDVLFSRGDSREPANAGVLGAIVGSLLTMLVTLAISFPVGIAAAVYLEEFAPQNKLTDF 244

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPSI++G+LG AV IN F MPRS  +VGGL+LALMTLP+III++  A+++
Sbjct: 245 IEVNINNLAAVPSIIFGLLGLAVFINLFGMPRSVPVVGGLVLALMTLPTIIISSRAAIKS 304

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AA G+GASK+Q V HHV+PLAMP +LTGS + +A+ALGETAPLL +GMVAF+ 
Sbjct: 305 VPPSIREAAEGVGASKMQVVLHHVVPLAMPGMLTGSIIGMAQALGETAPLLLIGMVAFIV 364

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P G+   AT  PVQIYLWA+ +E+ FVE    AI++LL F+ ++N   +WLR R ++R
Sbjct: 365 DVPDGLFSSATVLPVQIYLWASSSEQGFVELASAAIMVLLTFMIIMNALAIWLRKRLERR 424

Query: 425 W 425
           W
Sbjct: 425 W 425


>gi|293609756|ref|ZP_06692058.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828208|gb|EFF86571.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 465

 Score =  330 bits (847), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 183/439 (41%), Positives = 265/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K+L  R+  E  FRF    AV++   F+ LL  SI++KG+ A WQT +++PI F   
Sbjct: 30  VIEKSLAKRHRKEKAFRFAGFSAVIIGLAFVALLFGSILAKGLPAFWQTSMNVPIYFDPE 89

Query: 66  IVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                ++R++D    +   D++ ++   +  K     S        
Sbjct: 90  VIDAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDGIIVNGMIAKDPALASQRD---YL 146

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++    
Sbjct: 147 SSLYASSEAYRLRDMVFADPSLIGKKENITFLGDANVDVWLKGNIDRSLPDDQQQLDPEV 206

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K   +L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI ++ P+G+A
Sbjct: 207 RKLADELKAKGVLESTFNLNLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIIAIPIGVA 266

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+
Sbjct: 267 SAIYLEEFAPKNVLTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLS 326

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASK QT+FHHVLPLA+P I+TG+ + +A A
Sbjct: 327 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKFQTIFHHVLPLALPGIMTGAIIGVAHA 386

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 387 LGETAPLLLIGMSAFVASIPATPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 446

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 447 MIGLNSLAIWLRKKFEVRW 465


>gi|262376069|ref|ZP_06069300.1| phosphate ABC transporter, permease PstA [Acinetobacter lwoffii
           SH145]
 gi|262309163|gb|EEY90295.1| phosphate ABC transporter, permease PstA [Acinetobacter lwoffii
           SH145]
          Length = 463

 Score =  330 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 187/438 (42%), Positives = 267/438 (60%), Gaps = 22/438 (5%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
            + +L  R+  E  FR +   AVL    F++LL  SI+SKG+ A WQ+ +SLPI F   I
Sbjct: 29  IQSSLARRHRKEKTFRLFGFSAVLAGLFFVVLLFGSILSKGLPAFWQSSMSLPIHFDPAI 88

Query: 67  VD----PQKKRFMDPAILLR-----------ADYNLLVRKALARKLSISDSNHALLRQAS 111
           VD    P+      PA                D++ L+   +  K S  +S      +  
Sbjct: 89  VDIGPKPKPAAGESPAQFEDRFIAWQTEVGMVDWDALIINGMIAKDSKLESQRD---ELG 145

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +M DPSL+G++ EV +LA AN+D  L G +    P    ++S    
Sbjct: 146 SLYTSSEAYRLRDMVMNDPSLVGQSKEVKILADANVDVWLAGNIDRDLPDEQQQLSPEVR 205

Query: 170 KWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           +   ++ + G +   FN   F +  S      +G+  A +GSL+MM+IVI +S P+G+AS
Sbjct: 206 QVADEMKASGVIENSFNTNIFTSPDSRSSPATSGLAGAFMGSLFMMMIVIFISIPIGVAS 265

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K + +  V+ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+L
Sbjct: 266 AIYLEEFAPKNWITDVVEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSL 325

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGAS++QTVFHHVLPLA+P ILTG+ + +A+AL
Sbjct: 326 MTLPTVIITTRASLKAVPPSIRQAALGLGASRIQTVFHHVLPLALPGILTGAIIGVAQAL 385

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D +TA PVQI+LW  +  R F E RT  AI++LL  +
Sbjct: 386 GETAPLLLIGMSAFVASVPATPFDQSTALPVQIFLWQGNELRNFFEGRTAAAIIVLLAMM 445

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 446 ISLNSLAIWLRKKFEVRW 463


>gi|169632870|ref|YP_001706606.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter baumannii SDF]
 gi|169151662|emb|CAP00452.1| high-affinity phosphate transport protein (ABC superfamily,
           membrane) [Acinetobacter baumannii]
          Length = 465

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 183/439 (41%), Positives = 259/439 (58%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K+L  R+  E  FRF  + AV++   F+ LL  SI++KG+ A WQT +++P+ F   
Sbjct: 30  VIEKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFGSILAKGLPAFWQTSMNVPVYFDPK 89

Query: 66  IVDPQKKRFMDPA---------------ILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                          +   D++ L+   +  K     S        
Sbjct: 90  VIDAGPVPVRTQGETPAHYRERYVDWQMKMGMVDWDSLIVNGMIAKDPSLASQRD---YL 146

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++    
Sbjct: 147 SSLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLPDDQQQLDPEI 206

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K    L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI +S P+G+A
Sbjct: 207 RKLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIISIPIGVA 266

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S   VGGL+L+
Sbjct: 267 SAIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMLLPLSAPFVGGLVLS 326

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+TG+ + +A A
Sbjct: 327 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIMTGAIIGVAHA 386

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 387 LGETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 446

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 447 MIGLNSLAIWLRKKFEVRW 465


>gi|255318361|ref|ZP_05359594.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           radioresistens SK82]
 gi|262378591|ref|ZP_06071748.1| phosphate ABC transporter, permease PstA [Acinetobacter
           radioresistens SH164]
 gi|255304353|gb|EET83537.1| phosphate ABC transporter, permease protein PstA [Acinetobacter
           radioresistens SK82]
 gi|262299876|gb|EEY87788.1| phosphate ABC transporter, permease PstA [Acinetobacter
           radioresistens SH164]
          Length = 465

 Score =  329 bits (843), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 178/440 (40%), Positives = 261/440 (59%), Gaps = 22/440 (5%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
               K+L  R+  E +FR     AV+    F+ LL  SI+ KG+ A WQ  +S+P+ F  
Sbjct: 29  DRIAKSLSKRHRKEKIFRIAGFSAVMAGLFFVALLFGSILIKGLPAFWQAGMSVPVYFDP 88

Query: 65  TIVDPQKKRFMDPA---------------ILLRADYNLLVRKALARKLSISDSNHALLRQ 109
            I+D   +                      +   D++ L+   +  K            +
Sbjct: 89  NIIDAGPRPVQKAGESPAQFQGRYIAWQTKMGMVDWDALIVNGIISKAPALAPQRD---E 145

Query: 110 ASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDY 167
             ++ +++  Y LR  +  +P+LIGKT ++ +LA AN+D  ++G +    P    ++S  
Sbjct: 146 LGEIYTSSESYRLRDMVFENPALIGKTQDIKILADANVDVWVRGQIDRDLPDEQQQLSPE 205

Query: 168 QWKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGI 226
             K   ++++ G L   FN   F N  S      +G+  A +GSL+MMLIVI +S P+G+
Sbjct: 206 VRKLADEMEAQGVLTTSFNTQIFTNPDSRSSPATSGLAGAFMGSLFMMLIVIFISIPIGV 265

Query: 227 ASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLIL 286
           ASAIYLEEF+ K + +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L
Sbjct: 266 ASAIYLEEFAPKNYITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVL 325

Query: 287 ALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR 346
           +LMTLP++II T  +L+ VP SIR AALGLGAS+VQT+FHHVLPLA+P ILTG+ + +A+
Sbjct: 326 SLMTLPTVIITTRASLKAVPPSIRQAALGLGASRVQTIFHHVLPLALPGILTGAIIGVAQ 385

Query: 347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLI 405
           ALGETAPLL +GM AFV   P    D +TA PVQI+LW  +  R F E RT  AI++LL 
Sbjct: 386 ALGETAPLLLIGMSAFVASVPTSPLDQSTALPVQIFLWQGNELRNFFEGRTAAAIIVLLA 445

Query: 406 FLAVINTAMLWLRNRFKKRW 425
            +  +N+  +WLR +F+ RW
Sbjct: 446 LMIGLNSLAIWLRKKFEVRW 465


>gi|221639013|ref|YP_002525275.1| phosphate ABC transporter inner membrane subunit PstA [Rhodobacter
           sphaeroides KD131]
 gi|221159794|gb|ACM00774.1| Phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides KD131]
          Length = 449

 Score =  328 bits (842), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 185/434 (42%), Positives = 266/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +        + R  +E  FR Y + AV +  + L++LLSS++  G GA  QT I +P+  
Sbjct: 16  TLFAPDARTRRRNAAERRFRAYGLTAVGLSILALVVLLSSVIGNGAGAFRQTFIEIPLTL 75

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHA--LLRQASQMLSTTAR 119
              IVDP+  R +D    +    Y   +  ++   ++ +         +  + +LS  A 
Sbjct: 76  DAKIVDPKGNRNIDEMKKVTTIGYGRQLEASMVAAVAAAGLKTEGISDKDIAGLLSKEAA 135

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ D +L+G+T+    LA+  +D   KG   + S      ++  Q    Q++  
Sbjct: 136 ATLRNRVLADTALVGETITFRALANGRVDGFFKGRVTMESAKLDSNVTPEQLGLAQRMRE 195

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G + L FN  F +   +S  RPE AG+GVA++GS YMM+IV+ L+ P+G+A++IYLEEF
Sbjct: 196 AGLITLAFNPDFLLGSDASEVRPEAAGLGVAILGSAYMMIIVLVLALPIGVAASIYLEEF 255

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  ++  ++ NI NLA+VPSIV+GILG A+ IN   +P+S  +VGGLIL LMTLP+II
Sbjct: 256 APKNRWTDLIEVNIANLAAVPSIVFGILGLAIFINMMGLPQSAPIVGGLILTLMTLPTII 315

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT V+L  VP SIR AALG+GAS++Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL
Sbjct: 316 IATRVSLAAVPPSIRDAALGVGASRMQAVFHHVLPLALPGILTGTIIGMARALGETAPLL 375

Query: 356 FVGMVAFV----TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV       P G  D A+A PVQ+Y +   A+  FVER  GAI++LL FL  +N
Sbjct: 376 LIGMVAFVREYPAAPPEGFFDPASALPVQVYNFTQRADPAFVERASGAIIVLLAFLICMN 435

Query: 412 TAMLWLRNRFKKRW 425
            A + LR RF++RW
Sbjct: 436 AAAIILRRRFERRW 449


>gi|299769228|ref|YP_003731254.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. DR1]
 gi|298699316|gb|ADI89881.1| high-affinity phosphate ABC transporter membrane protein
           [Acinetobacter sp. DR1]
          Length = 465

 Score =  328 bits (842), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 184/439 (41%), Positives = 267/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K+L  R+  E  FRF  + AV++   F+ LL SSI++KG+ A WQT +++PI F   
Sbjct: 30  VIEKSLAKRHRKEKAFRFAGLSAVVIGLAFVALLFSSILAKGLPAFWQTSMNVPIYFDPK 89

Query: 66  IVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                ++R++D    +   D++ ++   +  K     S        
Sbjct: 90  VIDAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDGIIVNGMIAKDPALASERD---YL 146

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++    
Sbjct: 147 SSLYASSEAYRLRDMVFADPSLIGKKENINFLGDANVDVWLKGNIDRSLPDDQQQLEPEV 206

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K   +L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI ++ P+G+A
Sbjct: 207 RKLADELKAKGVLENTFNLNLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIIAIPIGVA 266

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+
Sbjct: 267 SAIYLEEFAPKNIVTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLS 326

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASK QT+FHHVLPLA+P I+TGS + +A A
Sbjct: 327 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKFQTIFHHVLPLALPGIMTGSIIGVAHA 386

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D +TA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 387 LGETAPLLLIGMSAFVASIPATPFDQSTALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 446

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 447 MIGLNSLAIWLRKKFEVRW 465


>gi|21388709|dbj|BAC00818.1| phosphate transport system permease ABC transporter protein
           [Rhodobacter sphaeroides f. sp. denitrificans]
          Length = 449

 Score =  328 bits (842), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 183/434 (42%), Positives = 265/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +        + R  +E  FR Y + AV +  + L++LLSS++  G GA  QT + +P+  
Sbjct: 16  TLFAPDNRTRRRNAAERRFRAYGLTAVGLSILALVVLLSSVIGNGAGAFRQTFVEIPLTL 75

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHA--LLRQASQMLSTTAR 119
              IVDP+  R +D    +    Y   +  ++   ++ +         +  + +LS  A 
Sbjct: 76  DARIVDPKGNRNIDEMKKVTTIGYGRQLEASMVAAVAAAGLKTEGISDKDIAGLLSKEAA 135

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ +P+L+G T+    LA+  +D   KG   + S      ++  Q    Q++  
Sbjct: 136 ATLRNRVLANPALVGDTITFRALANGRVDGFFKGRVTMESAELDSNVTPEQLGLAQRMRE 195

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G + L FN  F +   +S  RPE AG+GVA++GS YMM+IV+ L+ P+G+A++IYL EF
Sbjct: 196 AGLITLAFNPDFLLGSDASEVRPEAAGLGVAILGSAYMMIIVLVLALPIGVAASIYLXEF 255

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  ++  ++ NI NLA+VPSIV+GILG A+ IN   +P+S  +VGGLIL LMTLP+II
Sbjct: 256 APKNRWTDLIEVNIANLAAVPSIVFGILGLAIFINMMGLPQSAPIVGGLILTLMTLPTII 315

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT V+L  VP SIR AALG+GAS++Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL
Sbjct: 316 IATRVSLAAVPPSIRDAALGVGASRMQAVFHHVLPLALPGILTGTIIGMARALGETAPLL 375

Query: 356 FVGMVAFV----TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV       P G  D A+A PVQ+Y +   A+  FVER  GAI++LL FL  +N
Sbjct: 376 LIGMVAFVREYPAAPPEGFFDPASALPVQVYNFTQRADPAFVERASGAIIVLLAFLICMN 435

Query: 412 TAMLWLRNRFKKRW 425
            A + LR RF++RW
Sbjct: 436 AAAIILRRRFERRW 449


>gi|332558030|ref|ZP_08412352.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides WS8N]
 gi|332275742|gb|EGJ21057.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides WS8N]
          Length = 449

 Score =  328 bits (841), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 186/434 (42%), Positives = 266/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +        + R  +E  FR Y + AV +  + L++LLSS++  G GA  QT I +P+  
Sbjct: 16  TLFAPDSRTRRRNAAERRFRAYGLTAVGLSILALVVLLSSVIGNGAGAFRQTFIEIPLTL 75

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHA--LLRQASQMLSTTAR 119
              IVDP+  R +D    +    Y   +  ++   ++ +         +  + +LS  A 
Sbjct: 76  DAKIVDPKGNRNIDEMKKVTTIGYGRQLEASMVAAVAAAGLKTEGISDKDIAGLLSKEAA 135

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ D SL+G+T+    LA+  +D   KG   + S      ++  Q    Q++  
Sbjct: 136 ATLRNRVLADTSLVGETITFRALANGRVDGFFKGRVTMESAKLDSNVTPEQLGLAQRMRE 195

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G + L FN  F +   +S  RPE AG+GVA++GS YMM+IV+ L+ P+G+A++IYLEEF
Sbjct: 196 AGLITLAFNPDFLLGADASEVRPEAAGLGVAILGSAYMMIIVLVLALPIGVAASIYLEEF 255

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  ++  ++ NI NLA+VPSIV+GILG A+ IN   +P+S  +VGGLIL LMTLP+II
Sbjct: 256 APKNRWTDLIEVNIANLAAVPSIVFGILGLAIFINMMGLPQSAPIVGGLILTLMTLPTII 315

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT V+L  VP SIR AALG+GAS++Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL
Sbjct: 316 IATRVSLAAVPPSIRDAALGVGASRMQAVFHHVLPLALPGILTGTIIGMARALGETAPLL 375

Query: 356 FVGMVAFV----TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV       P G  D A+A PVQ+Y +   A+  FVER  GAI++LL FL  +N
Sbjct: 376 LIGMVAFVREYPAAPPEGFFDPASALPVQVYNFTQRADPAFVERASGAIIVLLAFLICMN 435

Query: 412 TAMLWLRNRFKKRW 425
            A + LR RF++RW
Sbjct: 436 AAAIILRRRFERRW 449


>gi|325122978|gb|ADY82501.1| high-affinity phosphate transport protein (ABC superfamily,
           membrane) [Acinetobacter calcoaceticus PHEA-2]
          Length = 456

 Score =  328 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 183/439 (41%), Positives = 264/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K+L  R+  E  FRF    AV++   F+ LL  SI++KG+ A WQT +++PI F   
Sbjct: 21  VIEKSLAKRHRKEKAFRFAGFSAVIIGLAFVALLFGSILAKGLPAFWQTSMNVPIYFDPK 80

Query: 66  IVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                ++R++D    +   D++ ++   +  K     S        
Sbjct: 81  VIDAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDGIIVNGMIAKDPALASQRD---YL 137

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P +  ++    
Sbjct: 138 SSLYASSEAYRLRDMVFADPSLIGKKENITFLGDANVDVWLKGNIDRSLPDDQQQLDPEV 197

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K    L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI ++ P+G+A
Sbjct: 198 RKLADDLKAKGVLESTFNLNLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIIAIPIGVA 257

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+
Sbjct: 258 SAIYLEEFAPKNVLTDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLS 317

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASK QT+FHHVLPLA+P I+TG+ + +A A
Sbjct: 318 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKFQTIFHHVLPLALPGIMTGAIIGVAHA 377

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 378 LGETAPLLLIGMSAFVASIPATPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 437

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 438 MIGLNSLAIWLRKKFEVRW 456


>gi|77463156|ref|YP_352660.1| ABC phosphate transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides 2.4.1]
 gi|126462028|ref|YP_001043142.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides ATCC 17029]
 gi|77387574|gb|ABA78759.1| ABC phosphate transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103692|gb|ABN76370.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 449

 Score =  327 bits (839), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 185/434 (42%), Positives = 266/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +        + R  +E  FR Y + AV +  + L++LLSS++  G GA  QT I +P+  
Sbjct: 16  TLFAPDSRTRRRNAAERRFRAYGLTAVGLSILALVVLLSSVIGNGAGAFRQTFIEIPLTL 75

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHA--LLRQASQMLSTTAR 119
              IVDP+  R +D    +    Y   +  ++   ++ +         +  + +LS  A 
Sbjct: 76  DAKIVDPKGNRNIDEMKKVTTIGYGRQLEASMVAAVAAAGLKTEGISDKDIAGLLSKEAA 135

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ D +L+G+T+    LA+  +D   KG   + S      ++  Q    Q++  
Sbjct: 136 ATLRNRVLADTALVGETITFRALANGRVDGFFKGRVTMESAKLDSNVTPEQLGLAQRMRE 195

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G + L FN  F +   +S  RPE AG+GVA++GS YMM+IV+ L+ P+G+A++IYLEEF
Sbjct: 196 AGLITLAFNPDFLLGADASEVRPEAAGLGVAILGSAYMMIIVLVLALPIGVAASIYLEEF 255

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  ++  ++ NI NLA+VPSIV+GILG A+ IN   +P+S  +VGGLIL LMTLP+II
Sbjct: 256 APKNRWTDLIEVNIANLAAVPSIVFGILGLAIFINMMGLPQSAPIVGGLILTLMTLPTII 315

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT V+L  VP SIR AALG+GAS++Q VFHHVLPLA+P ILTG+ + +ARALGETAPLL
Sbjct: 316 IATRVSLAAVPPSIRDAALGVGASRMQAVFHHVLPLALPGILTGTIIGMARALGETAPLL 375

Query: 356 FVGMVAFV----TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV       P G  D A+A PVQ+Y +   A+  FVER  GAI++LL FL  +N
Sbjct: 376 LIGMVAFVREYPAAPPEGFFDPASALPVQVYNFTQRADPAFVERASGAIIVLLAFLICMN 435

Query: 412 TAMLWLRNRFKKRW 425
            A + LR RF++RW
Sbjct: 436 AAAIILRRRFERRW 449


>gi|86138912|ref|ZP_01057484.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           MED193]
 gi|85824559|gb|EAQ44762.1| phosphate ABC transporter, permease protein [Roseobacter sp.
           MED193]
          Length = 450

 Score =  327 bits (839), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 185/434 (42%), Positives = 266/434 (61%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S     K    R  +E  F+ Y + A+ V  V L++L+++IV +G GA  QT I++ +E 
Sbjct: 17  SLLTLSKRTIQRNAAEKRFKAYGIAAIAVGLVMLLVLVTTIVGRGTGAFQQTFITVNVEL 76

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTARY 120
            E+ +D   +R ++    +    Y  L++ A+   ++      +L  +  + +LS  A  
Sbjct: 77  LESKLDKNGERNIEDIKRVTTFGYAPLIKTAMQNTVADLGIETSLKTKHMAGLLSKNAVA 136

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSD 178
            LR  ++ +P  IG+TVE   LA + +D  LKG +     AN   +S  Q      L + 
Sbjct: 137 QLRAFVLENPEKIGETVEFRFLAQSRVDGYLKGRVSRDSIANDKNISAEQLDLVDALVAA 196

Query: 179 GALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           G +   FN  F +   +S      AG+GV+++GSL+MML+V+ LS P+G+A++IYLEEF+
Sbjct: 197 GVIEKTFNLDFILGSDASDQRPEAAGMGVSMMGSLFMMLVVLALSLPIGVAASIYLEEFA 256

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIII 296
            K + +  ++ NI NLA+VPSIVYGILG AV IN+  +P S  LVGGL+L LMTLP+III
Sbjct: 257 PKNWITDVIEVNIANLAAVPSIVYGILGLAVFINYMHLPMSAPLVGGLVLTLMTLPTIII 316

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           +T  AL+ VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL 
Sbjct: 317 STRAALKAVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLL 376

Query: 357 VGMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
           +GMV F+          G+    +A P QIY WA  A+  F ER +G I++LLIFL  +N
Sbjct: 377 IGMVGFIASNAPETIGEGLLSPNSAMPAQIYEWAKRADPAFYERAWGGIIILLIFLVTMN 436

Query: 412 TAMLWLRNRFKKRW 425
           T  + LR RF++RW
Sbjct: 437 TVAVILRRRFERRW 450


>gi|307941518|ref|ZP_07656873.1| phosphate ABC transporter, permease protein PstA [Roseibium sp.
           TrichSKD4]
 gi|307775126|gb|EFO34332.1| phosphate ABC transporter, permease protein PstA [Roseibium sp.
           TrichSKD4]
          Length = 446

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 172/433 (39%), Positives = 244/433 (56%), Gaps = 14/433 (3%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           KS        + R  +E  FR Y + A+ +   FL++L  SI+S+G+ A  +T + +   
Sbjct: 19  KSLYALDDLTRIRNAAEKRFRAYGMTAIGIGLFFLVVLAYSIISEGMPAFSRTVMKVEFT 78

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
            ++   D       +  +     Y  +   AL  +L  S  +    + A   L       
Sbjct: 79  LTQEQYDA-----AEKELFKTKAYESIFISALKSQLDASGISVPFDKDAIGRLVGKPGGT 133

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDG 179
           +R     +P  +GK V   L AS+ +D  + G +      +   +          L   G
Sbjct: 134 IRSFYKENPDQLGKNVAFELAASSRVDGYINGRVTRENMTDSRFLQKSDLDIVDALVKAG 193

Query: 180 ALFLDFNYGFFINGAS--SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            +   FN+ F     S    P  AGIG +VVGS +MML+V+ LS P+G+A++IYLEEF+ 
Sbjct: 194 IIVNVFNWDFITGADSGVDNPGGAGIGASVVGSFFMMLVVLFLSLPIGVAASIYLEEFAP 253

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           +   +  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+
Sbjct: 254 QNKITDLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIIS 313

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  +L+ VP SIR AALG+GASK+Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +
Sbjct: 314 TRASLKAVPPSIRDAALGIGASKMQAVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLI 373

Query: 358 GMVAFVT-----DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           GMV FV          G  D  +A P QIY WAA A+  F E+ +G I++LL+FL  +N 
Sbjct: 374 GMVGFVARGYPDGIVQGFIDPNSAMPAQIYTWAARADFAFYEKAWGGIIVLLVFLLTMNI 433

Query: 413 AMLWLRNRFKKRW 425
             + LR RF++RW
Sbjct: 434 LAIILRRRFERRW 446


>gi|254509901|ref|ZP_05121968.1| phosphate ABC transporter, permease protein PstA [Rhodobacteraceae
           bacterium KLH11]
 gi|221533612|gb|EEE36600.1| phosphate ABC transporter, permease protein PstA [Rhodobacteraceae
           bacterium KLH11]
          Length = 443

 Score =  326 bits (836), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 174/432 (40%), Positives = 250/432 (57%), Gaps = 14/432 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S +        R  +E  FR Y ++A+     FLI+L +SI+S+GI A  +T +S+    
Sbjct: 17  SLTAADPRTIKRANAEKRFRAYGIIAIATGLFFLIVLFASILSQGIPAFQRTVVSVDFTL 76

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           +     PQ++   +  +     Y+ L    L  +L+           A + L       +
Sbjct: 77  T-----PQQQEEAEGTLFKTKAYSDLFIAELNAELAERGITVDFDEAAIERLLGKVGGTI 131

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDGA 180
           R     +P  +G+ +   L AS+ +D   KG +      +   +          L+  G 
Sbjct: 132 RTFYADNPDKLGEPIGFDLTASSRVDGYFKGRVSRDTLQDSRFLQLSDLDLVDALEEAGI 191

Query: 181 LFLDFNYGFFINGAS--SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           +   FN+ F     S    P  AGIG +VVGS +MML+V+GLS P+G+A++IYLEEF+ +
Sbjct: 192 IKQVFNWPFITGADSGVDNPGGAGIGASVVGSFFMMLVVLGLSLPIGVAASIYLEEFAPQ 251

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             F+  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+T
Sbjct: 252 NKFTDLIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIIST 311

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             +L+ VP SIR AALG+GASK+Q VFHHVLPLA P ILTG+ + LA+ALGETAPLL +G
Sbjct: 312 RASLKAVPPSIRDAALGVGASKMQAVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLIG 371

Query: 359 MVAFVT-----DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           MV FV       +  G T+  +A P QIY WAA A+  F E+ +G I++LL+FL  +N  
Sbjct: 372 MVGFVARGYPDGFLAGFTEPNSAMPAQIYTWAARADVGFYEKAWGGIIILLMFLLTMNII 431

Query: 414 MLWLRNRFKKRW 425
            + LR RF++RW
Sbjct: 432 AIILRRRFERRW 443


>gi|84501124|ref|ZP_00999359.1| phosphate ABC transporter, permease protein [Oceanicola batsensis
           HTCC2597]
 gi|84391191|gb|EAQ03609.1| phosphate ABC transporter, permease protein [Oceanicola batsensis
           HTCC2597]
          Length = 446

 Score =  325 bits (833), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 171/432 (39%), Positives = 246/432 (56%), Gaps = 14/432 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S     +  + R  SE  F+ Y +VA+ +   FL++L+ +I+  G+ A   T   + I  
Sbjct: 20  SLLTVDERTRRRNASEGRFKTYGIVAIAIALFFLVVLVVAILRSGLPAFTATVADVEITI 79

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           ++   D  +             Y  L    L R+LS +         A + +       +
Sbjct: 80  TQEEFDAAEGELFKTKA-----YEQLFIGKLQRQLSENGMQVEFDAAAIERIMGKVGGDI 134

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDSDGA 180
           R+    +P+ +G+ V   L AS+ +D   KG +      +   +          L+  G 
Sbjct: 135 REFYRANPAQLGEPVSFQLSASSRVDGYFKGRVTREALQDSRFLQLSDLDLVDALEEAGI 194

Query: 181 LFLDFNYGFFINGAS--SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           +   FN+ F     S    P  AGIG +VVGS +MML+V+ LS P+G+A++IYLEEF+ +
Sbjct: 195 IRQSFNWTFIQGADSGVDNPGGAGIGASVVGSFFMMLVVLFLSLPIGVAASIYLEEFAPQ 254

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIAT 298
             ++  ++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+T
Sbjct: 255 NRWTDMIEVNISNLAAVPSIVFGILGLAVFIQFMHLPQSAPLVGGLVLTLMTLPTIIIST 314

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             +L+ VP SIR AALG+GASK+Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +G
Sbjct: 315 RASLKAVPPSIRDAALGVGASKMQAVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLIG 374

Query: 359 MVAFVT-----DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           MV FV          G  D  +A P QIY WAA A+  F E+ +G I++LL+FL  +N  
Sbjct: 375 MVGFVARGYPDGIVSGFVDPNSAMPAQIYTWAARADAAFYEKAWGGIIILLLFLMTMNFI 434

Query: 414 MLWLRNRFKKRW 425
            + LR RF++RW
Sbjct: 435 AIVLRRRFERRW 446


>gi|262368529|ref|ZP_06061858.1| phosphate ABC transporter, permease PstA [Acinetobacter johnsonii
           SH046]
 gi|262316207|gb|EEY97245.1| phosphate ABC transporter, permease PstA [Acinetobacter johnsonii
           SH046]
          Length = 462

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 183/438 (41%), Positives = 265/438 (60%), Gaps = 22/438 (5%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
              +L  R+  E  FRF+   AV+    F+ LL  SI+SKG+ A WQ+ +SLP+ F   I
Sbjct: 28  ISNSLAKRHRKEKTFRFFGFSAVIAGLFFVALLFGSILSKGLPAFWQSSMSLPVYFDPAI 87

Query: 67  V----DPQKKRFMDPAILLR-----------ADYNLLVRKALARKLSISDSNHALLRQAS 111
           +     P ++    PA                D++ L+  A+  K     S        +
Sbjct: 88  ITTGAKPVQRSGESPAQFEERFIAWQTEMGMVDWDALIVNAMIAKDPALASKRDD---LA 144

Query: 112 QMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQW 169
            + +++  Y LR  +M DPSL+GK  ++ +LA AN+D  L G +    P    ++S    
Sbjct: 145 SLYTSSEAYRLRDMVMKDPSLVGKKEDIKVLADANVDVWLAGNIDRSLPDEQQQLSPEVR 204

Query: 170 KWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
           +   ++ + G +   FN   F++  S      +G+  A +GSL+MMLIVI +S P+G+AS
Sbjct: 205 QLADEMKASGVMENTFNTNIFVSPDSRSSPATSGLAGAFMGSLFMMLIVIIISIPIGVAS 264

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           AIYLEEF+ K + +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+L
Sbjct: 265 AIYLEEFAPKNWITDVIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLSL 324

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           MTLP++II T  +L+ VP SIR AALGLGAS+VQTVFHHVLPLA+P ILTG+ + +A+AL
Sbjct: 325 MTLPTVIITTRASLKAVPPSIRQAALGLGASRVQTVFHHVLPLALPGILTGAIIGVAQAL 384

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFL 407
           GETAPLL +GM AFV   P    D ++A PVQI+LW  +  R F E RT  AI++LL  +
Sbjct: 385 GETAPLLLIGMSAFVASVPTTPFDQSSALPVQIFLWQGNELRNFFEGRTAAAIIVLLAMM 444

Query: 408 AVINTAMLWLRNRFKKRW 425
             +N+  +WLR +F+ RW
Sbjct: 445 IGLNSIAIWLRKKFEVRW 462


>gi|89069579|ref|ZP_01156923.1| phosphate ABC transporter, permease protein [Oceanicola granulosus
           HTCC2516]
 gi|89044914|gb|EAR51004.1| phosphate ABC transporter, permease protein [Oceanicola granulosus
           HTCC2516]
          Length = 442

 Score =  323 bits (828), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 180/433 (41%), Positives = 259/433 (59%), Gaps = 15/433 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        + R  +E  F+ Y + A+ +   FL  LL +IVS G  A  QT + +PI  
Sbjct: 15  SLHATDARTRRRNAAEKRFKAYGLTAIGIGLAFLAALLFAIVSNGSAAFTQTFVEVPITL 74

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHA-LLRQASQMLSTTARYH 121
               +        + +I+  + Y  ++  AL  +L+ +         +  ++LS++    
Sbjct: 75  DAEEI-----AAAESSIVKTSKYREIIHGALLEQLADAGIETDMDAAELGKILSSSEAAE 129

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVH--RMSDYQWKWFQKLDSDG 179
           +R   + +P  +G+TV    LAS+ +D  LKG +   A      +         +L   G
Sbjct: 130 MRDFALANPERMGETVRFDFLASSRVDGYLKGRVTRDALARDQNLDAAHLDLVDRLAEQG 189

Query: 180 ALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            +   FN+ F +   +S  RPE AGIGVA++GS +MML+V+ L+ P+G+A++IYLEEF+ 
Sbjct: 190 IVVKRFNWDFILGADASDQRPEQAGIGVAMLGSFFMMLVVLALALPIGVAASIYLEEFAP 249

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K   + F++ NI+NLA+VPSIV+GILG AV I F  +P+S  LVGGL+L LMTLP+III+
Sbjct: 250 KNRITDFIEVNISNLAAVPSIVFGILGLAVFIQFAGLPQSAPLVGGLVLTLMTLPTIIIS 309

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  AL  VP SIR+AALG+GASK+Q+VFHHVLPLAMP ILTG+ + LA+ALGETAPLL +
Sbjct: 310 TRAALAAVPPSIRAAALGVGASKMQSVFHHVLPLAMPGILTGTIIGLAQALGETAPLLLI 369

Query: 358 GMVAFVTD-----YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           GMV F+          G TD  +A P QIY WA  A+  F ER +G I++LL+FL  +N 
Sbjct: 370 GMVGFIASNYPDGVVSGFTDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLLFLMTMNF 429

Query: 413 AMLWLRNRFKKRW 425
             + LR RF++RW
Sbjct: 430 IAILLRRRFERRW 442


>gi|254486512|ref|ZP_05099717.1| phosphate ABC transporter, permease protein PstA [Roseobacter sp.
           GAI101]
 gi|214043381|gb|EEB84019.1| phosphate ABC transporter, permease protein PstA [Roseobacter sp.
           GAI101]
          Length = 443

 Score =  323 bits (828), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 186/435 (42%), Positives = 271/435 (62%), Gaps = 11/435 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            S          R  +E  F+ Y + A+ V  + L++LL++I+ +G GA  QT ++L ++
Sbjct: 9   NSLLRQDARTVKRNRAETRFKAYGIAAIAVGLLMLLILLTTIIGRGTGAFQQTFLTLDVQ 68

Query: 62  FSETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTAR 119
             E  +D +  R + D   +    Y  L+  AL +K++ +     L  +  + +LS  A 
Sbjct: 69  LLEAKLDKKGNRDLEDIKKVSTFGYAPLMAAALEKKVADTGIETGLKPKDMAAILSKDAA 128

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             LR  ++ +  LIG +VE   L ++ +D  LKG +     AN   +S  Q      L +
Sbjct: 129 AQLRDFVLENTDLIGSSVEFRFLTNSRVDGYLKGRVTRESIANDKNISTAQLDLVDALIA 188

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
           DGAL   FN  F     +S  RPE AG+GV+++GSL+MML+V+ L+ P+G+A++IYLEEF
Sbjct: 189 DGALEKRFNLAFITGADASDARPEAAGMGVSMLGSLFMMLVVLALALPIGVAASIYLEEF 248

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K + +  ++ NI+NLA+VPSIV+GILG AV IN+  +P S  LVGGL+L LMTLP+II
Sbjct: 249 APKNWITDIIEVNISNLAAVPSIVFGILGLAVFINYMHLPNSAPLVGGLVLTLMTLPTII 308

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  +L++VP SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL
Sbjct: 309 ISTRASLKSVPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLL 368

Query: 356 FVGMVAFVTDYP-----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV F+   P      G+ D  +A P QIY WA  A+  F ER +G I++LL+FL  +
Sbjct: 369 LIGMVGFIASNPPDGIASGLLDPNSAMPAQIYEWAKRADPAFYERAWGGIIILLVFLVTM 428

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR RF++RW
Sbjct: 429 NAIAVMLRRRFERRW 443


>gi|120556532|ref|YP_960883.1| phosphate ABC transporter, inner membrane subunit PstA
           [Marinobacter aquaeolei VT8]
 gi|120326381|gb|ABM20696.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Marinobacter aquaeolei VT8]
          Length = 424

 Score =  323 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 173/421 (41%), Positives = 257/421 (61%), Gaps = 5/421 (1%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
            + +++LK RY  E  FR Y + A+ +    L++L + I+ KG  A  +T ++L ++   
Sbjct: 9   ELVRQSLKRRYRKERRFRAYGIAAIAIALSALVILFADIIGKGHTAFIKTTVTLEVDIDG 68

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
             +        D   +  AD+   + +AL +++  +    +       +++  A   LR 
Sbjct: 69  EAMYLDDAS--DERQMKMADFVEPLIRALMKEIPEAG--ESDRDDVRDLINPYASNQLRD 124

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            L  +P L+  T  ++ L+  ++D  +K       ++  +++ Q  W   L   G +   
Sbjct: 125 ALRENPELLNTTQTMTFLSHTDVDVYVKHAGDENYSIK-LNEKQQAWVDTLYERGVVDTG 183

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN  FF  G S  P  AGI  A+VGSL  M++ + LSFP+G+A+AIYLEEF+ +   + F
Sbjct: 184 FNDVFFSRGDSRDPSRAGILGAIVGSLLTMVVTLALSFPIGVAAAIYLEEFAPQNKLTDF 243

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPSI++G+LG AV IN F MPRS  +VGGL+L LMTLP+III++  A+++
Sbjct: 244 IEVNINNLAAVPSIIFGLLGLAVFINLFGMPRSVPVVGGLVLTLMTLPTIIISSRAAIKS 303

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AA G+GASK+Q V HHVLPLAMP +LTGS + +A+ALGETAPLL +GMVAF+ 
Sbjct: 304 VPPSIREAAEGIGASKMQVVLHHVLPLAMPGMLTGSIIGMAQALGETAPLLLIGMVAFIV 363

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P G  D AT  PVQ++LWA   E  F+ER   AI++LL FL  +N   +WLR R ++R
Sbjct: 364 DVPDGFFDSATVLPVQVFLWAGSPELAFIERASAAIMVLLTFLIGMNALAIWLRKRLERR 423

Query: 425 W 425
           W
Sbjct: 424 W 424


>gi|260574721|ref|ZP_05842724.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sp. SW2]
 gi|259023138|gb|EEW26431.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sp. SW2]
          Length = 430

 Score =  323 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 189/423 (44%), Positives = 262/423 (61%), Gaps = 12/423 (2%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
              + NL+ R+  E   +   + A+ + F+ L +L+ S+VS G  A  QTH+++      
Sbjct: 18  DSVRANLRRRHRRETGLKSLGMAAIAIAFLMLAILVGSLVSTGWQAFTQTHVTITFPIDP 77

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
             V  +K            +Y  LV+ A+   L   D   A  ++ ++++S +A++ LR 
Sbjct: 78  AKVKAEKPEA--------GNYRALVQAAMVAALP--DVPAAQAKKLAEIVSNSAQFTLRD 127

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALF 182
            ++ D  LIG+++ +++ AS   D   KG +    PA   R+SD Q   F  L +DG + 
Sbjct: 128 RVVADTGLIGQSITLTVPASDPYDQLNKGLIDRATPAANRRLSDEQVAAFDALAADGRIS 187

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
             FN+  F N  S  PE+AG+  A+VGS Y +L    L+FPLGI SAIYLEEF+ K   S
Sbjct: 188 KPFNWALFTNADSRFPELAGLTGALVGSFYALLTCFVLAFPLGIGSAIYLEEFAPKNRIS 247

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ NINNLA+VPSIV+G+L  AV +N F +PRS  +VGGL LALMTLP+IIIAT  AL
Sbjct: 248 DFIEININNLAAVPSIVFGLLALAVFLNGFGLPRSAPIVGGLTLALMTLPTIIIATRAAL 307

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP SIR AALG+GAS+ Q VFHHVLPLAMP +LTG+ + LARALGE APLL +GM AF
Sbjct: 308 KAVPPSIREAALGIGASRQQVVFHHVLPLAMPGVLTGTILGLARALGEAAPLLLIGMNAF 367

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +T  P    D ATA P QI +WA   ER FV RT  A+L+LL FL ++N   ++LR RF+
Sbjct: 368 ITAAPGSPFDPATALPTQILIWADSTERGFVSRTSAAVLVLLGFLLIMNAVAIYLRARFE 427

Query: 423 KRW 425
           ++W
Sbjct: 428 RKW 430


>gi|221134923|ref|ZP_03561226.1| ABC phosphate transporter inner membrane protein, PstA-like protein
           [Glaciecola sp. HTCC2999]
          Length = 429

 Score =  322 bits (826), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 173/421 (41%), Positives = 262/421 (62%), Gaps = 6/421 (1%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
               K  LK R+ SE +F+   + AVL+ F+ + +LL  I SK + A  Q  + L +++S
Sbjct: 15  TEKIKLGLKKRHRSEMMFKTTGLAAVLLGFMLVFVLLFDITSKALPAFHQHWVQLEVDYS 74

Query: 64  ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLR 123
            + +     R+ +   L    Y   +RKA+A +      +    RQ + + S+ A + ++
Sbjct: 75  ASNL-----RYSEGDSLENLRYRSTLRKAIANQFP-DVKSRRDKRQLNGLYSSNAEFAIK 128

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
             L+ +P  +     V +    ++D  LK        + R+ + + +W + L   G +  
Sbjct: 129 DFLIANPQALNTVQNVWVRVDDDVDIYLKETTSLGEPLIRIDEKEAQWIKSLVEAGQIDK 188

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
            FN  FF +  S  PE+AG+  A+ G++  ML+ + LSFPLG+A+A+YLEEF+ K  ++ 
Sbjct: 189 RFNIQFFTSSDSREPELAGVRGALTGTMLTMLVTLVLSFPLGVAAALYLEEFAPKNKWTD 248

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NINNLA+VPSI++G+LG AV+IN F +PRS  LVGG++L LMTLP+IIIA+  +++
Sbjct: 249 MIEVNINNLAAVPSIIFGLLGLAVIINLFGLPRSAPLVGGIVLTLMTLPTIIIASRASIK 308

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP SIR AA GLGASK+QT F HVLP+AMP ILTG+ + +A+ALGETAPLL +GMVAF+
Sbjct: 309 AVPPSIREAATGLGASKIQTTFSHVLPMAMPGILTGTIIGMAQALGETAPLLMIGMVAFI 368

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            D P  +TD +T  PVQI+LWA   ER F+ +T  AIL+LL FL ++N +  +LR RF+ 
Sbjct: 369 VDVPASITDASTVMPVQIFLWADSPERGFLAKTSAAILVLLGFLFLMNASAAYLRRRFES 428

Query: 424 R 424
           +
Sbjct: 429 K 429


>gi|262278268|ref|ZP_06056053.1| high-affinity phosphate transporter [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258619|gb|EEY77352.1| high-affinity phosphate transporter [Acinetobacter calcoaceticus
           RUH2202]
          Length = 465

 Score =  322 bits (824), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 183/439 (41%), Positives = 264/439 (60%), Gaps = 22/439 (5%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           + +K L  R+  E  FR+    AV++   F+ LL SSI++KG+ A WQT +++PI F   
Sbjct: 30  LIEKTLATRHRKEKAFRYAGFSAVIIGLAFVALLFSSILAKGLPAFWQTSMNVPIYFDPK 89

Query: 66  IVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSISDSNHALLRQA 110
           ++D                ++R++D    +   D++ ++   +  K              
Sbjct: 90  LIDAGPVPVRGQGETPAHYQERYIDWQTKMGMVDWDGIIVNGMIAKDPALAGQRD---YL 146

Query: 111 SQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQ 168
           S + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P    ++    
Sbjct: 147 SSLYASSEAYRLRDMVFADPSLIGKKENLNFLGDANVDVWLKGNIDRSLPDEQQQLDPEV 206

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
            K   +L + G L   FN   F N  S     ++G+  A +GSL+MMLIVI ++ P+G+A
Sbjct: 207 RKLADELKAKGVLESTFNMSLFKNPDSRSSPAISGLAGAFMGSLFMMLIVIIIAIPIGVA 266

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILA 287
           SAIYLEEF+ K F +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S  LVGGL+L+
Sbjct: 267 SAIYLEEFAPKNFITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLSAPLVGGLVLS 326

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           LMTLP++II T  +L+ VP SIR AALGLGASK QT+FHHVLPLA+P I+TG+ + +A A
Sbjct: 327 LMTLPTVIITTRASLKAVPPSIRQAALGLGASKFQTIFHHVLPLALPGIMTGAIIGVAHA 386

Query: 348 LGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIF 406
           LGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT  AI++LL  
Sbjct: 387 LGETAPLLLIGMSAFVASIPTTPFDQATALPVQVYLWQGNELRNFFEGRTAAAIIVLLAL 446

Query: 407 LAVINTAMLWLRNRFKKRW 425
           +  +N+  +WLR +F+ RW
Sbjct: 447 MIGLNSLAIWLRKKFEVRW 465


>gi|310814682|ref|YP_003962646.1| phosphate ABC transporter, permease protein [Ketogulonicigenium
           vulgare Y25]
 gi|308753417|gb|ADO41346.1| phosphate ABC transporter, permease protein [Ketogulonicigenium
           vulgare Y25]
          Length = 444

 Score =  320 bits (820), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 189/435 (43%), Positives = 269/435 (61%), Gaps = 11/435 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +S        K R  +E  FR Y + A+L+   FLI L+ SI   GIGA  QT + + + 
Sbjct: 10  QSLLAPDARTKKRNAAEARFRAYGIGALLIAMGFLIALMWSIFGNGIGAFTQTFVKIQVP 69

Query: 62  FSETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISDSNHA-LLRQASQMLSTTAR 119
             E+++DP   R   D A      Y  L++ A+A  L              +Q+LS++A 
Sbjct: 70  LEESVLDPNGNREPADLARATTLRYGSLLQGAMASTLEREGITTDMEPAALAQILSSSAA 129

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSP--ANVHRMSDYQWKWFQKLDS 177
             +R  ++ +PSLIG+TVE+ +LAS+ +D  +KG +     A    +S        ++  
Sbjct: 130 AEVRNRVLAEPSLIGQTVELEVLASSRVDGYMKGRVSRESLARDRNLSPAALNVVDQMRD 189

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G +   FN+ F     +S  RPE AGIGV+++GSL MML+V+ LS P+G+A++IYLEEF
Sbjct: 190 AGVIERRFNWNFIFGSDASDQRPEQAGIGVSMLGSLAMMLVVLALSLPIGVAASIYLEEF 249

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + +  F+  ++ NI+NLA+VPSIV+GILG AV I    +P+S  +VGGL+L LMTLP+II
Sbjct: 250 APQNRFTDLIEVNISNLAAVPSIVFGILGLAVFIQIMHLPQSAPVVGGLVLTLMTLPTII 309

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I+T  AL+ VP SIR AALG+GAS++Q VFHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 310 ISTRAALKAVPPSIRDAALGIGASRMQAVFHHVLPLAMPGILTGTILGLAQALGETAPLL 369

Query: 356 FVGMVAFVT-DYPVG----VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            +GMV F+  +YP           +A P QIY WA  A+  F ER +G I+LLL+FL ++
Sbjct: 370 LIGMVGFIASNYPGSVDAAFNAPNSAMPAQIYEWAKRADPAFYERAWGGIILLLVFLLLM 429

Query: 411 NTAMLWLRNRFKKRW 425
           N   + LR RF+++W
Sbjct: 430 NFLAVLLRRRFERKW 444


>gi|103486314|ref|YP_615875.1| phosphate ABC transporter permease [Sphingopyxis alaskensis RB2256]
 gi|98976391|gb|ABF52542.1| Phosphate transport system permease protein 2 [Sphingopyxis
           alaskensis RB2256]
          Length = 418

 Score =  318 bits (814), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 167/420 (39%), Positives = 249/420 (59%), Gaps = 15/420 (3%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
             +K +  RY +E  F+   + AVL+   FL  LL  +V  G      TH+S+PI+F  T
Sbjct: 14  AMQKRIAGRYAAERRFKAIGLAAVLLSGAFLAFLLFVMVGNGARGFTYTHVSVPIDFKAT 73

Query: 66  IVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKT 125
            +     R  DP      D + L+  A    +    ++ AL    S+++S  A   +R  
Sbjct: 74  PLTIDASRLDDP------DADQLIAGAGLADIVAFAADEALGEDGSKLISENAWKEVRSA 127

Query: 126 LMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
           +  DP L+       L A++ +D   K                      L+ DG L    
Sbjct: 128 IKADPELLNGKSVFELPAASEVDIMAKEGARGELGAR---------VDALERDGRLSTGI 178

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ FF N  ++ P VAGI  A+ GS+  + I   ++FP G+ +A+YLEE++ K  ++  +
Sbjct: 179 HWPFFRNADATDPAVAGIWGALKGSVLTIFIAFLIAFPTGVLAALYLEEYAPKNRWTDLI 238

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + +INNLA+VPSI++G+L  AV IN+F + +++ LVGGL LALMT+P I+IA+  A+++V
Sbjct: 239 EVSINNLAAVPSIIFGLLALAVFINWFGICQASPLVGGLTLALMTMPVIVIASRNAIKSV 298

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR AALG+GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AF+ D
Sbjct: 299 PPSIRDAALGVGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLLIGMRAFIGD 358

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P G+   +T  P+QI+LW+ + +R FVE+T  AI++LLI L  +N   ++LRN+F+KRW
Sbjct: 359 VPGGICSPSTVLPMQIFLWSDEVDRGFVEKTSAAIIVLLIVLLSMNAFAIYLRNKFEKRW 418


>gi|294679017|ref|YP_003579632.1| phosphate ABC transporter permease PstA [Rhodobacter capsulatus SB
           1003]
 gi|294477837|gb|ADE87225.1| phosphate ABC transporter, permease protein PstA [Rhodobacter
           capsulatus SB 1003]
          Length = 443

 Score =  317 bits (811), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 201/434 (46%), Positives = 277/434 (63%), Gaps = 10/434 (2%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +S        K R  +E  FR Y + AV++  + L++LLSS++  G+GA  QT +SLPI 
Sbjct: 10  RSLYTADARTKARNAAEKRFRIYGITAVVIGLLALVVLLSSVLGSGLGAFRQTVLSLPIT 69

Query: 62  FSETIVDPQKKRFM-DPAILLRADYNLLVRKALARKLSISDSNHALL-RQASQMLSTTAR 119
                +DP+  R   + A      Y  L+ KAL   ++  +    +  +   +++S  A 
Sbjct: 70  LDAKALDPKGNRDPAEMAKATTVTYGKLITKALEAVVTEKNLAPGMKTKAIGELISKEAP 129

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ DP L+G T+   +LAS  +D   KG   + S A    ++  Q +  +KL  
Sbjct: 130 AGLRDLVLADPELVGTTITYDVLASGRVDGFFKGRVTMESAALDSNITPEQLQLAEKLRD 189

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G L L FN GF  N  +S  RPE AG+GVA++GS+YMM++V+ L+ P+G+A++IYLEEF
Sbjct: 190 AGLLKLAFNTGFLTNPDASELRPESAGLGVAILGSIYMMVLVLCLALPIGVAASIYLEEF 249

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  F+  ++ N+ NLA+VPSIVYGILG A  INF  MP+S+ LVG L+L LMTLP II
Sbjct: 250 APKNRFTDLIEVNVANLAAVPSIVYGILGLAAFINFAGMPQSSPLVGALVLTLMTLPRII 309

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           I T  AL  VP SIR AALG+GASK QT+FHHVLPLA+P ILTG+ + LA+ALGETAPLL
Sbjct: 310 IPTRAALNAVPPSIREAALGVGASKTQTIFHHVLPLAVPGILTGAIIGLAQALGETAPLL 369

Query: 356 FVGMVAFVTDY----PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV DY    P G+ D A+A PVQIY W   A+  FVER  GAI++LLIFL ++N
Sbjct: 370 LIGMVAFVKDYPAAPPEGILDPASAIPVQIYNWTQRADPAFVERASGAIIVLLIFLLMMN 429

Query: 412 TAMLWLRNRFKKRW 425
           +  + LR +F++RW
Sbjct: 430 SLAVILRRKFERRW 443


>gi|146277958|ref|YP_001168117.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145556199|gb|ABP70812.1| phosphate ABC transporter, inner membrane subunit PstA [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 449

 Score =  315 bits (806), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 189/434 (43%), Positives = 274/434 (63%), Gaps = 11/434 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S        + R  +E  FR Y + AV++  + L+LLL+S++  G GA  QT I++P+  
Sbjct: 16  SLFAPDARTRRRNAAERRFRAYGLGAVILSILALVLLLTSVIGNGAGAFRQTFIAIPVTL 75

Query: 63  SETIVDPQKKRFMDP-AILLRADYNLLVRKALARKLSISDSNHA--LLRQASQMLSTTAR 119
              IVDP+  R ++    +    Y   +  ++   ++ +         +  + +LS  A 
Sbjct: 76  DAAIVDPRGNRDIEEMKKVTTIGYGRQLEASMVAAVAAAGLQSEGISDKDIAGLLSKEAA 135

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY--LYSPANVHRMSDYQWKWFQKLDS 177
             LR  ++ DP L+G+TVEV  LA+  +D   KG   + S A    ++  Q    Q+L  
Sbjct: 136 AGLRNRVLADPELVGQTVEVRALANGRVDGFFKGRVTMESAALDSNITPEQLVLAQRLRE 195

Query: 178 DGALFLDFNYGFFINGASS--RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
            G + + FN  F     +S  RPE AG+GVA++GS YMM IV+ L+ P+G+A++IYLEEF
Sbjct: 196 AGLITIAFNPQFLFGPDASELRPEAAGLGVAILGSAYMMFIVLVLALPIGVAASIYLEEF 255

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
           + K  ++  ++ NI+NLA+VPSIV+GILG A+ INF  +P+S  +VGGL+L LMTLP+II
Sbjct: 256 APKNRWTDLIEVNISNLAAVPSIVFGILGLAIFINFMGLPQSAPIVGGLVLTLMTLPTII 315

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           IAT  +L+ VP SIR AALG+GASK+Q +FHHVLPLAMP ILTG+ + LA+ALGETAPLL
Sbjct: 316 IATRASLKAVPPSIRDAALGVGASKMQAIFHHVLPLAMPGILTGTIIGLAQALGETAPLL 375

Query: 356 FVGMVAFVTDY----PVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
            +GMVAFV ++    P G  D A+A PVQ++ +   A+  FVER  GAI++LL+FL  +N
Sbjct: 376 LIGMVAFVREFPAAPPEGFFDPASALPVQVFNFTQRADPAFVERASGAIIVLLVFLVAMN 435

Query: 412 TAMLWLRNRFKKRW 425
           T  + LR RF++RW
Sbjct: 436 TVAIILRRRFERRW 449


>gi|194595542|gb|ACF77053.1| putative ABC-type phosphate transporter permease protein [Halomonas
           sp. HAL1]
          Length = 388

 Score =  315 bits (806), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 160/424 (37%), Positives = 244/424 (57%), Gaps = 38/424 (8%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
            +F    + LK R+      ++  + ++ +  +FL+L  + ++SKG+ A  Q +I   I 
Sbjct: 3   HTFDEISQQLKRRHRKSARLKWISMGSLGLAGLFLVLFFADMLSKGLPAFQQAYIQTEIS 62

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           ++E                                 + +D   A  ++   ++S TA   
Sbjct: 63  YTEE--------------------------------AQTDGRQAFDQELLPLISRTAVRV 90

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           +   L  +P +IG +    +LA++ +D  LKG+         +S+ +     +    G +
Sbjct: 91  IPMELRNNPGMIGTSEAQWVLANSEVDQYLKGHRNR------LSEEEQAALDERVEAGQV 144

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            L FN  FF +G S   E AGI  AVVG++  M++ + +SFP+G+ +A+YLEEF+    F
Sbjct: 145 DLRFNSTFFGSGDSKIAENAGILSAVVGTVMTMIVTLAISFPIGVMTAVYLEEFAPDNRF 204

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NINNLA++PSI++G+LG A+ INFF +PRS+ L GG+ LALMTLP III+T  A
Sbjct: 205 TQAIEININNLAAIPSILFGLLGLAIFINFFGVPRSSPLAGGMTLALMTLPVIIISTRTA 264

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR+VP SIR AA G+G S+ Q V  HVLPLAMP I+TGS + LA+A+GETAPL+ VGMVA
Sbjct: 265 LRSVPDSIRHAAFGVGCSRWQVVRDHVLPLAMPGIMTGSIIGLAQAMGETAPLIIVGMVA 324

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D     T+ AT  P QI+ W+ + E+ FVE+T G IL+LL  L  +N   + LR +F
Sbjct: 325 FIPDVGASFTEAATVMPAQIFTWSGEPEQAFVEKTAGGILVLLTILISLNAFAVVLRKKF 384

Query: 422 KKRW 425
           ++RW
Sbjct: 385 ERRW 388


>gi|332703031|ref|ZP_08423119.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio africanus str. Walvis Bay]
 gi|332553180|gb|EGJ50224.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio africanus str. Walvis Bay]
          Length = 388

 Score =  313 bits (802), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 165/422 (39%), Positives = 248/422 (58%), Gaps = 38/422 (9%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
               KK L  R  +E  F+ Y  +A+LV   FLI  L  ++  G  A  Q  + + + +S
Sbjct: 5   TETAKKRLGSRRRAEKRFKLYSRLAILVAISFLIFFLYDMIRTGYPAFTQAELLVEVSYS 64

Query: 64  ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLR 123
           E  ++  +    +                                   +++S      + 
Sbjct: 65  EESMEIGQLAVDEE--------------------------------MERLVSRGFLRIIP 92

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
             +  DP+L+G T +  +LA A +D  LKG              + +  Q+   +G + +
Sbjct: 93  MRMQADPALLGVTRDEWVLAVAEVDQYLKGKPNRLRED------ERETVQRFQDEGRVKM 146

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
            FN GFF+NG S  PE+AG+  A+VGS Y++L+ +  SFP+G+ +A+YLEEF+     + 
Sbjct: 147 AFNTGFFVNGDSKLPEMAGVWAALVGSAYVLLLTLAFSFPVGVLTAVYLEEFAPDNRLTQ 206

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            V+ NINNLA++PSI+YG+LG A+ INFF +PRS+ALVGGL LALMT+P III+T  ALR
Sbjct: 207 IVEVNINNLAAIPSILYGLLGLAIFINFFHVPRSSALVGGLTLALMTMPVIIISTRAALR 266

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP SIR AA G+GA+  Q V+HH LPLA+P +LTG+ + LARA+GE+APLL +GM+A++
Sbjct: 267 SVPGSIREAAYGIGATPWQVVWHHTLPLALPGVLTGTIIGLARAIGESAPLLIIGMMAYI 326

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            D P  VT+ ATA P QIY W+ D++R F ERT  AI++LL  L  +N   +++RN++++
Sbjct: 327 PDAPHSVTEAATALPAQIYTWSTDSQRAFTERTAAAIVVLLAVLLSMNALAIYMRNKYER 386

Query: 424 RW 425
           +W
Sbjct: 387 KW 388


>gi|258404599|ref|YP_003197341.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfohalobium retbaense DSM 5692]
 gi|257796826|gb|ACV67763.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfohalobium retbaense DSM 5692]
          Length = 390

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 169/414 (40%), Positives = 240/414 (57%), Gaps = 38/414 (9%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           K RY +E  FRFY + AV++   FL+     I+S+G  A  Q  I   I ++E   +   
Sbjct: 15  KRRYRAEKRFRFYALSAVVLACAFLVFFFFDIISQGYTAFVQARIKAEIHYTEQSAEL-- 72

Query: 72  KRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPS 131
                P   +  D    V +   R + +                          +   P 
Sbjct: 73  -----PLAAVDEDIRYFVSRGRLRTIPLE-------------------------IEKHPE 102

Query: 132 LIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFI 191
           L+G T    ++A A +D  LKG          +   Q ++   L ++  + L FN GFF 
Sbjct: 103 LMGTTQTEWVIADAEVDQYLKGKSNR------LKPKQKRFIDSLKANDRVKLAFNTGFFT 156

Query: 192 NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINN 251
            G S  PE+AGI  AVVGS+Y++ + +  S P+G+ +AIYLEEF+    F+  ++ NINN
Sbjct: 157 RGDSKLPEIAGIFAAVVGSIYVLSLTLLFSVPIGVMTAIYLEEFAPDNRFTQAIEVNINN 216

Query: 252 LASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRS 311
           LA++PSI++G+LG A+ INFF +PRS+A+ GGL L LMTLP III+T  ALR VP SIR 
Sbjct: 217 LAAIPSILFGLLGLAIFINFFGVPRSSAMAGGLTLGLMTLPIIIISTRAALRAVPDSIRE 276

Query: 312 AALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVT 371
            A G+GAS  Q V+HHVLPL++P ILTG+ + LA+A+GETAPLL VGM+A++ + P GVT
Sbjct: 277 GAYGVGASPWQVVWHHVLPLSLPGILTGTIIGLAQAMGETAPLLIVGMMAYIPEAPSGVT 336

Query: 372 DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           D AT  P QIY W+A + R + ERT  AI++LL  L  +N A ++LR R+++RW
Sbjct: 337 DAATVLPAQIYTWSAASLRAYAERTAAAIIVLLAVLLTLNAAAVFLRKRYERRW 390


>gi|307294610|ref|ZP_07574452.1| phosphate ABC transporter, inner membrane subunit PstA [Sphingobium
           chlorophenolicum L-1]
 gi|306879084|gb|EFN10302.1| phosphate ABC transporter, inner membrane subunit PstA [Sphingobium
           chlorophenolicum L-1]
          Length = 414

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 249/421 (59%), Gaps = 19/421 (4%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
              +K +  RY SE  F+   ++AV +   FL  LL S++  G+    +T I++ ++F  
Sbjct: 13  DAMRKRIARRYASERRFKIAGLLAVALSAAFLAFLLFSMMGNGLRGFTRTEIAVKVDFPA 72

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
           + +        D A          +  A    ++      AL   A + +S TA   LR 
Sbjct: 73  SPLLLDPNAITDQA----------LANANLPMVTGEVVKKALGANAEEWVSPTAWTVLRD 122

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            +  DP ++ +TV + L A+  ID A K            S        +L   G L   
Sbjct: 123 AIKADPKILAQTVTIKLPAATAIDLAAKS---------DGSPEAEAAVARLKKAGLLTTG 173

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N+GF      + P   GI  A  GSL  ML+ + LSFP+G+A+A+YLEE++ K + +  
Sbjct: 174 VNWGFLTASDGTDPTQVGIWGAFKGSLLTMLVTLALSFPVGVATAVYLEEYARKNWLTDI 233

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ +INNLA+VPSI++G+LG ++ +NF  +PRS ALVGG+ LALMT+P I+IA   A+++
Sbjct: 234 IEVSINNLAAVPSIIFGLLGLSIFLNFLALPRSAALVGGMTLALMTMPVIVIAGRNAIKS 293

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR AALG+GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AF+ 
Sbjct: 294 VPPSIRDAALGIGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFIA 353

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G+TD AT  PVQI+LW+ +  + FVE+T  AI++LL+FL  +N   ++LRN+F++R
Sbjct: 354 TPPGGITDPATVLPVQIFLWSDEVSKGFVEKTSAAIIVLLVFLLAMNGLAIYLRNKFERR 413

Query: 425 W 425
           W
Sbjct: 414 W 414


>gi|307544718|ref|YP_003897197.1| ABC transporter permease [Halomonas elongata DSM 2581]
 gi|307216742|emb|CBV42012.1| ABC-type transport system permease protein [Halomonas elongata DSM
           2581]
          Length = 388

 Score =  305 bits (781), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 158/424 (37%), Positives = 240/424 (56%), Gaps = 38/424 (8%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +SF      L+ R+      ++  + A+ +  +FL+L  + ++ KG+ A  Q  I + +E
Sbjct: 3   QSFDEISAQLRRRHRKSARLKWISMGALGLAGLFLVLFFADMLVKGLPAFQQARIQVEVE 62

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           +SE                                 +      A+  +   ++S      
Sbjct: 63  YSEQ--------------------------------ASQIPLAAVQEEVRPIVSRGYLRL 90

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           +   +  +P L G T    +LA   +D  LKG+       +++   +     +L S+G  
Sbjct: 91  IPGRMDENPDLQGTTRMEWVLADGQVDQYLKGHH------NKLDADEKATIDRLQSEGRA 144

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            L FN  FF NG S  PE+AGI  A +G++  +L+ + +SFP+G+ +A+YLEEF+     
Sbjct: 145 ELVFNTTFFTNGDSKMPELAGIASAAMGTVLTLLVTLAVSFPIGVMTAVYLEEFAPDNRV 204

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NINNLA++PSI++G+LG A+ INFF +PRS+ +VGGL LALMTLP IIIAT  A
Sbjct: 205 TQLIEININNLAAIPSILFGLLGLAIFINFFGVPRSSPVVGGLTLALMTLPVIIIATRTA 264

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR+VP SIR AA G+G S+ Q V  HVLP+A+P I+TGS + LA+A+GETAPL+ VGMVA
Sbjct: 265 LRSVPDSIRHAAFGVGCSRWQMVRDHVLPVALPGIMTGSIIGLAQAMGETAPLIIVGMVA 324

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D     T+ AT  P QI+ WA + +R F+E+T G IL+LL  L  +N   + LR +F
Sbjct: 325 FIPDVTSSFTEAATVLPAQIFTWAGEPDRAFIEKTSGGILVLLAVLITLNATAVVLRKKF 384

Query: 422 KKRW 425
           ++RW
Sbjct: 385 ERRW 388


>gi|320352742|ref|YP_004194081.1| PhoT family phosphate ABC transporter membrane protein 2
           [Desulfobulbus propionicus DSM 2032]
 gi|320121244|gb|ADW16790.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Desulfobulbus propionicus DSM 2032]
          Length = 422

 Score =  305 bits (781), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 187/405 (46%), Positives = 266/405 (65%), Gaps = 11/405 (2%)

Query: 23  FYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLR 82
            + + A++   +FL+LLL+SI +KG  A  Q+ I L I F   ++D           L  
Sbjct: 27  MFGLTAIVASLLFLVLLLASIGAKGYTAFRQSEILLDIHFDPAVLDVDN--------LAT 78

Query: 83  ADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLL 142
           A+Y  LVR+A+         +    R  ++++S+ A + L+  +M  P LIG T  V + 
Sbjct: 79  ANYAALVREAVLALFP-EVESRQDKRTVAKLVSSGAAHALQAMVMAKPELIGTTRAVWVT 137

Query: 143 ASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEV 200
           A   +D  +KG++    P +  R+SD Q  W  +L   G L   FN  FF  G S  PE+
Sbjct: 138 ADDEVDMFVKGHIPRDVPESERRISDQQAAWIDRLIEAGRLEQRFNAAFFQAGDSREPEL 197

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
           AGI  A +GSL+ + + + LSFP+G+A+A+YLEEF+ K  ++  ++ NINNLA++PSIV+
Sbjct: 198 AGIRGATMGSLFTLAVTLVLSFPVGVAAAVYLEEFAPKNRWTDLIEVNINNLAAIPSIVF 257

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+LG AV +NF  +PRS++LVGGL+L LMTLP+IIIA+  +L++VP SIR AALG+GASK
Sbjct: 258 GLLGLAVFLNFLGLPRSSSLVGGLVLTLMTLPTIIIASRASLKSVPPSIREAALGVGASK 317

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
           +QT+ HHVLPLA+P ++TG+ + +ARALGETAPLL +GMVAF+ D P G  D AT  PVQ
Sbjct: 318 MQTIAHHVLPLALPGMMTGAIIGMARALGETAPLLMIGMVAFIVDVPQGFHDPATVLPVQ 377

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           IYLWA   ER FVERT  AI++LL+ L  +N A + LRN+F++RW
Sbjct: 378 IYLWADSPERAFVERTSAAIMVLLVLLLAMNAAAVLLRNKFERRW 422


>gi|256830446|ref|YP_003159174.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfomicrobium baculatum DSM 4028]
 gi|256579622|gb|ACU90758.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfomicrobium baculatum DSM 4028]
          Length = 386

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 169/423 (39%), Positives = 247/423 (58%), Gaps = 38/423 (8%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S  I+ ++L+ R   E  F+    +A+ V  +FL++  + I+ +G  A  QT I   + F
Sbjct: 2   SMPIDPRSLRKRKNKESQFKALSYMAIAVAGIFLVVFFADIIRQGYTAFMQTEIRTNVTF 61

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
           S++I D                                D   AL R+   ++S      L
Sbjct: 62  SQSIFD--------------------------------DPRSALDRKLIPLVSRGVTRIL 89

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
              L  +P L+G T EV +LA+A +D  +KG          +   +     +L ++G++ 
Sbjct: 90  PMQLRENPQLLGTTSEVWVLANAEVDQYIKGKPNR------LKPKEIAQVDELVAEGSIK 143

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
             FN GFF NG S   E+AGI  A VG+LY++ I    SFP G+ +AIYLEEF+      
Sbjct: 144 KAFNVGFFTNGDSKLAEMAGILSAAVGTLYLLGITFIFSFPAGVMAAIYLEEFAPDNRLM 203

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             V+ NINNLA++PSI++G+LG A+ INF  +PRS+ALVGGL LALMTLP III+T  A+
Sbjct: 204 HIVEVNINNLAAIPSILFGLLGLAIFINFMGLPRSSALVGGLTLALMTLPVIIISTRAAI 263

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P SIR  AL LGA+  Q V+ H+LPL++P ILTG+ + LARA+GETAPLL +GMVA+
Sbjct: 264 RAIPDSIREGALALGATHWQVVWDHILPLSLPGILTGTIIGLARAIGETAPLLIIGMVAY 323

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           + D P G+T  AT  P QIY+W++++ R F ERT   I++LL+ L  +N   + LRN+++
Sbjct: 324 IQDMPRGLTSAATVLPAQIYVWSSESIRAFTERTSAGIIVLLVVLLSMNALAILLRNKYE 383

Query: 423 KRW 425
           ++W
Sbjct: 384 RKW 386


>gi|92113602|ref|YP_573530.1| phosphate ABC transporter permease [Chromohalobacter salexigens DSM
           3043]
 gi|91796692|gb|ABE58831.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chromohalobacter salexigens DSM 3043]
          Length = 388

 Score =  302 bits (774), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 158/424 (37%), Positives = 236/424 (55%), Gaps = 38/424 (8%)

Query: 2   KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIE 61
           +SF      LK R+      ++  + A+++   FL++ +S +V +G  A  Q  + + + 
Sbjct: 3   QSFEEISAQLKKRHRRSARMKWMTMGALILSAAFLVVFISDMVVRGWPAFQQAQLQVEVS 62

Query: 62  FSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH 121
           + E                                 S      A+      ++S      
Sbjct: 63  YDEQ--------------------------------SQKLPLAAVDEDVRPLISRGFFRS 90

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           L + +  +P L+G T    ++A + +D  LKG          +     +  Q L  DG  
Sbjct: 91  LPREMENNPELMGTTQTRWVIADSRVDQFLKGNEDR------LRPADKETLQALVEDGRA 144

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
            L FN  FF  G S  PE+AGI  A +G++  ML+ + + FP+G+ +A+YLEEF+     
Sbjct: 145 ALKFNTTFFTTGDSKMPELAGIASAAIGTVMTMLVTMAVCFPIGVMTAVYLEEFAPDNRL 204

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NINNLA+VPSI++G+LG A+ I+FF +PRS+ LVGGL LALMTLP III+T  A
Sbjct: 205 TQLIEININNLAAVPSILFGLLGLAIYISFFGVPRSSPLVGGLTLALMTLPVIIISTRAA 264

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR+VP SIR AA G+G S+ Q V  HVLP+++P ILTGS + LA+A+GETAPL+ VGMVA
Sbjct: 265 LRSVPDSIRHAAFGVGCSRWQVVRDHVLPVSLPGILTGSIIGLAQAMGETAPLIIVGMVA 324

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+ D  + +TD +T  P QI+ WA++    F E+T G IL+LL  L  +N   +WLRN+F
Sbjct: 325 FIPDASISITDASTVMPAQIFTWASEPNSAFAEKTAGGILVLLAVLIFLNALAVWLRNKF 384

Query: 422 KKRW 425
           ++RW
Sbjct: 385 ERRW 388


>gi|110635448|ref|YP_675656.1| phosphate ABC transporter, inner membrane subunit PstA
           [Mesorhizobium sp. BNC1]
 gi|110286432|gb|ABG64491.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chelativorans sp. BNC1]
          Length = 456

 Score =  302 bits (773), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 177/421 (42%), Positives = 255/421 (60%), Gaps = 22/421 (5%)

Query: 23  FYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAI--- 79
            Y + A+      +++L S I++KGI A  Q  ++L + F   +++   +    P     
Sbjct: 38  AYGIAAICAALGAVLILFSMILAKGIPAFTQASLTLDVFFDPAVIEVDPRPEPQPGQSPA 97

Query: 80  ------------LLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                       +   ++N ++  A+ +            RQA  ++ T+ R+ LR   +
Sbjct: 98  DYQKARLDWERQVTLVNWNRILEAAIRQAAPD---MEVDTRQALSIVETSERFVLRDRFV 154

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDF 185
            +P+L+G+TV+V LLASAN+D+ LKG +    P +  ++S        +L  +G +   F
Sbjct: 155 ENPALLGQTVKVDLLASANVDNWLKGNIDRSLPDSQQQLSAPARALADRLLENGTIRFAF 214

Query: 186 NYGFFINGASSR-PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
               F N  S   P  AG+  A +GSLYMML+VI L+ PLG+ SA+YLEEF+ K  F+  
Sbjct: 215 ATQIFTNVDSRSAPASAGLAGAFMGSLYMMLVVIVLAVPLGVGSAVYLEEFAPKNRFTDL 274

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA+VPSIV+G+LG+AV IN+F++P S  LVGGL+L LMTLP+IIIAT  ALR 
Sbjct: 275 IEVNINNLAAVPSIVFGLLGAAVFINYFRLPLSAPLVGGLVLTLMTLPTIIIATRSALRA 334

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S+R AALGLGAS++QTVFHHVLP+  P ILT + + +A+ALGETAPLL +GM AFV 
Sbjct: 335 VPPSLRQAALGLGASRMQTVFHHVLPVTYPGILTATIIGVAQALGETAPLLLIGMNAFVA 394

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFKK 423
             P    D +TA PVQIYLW  +  R F E RT  AI++LL  +  +N   ++LR R ++
Sbjct: 395 AVPATPLDQSTALPVQIYLWQGNENRNFFEARTSAAIIVLLGLMITLNALAIYLRTRLER 454

Query: 424 R 424
           R
Sbjct: 455 R 455


>gi|254440483|ref|ZP_05053977.1| phosphate ABC transporter, permease protein PstA [Octadecabacter
           antarcticus 307]
 gi|198255929|gb|EDY80243.1| phosphate ABC transporter, permease protein PstA [Octadecabacter
           antarcticus 307]
          Length = 437

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 180/435 (41%), Positives = 269/435 (61%), Gaps = 17/435 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S      + K R  +E  FR Y + A+ +  V L++LL SI+  G  +  QT++S P+  
Sbjct: 8   SLLQTDPHTKKRNAAEKRFRMYGLSAIGIAIVALVILLVSIIGNGASSFRQTYLSFPVTI 67

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLR-QASQMLSTTARYH 121
           + T ++       + A+L    YN +++ +L   L+ +D         A  M+S  A   
Sbjct: 68  NATEIEA-----AESALLKTGAYNKIIQISLLAYLTNNDQLQDTPEADAFGMISDEAGAT 122

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDG 179
            R+ ++ +P   G T +++LL +  ID   KG +   +      ++  Q     +L   G
Sbjct: 123 FRRFILANPDAAGTTFQMNLLTNGRIDGYFKGRVTAQTALLDKNVTPAQLILADRLADQG 182

Query: 180 ALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
            L   FN+ FF N  +S      AG+GVA++GSLYMM +V+ L+ P+G+A++IYLEEF+ 
Sbjct: 183 TLVQRFNWAFFTNPDASDQRPEAAGLGVAILGSLYMMAVVLCLALPIGVAASIYLEEFAR 242

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K + +  ++ NI NLA+VPSIVYGILG A+ INF ++ +S+ LVGGL+L LMTLP+III+
Sbjct: 243 KSWITDVIEVNIANLAAVPSIVYGILGLAIFINFAELNQSSPLVGGLVLTLMTLPTIIIS 302

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  +L+++P SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +
Sbjct: 303 TRASLKSIPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLI 362

Query: 358 GMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
           GMVAFV +YP           + +TA PVQ++ W   ++  FVER  GAI+ LLIFL ++
Sbjct: 363 GMVAFVKEYPAAWSPDAGLFGEASTALPVQVFNWTQRSDPAFVERASGAIITLLIFLLIM 422

Query: 411 NTAMLWLRNRFKKRW 425
           N   ++LR +F++RW
Sbjct: 423 NALAIFLRKKFERRW 437


>gi|94495741|ref|ZP_01302321.1| probable phosphate ABC transporter, permease protein (PstA)
           [Sphingomonas sp. SKA58]
 gi|94425129|gb|EAT10150.1| probable phosphate ABC transporter, permease protein (PstA)
           [Sphingomonas sp. SKA58]
          Length = 400

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 167/418 (39%), Positives = 254/418 (60%), Gaps = 19/418 (4%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K +  RY +E  FR   + AVL+   FL  LL +++  G+    +T I+L ++F  + +
Sbjct: 2   RKRIARRYAAERRFRLLGLGAVLLSAAFLAFLLVTMMGNGLRGFTRTEIALKVDFPASPL 61

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
               +   D A          +  A    ++ + +   L ++A   L+ TA   LR  + 
Sbjct: 62  LLDPQAITDEA----------LANANLPMVTSTVAEKMLGKEADAWLAPTAWTSLRDAIK 111

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            DP+++ +T  + + AS +ID A K            +       ++L   G L   FN+
Sbjct: 112 ADPTILNRTDVIRVPASTDIDLAAKS---------DGTPAAEAAVKRLTQAGILSTGFNW 162

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F  +   + P   GI  A  GSL  ML+ + LSFP+G+A+A+YLEE++ K +++  ++ 
Sbjct: 163 SFLSSSDGTDPTQVGIWGAFKGSLLTMLVTLVLSFPIGVATALYLEEYAPKAWWTDIIEV 222

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           +INNLA+VPSI++G+LG ++ +N   +PRS A+VGG+ LALMT+P I+IA   A+++VP 
Sbjct: 223 SINNLAAVPSIIFGLLGLSIFLNVLHLPRSAAVVGGMTLALMTMPVIVIAGRNAIKSVPP 282

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALG+GAS VQ VF HVLPLA+P ILTG+ + +ARALGETAPLL +GM AF+   P
Sbjct: 283 SIRDAALGIGASPVQVVFQHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFIATPP 342

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            GVTD AT  PVQI+LW+ +  + FVE+T  AI++LL+FL  +N   ++LRN+F+KRW
Sbjct: 343 GGVTDPATVLPVQIFLWSDEVSKGFVEKTSAAIIVLLVFLLAMNGLAIYLRNKFEKRW 400


>gi|78188477|ref|YP_378815.1| phosphate ABC transporter permease [Chlorobium chlorochromatii
           CaD3]
 gi|78170676|gb|ABB27772.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chlorobium chlorochromatii CaD3]
          Length = 396

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 156/426 (36%), Positives = 240/426 (56%), Gaps = 39/426 (9%)

Query: 1   MKSFSINKKNLKY-RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           M + SI  +  K  R   E  FRFY + A+++   FL+     I+ KG  A   T I   
Sbjct: 9   MDNVSIKDERRKQQRLARERRFRFYGISAIVLALSFLVFFFVDIIQKGYKAFAVTEIRSE 68

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTAR 119
           + +S   +D                                    A        +S +  
Sbjct: 69  VVYSPDALDI--------------------------------PQLAFQEDVRDFVSYSVV 96

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDG 179
             +   L  +P+L+GK+    ++A+  +D   KG      +  ++S+ + +    L   G
Sbjct: 97  RMIPSQLEKEPTLMGKSNVQWVVANDEVDQYCKG------SDTQLSEEEQQQINALRDAG 150

Query: 180 ALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG 239
            + + FN  FF  G S  PEVAGI  A+VG+LY++ + +  + P+G+ SA+YL+EF+   
Sbjct: 151 RVRVTFNALFFTAGDSKLPEVAGILSAIVGTLYVITLTVLFAVPIGVMSALYLQEFAPDN 210

Query: 240 FFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATG 299
            F+  ++ NI+NLA++PSI++G+LG ++ INFF +PRS+AL GGL LALMTLP III+T 
Sbjct: 211 AFTRLIEVNISNLAAIPSIIFGLLGLSIFINFFGVPRSSALAGGLTLALMTLPVIIISTR 270

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            +L  VP SIR  A  +GAS++Q VFHH+LPLA+P I TG+ + +ARALGETAPLL VGM
Sbjct: 271 ASLAAVPDSIRHGAYAVGASRLQMVFHHLLPLAVPGITTGTIIGVARALGETAPLLIVGM 330

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           +A++ D P  +T+ AT  P QIY W++ ++R FVE+T   I++LL  + V+N    +LR 
Sbjct: 331 MAYIPDMPTSITEAATVLPAQIYTWSSASQRAFVEKTAAGIMVLLAVMLVLNAIAFFLRK 390

Query: 420 RFKKRW 425
           +++ +W
Sbjct: 391 KYEIKW 396


>gi|254453463|ref|ZP_05066900.1| phosphate ABC transporter, permease protein PstA [Octadecabacter
           antarcticus 238]
 gi|198267869|gb|EDY92139.1| phosphate ABC transporter, permease protein PstA [Octadecabacter
           antarcticus 238]
          Length = 437

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 182/435 (41%), Positives = 272/435 (62%), Gaps = 17/435 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S      + K R  +E  FR Y + A+ +  + L++LL SI+  G  +  QT++S P+  
Sbjct: 8   SLLQTDTHTKKRNAAEKRFRMYGLSAIGIALIALVILLVSIIGNGASSFRQTYLSFPVT- 66

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLR-QASQMLSTTARYH 121
               ++  +    + A+L  A YN +++ +L   L+ +D    +    A  M+S  A   
Sbjct: 67  ----INAAEIEAAESALLKTAAYNKIIQTSLLTYLTENDLLQDIPEADAFGMISDEAGAT 122

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY--SPANVHRMSDYQWKWFQKLDSDG 179
            R+ ++ DP   G T +++LLA+  ID   KG +   +      ++  Q     +L   G
Sbjct: 123 FRRFILADPEAAGTTFQLNLLANGRIDGYFKGRVTAQTALLDQNVTPAQLVLADRLADQG 182

Query: 180 ALFLDFNYGFFINGASSRPEV--AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           AL   FN+ FF N  +S      AG+GVA++GSLYMM +V+ L+ P+G+A++IYLEEF+ 
Sbjct: 183 ALVKRFNWAFFTNPDASDQRPEAAGLGVAILGSLYMMAVVLCLALPIGVAASIYLEEFAR 242

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K + +  ++ NI NLA+VPSIVYGILG A+ INF ++ +S+ LVGGL+L LMTLP+III+
Sbjct: 243 KSWITDVIEVNIANLAAVPSIVYGILGLAIFINFAELNQSSPLVGGLVLTLMTLPTIIIS 302

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  +L+++P SIR AALG+GASK+Q+VFHHVLPLA P ILTG+ + LA+ALGETAPLL +
Sbjct: 303 TRASLKSIPPSIRDAALGVGASKMQSVFHHVLPLAAPGILTGTIIGLAQALGETAPLLLI 362

Query: 358 GMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
           GMVAFV +YP           + +TA PVQ++ W   ++  FVER  GAI+ LLIFL ++
Sbjct: 363 GMVAFVKEYPAAWSPDAGLFGEASTALPVQVFNWTQRSDPAFVERASGAIITLLIFLLIM 422

Query: 411 NTAMLWLRNRFKKRW 425
           N   ++LR +F++RW
Sbjct: 423 NALAIFLRKKFERRW 437


>gi|149184839|ref|ZP_01863157.1| probable phosphate ABC transporter, permease protein (PstA)
           [Erythrobacter sp. SD-21]
 gi|148832159|gb|EDL50592.1| probable phosphate ABC transporter, permease protein (PstA)
           [Erythrobacter sp. SD-21]
          Length = 416

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 157/422 (37%), Positives = 244/422 (57%), Gaps = 15/422 (3%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
             + +  LK RY +E  F+   + A+L     LI LL S+   GI    +  +++PI+F+
Sbjct: 10  THVFEARLKKRYAAEKRFKAMGLTAILFSVAVLIYLLGSMTINGISGFQRAEVAVPIDFT 69

Query: 64  ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLR 123
           +  +        DP+++  +     +     R +    +   L    ++ + T A   + 
Sbjct: 70  QAGI------SADPSVMGTSQAMQSLEAQGLRDVVQYFAVEELGEAGAEEIGTQAWRDVA 123

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
             +  DP ++ +     + ASA++   L G           S        +L  +G L  
Sbjct: 124 AAISADPGIVQRQETFWIPASADLAQGLAGE---------GSAEMQALASQLADEGKLAK 174

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           +F+ GFF    ++ P+  GI  A+ GS+  M++ + L+FP+G+ +A+YLEE++ K  ++ 
Sbjct: 175 NFDAGFFSRADATNPQQVGIWGALKGSILTMIVTLALAFPIGVLAALYLEEYAPKNRWTD 234

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +INNLA+VPSI++G+LG AV +  F   RS  L+GG+ LALMT+P I+IA   A++
Sbjct: 235 LIELSINNLAAVPSIIFGLLGLAVFLTIFPSYRSAPLIGGMTLALMTMPVIVIAGRNAIK 294

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP SIR  AL +GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AFV
Sbjct: 295 AVPPSIRDGALAVGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFV 354

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P   T  AT  P+QI+LW+ + +R FVERT  AI++LL FL V+N   ++LRN+F+K
Sbjct: 355 ASPPDSFTAPATVLPMQIFLWSDEIDRGFVERTSAAIIVLLAFLLVMNGLAIYLRNKFEK 414

Query: 424 RW 425
           +W
Sbjct: 415 KW 416


>gi|296283971|ref|ZP_06861969.1| phosphate ABC transporter permease [Citromicrobium bathyomarinum
           JL354]
          Length = 421

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 157/418 (37%), Positives = 244/418 (58%), Gaps = 15/418 (3%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           +K LK RY  E  F+ + + A++V    L +LL ++   G+G   +  + +PI+F+E+ +
Sbjct: 19  EKRLKQRYAQERRFKLFGLFAIIVSIAILFVLLGNMTINGVGGFQRAELQVPIDFAESGL 78

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                    P  +   +   L        +    +   +    ++ LS  A   + + L 
Sbjct: 79  AGDAASLSQPGAVQTLEMQGLPE------IVAFAAEQRMGAAGAEQLSQDAWREVAEDLR 132

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            DP+++       L AS ++ S + G           S        +L+ +G L   F++
Sbjct: 133 ADPAMLRGQETFWLPASGDLASGMDGE---------GSPEMQALAAQLEREGYLEKRFDW 183

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GF     ++ P+  G+  A+ GS+  M++ + L+FP+G+ SA+YLEE++ K  ++  ++ 
Sbjct: 184 GFLTRSDATDPQQVGVWGALKGSILTMIVTLALAFPIGVLSALYLEEYAPKNRWTDIIEV 243

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           +INNLA+VPSI++G+LG AV +  F   RS  LVGG+ LALMT+P I+I+   A++ VP 
Sbjct: 244 SINNLAAVPSIIFGLLGLAVFLWIFPNMRSAPLVGGMTLALMTMPVIVISGRNAIKAVPP 303

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR  AL +GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AFV   P
Sbjct: 304 SIRDGALAVGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLLIGMRAFVATPP 363

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            G T  AT  PVQI+LW+ + +R F+ERT  AI++LL+FL V+N   ++LRN+F+K W
Sbjct: 364 DGFTSPATVLPVQIFLWSDEIDRGFIERTSAAIIVLLLFLLVMNALAIYLRNKFEKTW 421


>gi|218887653|ref|YP_002436974.1| phosphate ABC transporter inner membrane protein PstA
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758607|gb|ACL09506.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 389

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 165/418 (39%), Positives = 242/418 (57%), Gaps = 38/418 (9%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK L+ R  +E  FR   + A+ +   FL+  L  I  KG  A  Q  + + + ++    
Sbjct: 10  KKLLRKRRAAETRFRLCAIFALFLAGAFLVFFLFDIGRKGYPAFQQAELLVSVNYTVEAH 69

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D                                +   A+     Q++S +    +   + 
Sbjct: 70  D--------------------------------NPYAAMDPDTVQVVSRSFTRLIPSMMA 97

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            +  LIG T EV +LASA+ D  LKG          +          +  +G   L FN+
Sbjct: 98  ENSRLIGTTQEVWVLASADTDQYLKGRPNR------LKPRHQALVDTMRQEGKARLAFNW 151

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
           GFF +G S  PE+AGI  A +GSLY++LI + +SFP+G+  A+YLEEF+     +  ++ 
Sbjct: 152 GFFESGDSKLPELAGIRAAAIGSLYVLLITLAISFPVGVMCAVYLEEFAPDNRLTQIIEV 211

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA++PSI+YG+LG A+ INF  + RS+ALVGGL L+LMTLP+III+T  A+R++P 
Sbjct: 212 NINNLAAIPSILYGLLGLAIFINFMGVARSSALVGGLTLSLMTLPAIIISTRAAIRSIPP 271

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AAL LGA+ +Q V+HHVLPL++P ILTG+ + LARA+GETAPLL VGM+A++ + P
Sbjct: 272 SIREAALALGATPLQVVWHHVLPLSLPGILTGTIIGLARAMGETAPLLIVGMMAYIPEAP 331

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
                 AT  P QI+ WA+D++R F ERT   IL+LL+ L  +N   +WLRN+++++W
Sbjct: 332 ENFNSAATVLPAQIFTWASDSQRAFSERTAAGILVLLVLLLGMNATAIWLRNKYERKW 389


>gi|85373910|ref|YP_457972.1| phosphate ABC transporter permease [Erythrobacter litoralis
           HTCC2594]
 gi|84786993|gb|ABC63175.1| probable phosphate ABC transporter, permease protein (PstA)
           [Erythrobacter litoralis HTCC2594]
          Length = 412

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 151/422 (35%), Positives = 243/422 (57%), Gaps = 15/422 (3%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
               ++ LK RY SE  F+     A+    + L LLL +++  G+    +  + + I+F+
Sbjct: 6   TEAFEQRLKQRYASERRFKMLGFSAIAFSVLVLALLLGNMLYSGVAGFQRDELRVSIDFT 65

Query: 64  ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLR 123
           +  +        +   L ++D    + +    ++    +   L    +  +S  A   + 
Sbjct: 66  QAGL------AGNADTLSQSDAVQELERQGLPQVIEFAATEQLGAAGAAEVSNQAWREVA 119

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
           + ++ DP L+    +  L  S ++   + G           S       Q+L ++G L  
Sbjct: 120 QDIIADPGLLQSQEDFWLPTSGDLAQGVDGE---------GSPEMQALAQRLVAEGKLET 170

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           +F+ GF     ++ P++ GI  A+ GS+  ML+ + L+FP+G+ +A+YLEE++ K  ++ 
Sbjct: 171 NFDIGFLTRSDATDPQMVGIWGALKGSILTMLVTLALAFPIGVLAALYLEEYAPKNRWTD 230

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +INNLA+VPSI++G+LG AV +  F   RS  L+GG+ LALMT+P I+I+   A++
Sbjct: 231 ILEVSINNLAAVPSIIFGLLGLAVFLTIFPNMRSAPLIGGMTLALMTMPVIVISGRNAIK 290

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP SIR  AL +GAS VQ VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AFV
Sbjct: 291 AVPPSIRDGALAVGASPVQVVFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFV 350

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P G T  AT  PVQI+LW+ + +  F+ERT  AI++LL+FL ++N   ++LRN+F+K
Sbjct: 351 ASPPDGFTSPATVLPVQIFLWSDEIDTGFIERTSAAIIVLLLFLLLMNGLAIYLRNKFEK 410

Query: 424 RW 425
            W
Sbjct: 411 SW 412


>gi|268680476|ref|YP_003304907.1| phosphate ABC transporter inner membrane subunit PstA
           [Sulfurospirillum deleyianum DSM 6946]
 gi|268618507|gb|ACZ12872.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 389

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 150/415 (36%), Positives = 236/415 (56%), Gaps = 38/415 (9%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +K R     LF+   ++A++    FL+  L+ IV  G  A  QT+I + +E +E +    
Sbjct: 13  IKKRNQKAALFKSLTILAIVFSISFLVFFLTDIVRAGYPAFTQTYIQMEVEINEEV---- 68

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
                                         +   AL  +  ++ S      L   +  +P
Sbjct: 69  ----------------------------AQNPYGALKGKNLKIASRAWLRDLPNLIKENP 100

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
           S +  T  + +LA++ +D  +KG              +  +  +L ++G +   FN  F 
Sbjct: 101 SWMNTTQILWVLANSEVDQYVKGKESRTKES------ERAYVDELRAEGKVERKFNTIFM 154

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
             G S  PE +GI  ++VG++  +++ + ++FP+G+ +AIYLEEF+    F+  ++ NIN
Sbjct: 155 TTGDSKIPENSGIYASIVGTVLTVIVTMAIAFPIGVMTAIYLEEFAPDNRFTQIIEVNIN 214

Query: 251 NLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIR 310
           NLA++PSI++G+LG A+ INFF +PRS+ LVGG+ LALM LP II+++  AL++VPSSIR
Sbjct: 215 NLAAIPSILFGLLGLAIFINFFGVPRSSPLVGGMTLALMCLPVIIVSSKAALKSVPSSIR 274

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
            A  GLG +K Q V  HVLPLAMP I+TGS +S+A ALGETAPL+ VGM+AFV D    +
Sbjct: 275 QAGFGLGLTKWQIVRDHVLPLAMPGIMTGSIISIAHALGETAPLIIVGMIAFVPDAATSI 334

Query: 371 TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           TD +T  P QI+ WA   E+ ++ERT   I++LL+ L  +N   ++LR +F+++W
Sbjct: 335 TDASTVLPAQIFTWAGMPEKAYLERTAAGIIVLLVVLLSLNAVAVYLRRKFERKW 389


>gi|85708494|ref|ZP_01039560.1| phosphate ABC transporter, permease protein [Erythrobacter sp.
           NAP1]
 gi|85690028|gb|EAQ30031.1| phosphate ABC transporter, permease protein [Erythrobacter sp.
           NAP1]
          Length = 421

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 155/422 (36%), Positives = 244/422 (57%), Gaps = 15/422 (3%)

Query: 4   FSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFS 63
                K L  RY +E  FR   + A++     LI LL ++++ GIG   +  +++ I   
Sbjct: 15  TEAFAKRLNQRYRAERRFRALGLGAIVFSIAVLIFLLGNMLANGIGGFQRAELAVEINM- 73

Query: 64  ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLR 123
                P+     D   L       ++       +    +  +L    ++ +S  A   + 
Sbjct: 74  -----PESGVTGDEVSLTAPSSTQVLEMQGLPDIVEFYAEQSLGEAGAEQVSRDAWRDVA 128

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
             L  DPSLI +T    L AS+++ + L G           S       ++L ++G L  
Sbjct: 129 DALKEDPSLIERTETFQLAASSDLAAGLAGE---------GSAEMQALAEQLANEGKLAE 179

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
           ++++GF     ++ P+  GI  A+ GS+  M++   L+FP+G+ +A+YLEE++ K  ++ 
Sbjct: 180 NWDWGFLARSDATSPQQVGIWGALKGSILTMIVTFLLAFPIGVLAALYLEEYAPKNRWTD 239

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +INNLA+VPSI++G+LG AV +  F   RS  ++GG+ LALMT+P I+I+   A++
Sbjct: 240 LIEVSINNLAAVPSIIFGLLGLAVFLTLFPNLRSAPVIGGMTLALMTMPVIVISGRNAIK 299

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP SIR  AL +GAS VQ VFHHVLPLA+P +LTG+ + +ARALGETAPLL +GM AFV
Sbjct: 300 SVPPSIRDGALAVGASPVQVVFHHVLPLALPGMLTGTIIGMARALGETAPLLLIGMRAFV 359

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P G T  AT  P+QI+LW+ + +R FVERT  AI++LL+FL ++N   ++LRN+F+K
Sbjct: 360 ATPPDGFTAPATVLPMQIFLWSDEIDRGFVERTSAAIIVLLLFLLLMNGLAIYLRNKFEK 419

Query: 424 RW 425
            W
Sbjct: 420 TW 421


>gi|34557335|ref|NP_907150.1| phosphate ABC transporter permease [Wolinella succinogenes DSM
           1740]
 gi|34483051|emb|CAE10050.1| PHOSPHATE TRANSPORT PERMEASE [Wolinella succinogenes]
          Length = 390

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 153/415 (36%), Positives = 229/415 (55%), Gaps = 38/415 (9%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           +  R      F+     A+ V   FL+  L  +V +G  A  Q +I + +  S+      
Sbjct: 14  INQRNRRGERFKILAASALFVSIAFLLFFLYDMVRQGYPAFKQAYIKVEMPISQE----- 68

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
                                      +  +    L +Q S+++S      L   +  +P
Sbjct: 69  ---------------------------AAENPYGVLEKQLSRLVSRAWLRDLPNQIRANP 101

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
             + KT     LASA +D  LKG+ +       +SD Q +    L ++G L + +N  FF
Sbjct: 102 EWMDKTHTFWALASAEVDQYLKGHHHR------LSDTQIEMVTHLKNEGKLEMKWNSIFF 155

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
             G S  PE +G+  AV+G++  ML+ + +S P+G+ +AIYLEEF+     +  ++ NIN
Sbjct: 156 TTGDSKIPENSGLYSAVIGTILTMLVTMAISVPIGVMTAIYLEEFAPDNRVTQIIEVNIN 215

Query: 251 NLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIR 310
           NLA++PSI++G+LG A+ INFF  PRS+ LVGG+ LALM+LP II+++  AL+ VP+SIR
Sbjct: 216 NLAAIPSILFGLLGLAIFINFFGAPRSSPLVGGMTLALMSLPIIIVSSKAALKAVPASIR 275

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
            A   LG +K Q V  HVLPLA P ILTGS +SLA+A+GETAPL+ VGM+AF+ D P  +
Sbjct: 276 QAGFALGLTKWQIVKDHVLPLATPGILTGSIISLAQAMGETAPLIIVGMIAFIPDAPDSI 335

Query: 371 TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
              AT  P QI+ W+   ER +VERT   IL+LL  L  +N   ++ R +F+++W
Sbjct: 336 FHAATVMPAQIFTWSGMPERAYVERTAAGILVLLSVLLSLNAVAIYFRKKFERKW 390


>gi|157736359|ref|YP_001489042.1| phosphate ABC transporter, permease protein [Arcobacter butzleri
           RM4018]
 gi|157698213|gb|ABV66373.1| phosphate ABC transporter, permease protein [Arcobacter butzleri
           RM4018]
          Length = 394

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 151/415 (36%), Positives = 232/415 (55%), Gaps = 38/415 (9%)

Query: 11  LKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQ 70
           LK R+ S   F+ + + +++    FL   L  +++KG+ A    ++ + + FSE  +   
Sbjct: 18  LKSRHTSAARFKKFTLTSLIFSIAFLAFFLFDMITKGVPAFNVAYVKIDVTFSEKSL--- 74

Query: 71  KKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
                                         D+  A+ ++   ++S      +   L  +P
Sbjct: 75  -----------------------------EDTRFAVDKKYKDIVSRAWLRDIPTLLKQNP 105

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
             +  T  + +LA   +D  +K +       + + + +     +L S G +   FN  FF
Sbjct: 106 DYMNTTQNLWVLADDQVDQYIKNH------NNNLKEKEILIVDELYSQGLIEKKFNAIFF 159

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
            NG S  PE AGI  AV+GS+  ++I + ++FP+G+ +AIYLEEF+    F+ F++ NIN
Sbjct: 160 KNGDSKIPEYAGIFSAVIGSILTLIITMLVAFPIGVMTAIYLEEFAGDNKFTRFIEININ 219

Query: 251 NLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIR 310
           NLA++PSI++G+LG A+ IN F MPRS+ LVGGL LALMTLP II+++  ALR VP SIR
Sbjct: 220 NLAAIPSILFGLLGLAIFINLFGMPRSSPLVGGLTLALMTLPIIIVSSRAALRAVPDSIR 279

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
            A  GLG +K+Q    HVLPLA P ILTGS + LA+A+GETAPL+ +GM+AF+ D P  V
Sbjct: 280 QAGYGLGLNKIQVTRDHVLPLAFPGILTGSIIGLAQAMGETAPLIIIGMIAFIPDAPTMV 339

Query: 371 TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           T  AT  P Q++ WA   E  ++E+T   IL+LL  L  +N   ++LR + + +W
Sbjct: 340 TQAATVMPAQLFTWAGMPEGMYIEKTAAGILVLLTILISLNAIAIYLRKKLEVKW 394


>gi|288956867|ref|YP_003447208.1| phosphate transport system permease protein [Azospirillum sp. B510]
 gi|288909175|dbj|BAI70664.1| phosphate transport system permease protein [Azospirillum sp. B510]
          Length = 434

 Score =  283 bits (723), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 179/387 (46%), Positives = 239/387 (61%), Gaps = 16/387 (4%)

Query: 41  SSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSIS 100
            SIV+KG GA  +  I L +                   +   ++   +R+AL  +    
Sbjct: 62  GSIVAKGAGAFLEARIRLEVTLDPA-------------EIADRNFTAPLRRALHAQFP-Q 107

Query: 101 DSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--P 158
            ++ A  R  +++LS+ A Y L   +  +P+L G T  V + A   ID  +KG      P
Sbjct: 108 VTDRAGRRVLNELLSSGAPYELEAMVAKNPALAGTTRTVWVRADDQIDQLVKGGYRRDLP 167

Query: 159 ANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVI 218
                +SD +      L + GAL   FN   F  G S  PE AGIG A+VGSL  +L+ +
Sbjct: 168 EGERGLSDAKVAAADALLASGALAQGFNTTLFTAGDSREPEQAGIGGALVGSLLTLLVTM 227

Query: 219 GLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST 278
            LS P+G+A+A+YLEEF+ K  ++  ++  INNLA+VPS+++G+LG AV + FF MPRS 
Sbjct: 228 ALSVPVGVAAAVYLEEFAAKNRWTGLIEVTINNLAAVPSVIFGLLGLAVFLGFFGMPRSA 287

Query: 279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILT 338
            LVGGL++ALMTLP III+  VALR VP SIR AAL +GAS +QTV HHVLPLAMPAILT
Sbjct: 288 PLVGGLVMALMTLPVIIISARVALRAVPPSIRDAALAIGASPLQTVLHHVLPLAMPAILT 347

Query: 339 GSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFG 398
           G+ + +ARALGETAPLL +GMVAF+ D P G+TD AT  PVQIY+WA   ER F ERT  
Sbjct: 348 GTIIGMARALGETAPLLMIGMVAFIVDIPHGLTDSATVLPVQIYMWADSPERAFTERTSA 407

Query: 399 AILLLLIFLAVINTAMLWLRNRFKKRW 425
           AIL+LL  L ++N A + LR  F++RW
Sbjct: 408 AILVLLGVLILLNGAAVILRKIFERRW 434


>gi|294012874|ref|YP_003546334.1| phosphate transport system permease protein [Sphingobium japonicum
           UT26S]
 gi|292676204|dbj|BAI97722.1| phosphate transport system permease protein [Sphingobium japonicum
           UT26S]
          Length = 414

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 166/401 (41%), Positives = 240/401 (59%), Gaps = 19/401 (4%)

Query: 25  CVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRAD 84
            + AVL+   FL  LL ++V  G+     T I++ ++F  + +        D A      
Sbjct: 33  GLFAVLLSAAFLAFLLFTMVGNGLRGFTGTEIAVKVDFPASPLLLDPNAITDQA------ 86

Query: 85  YNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLAS 144
               +  A    ++      AL   A Q ++ TA   LR  +  DP ++ +TV + L A+
Sbjct: 87  ----LANANLPMVTGEVVKKALGADAEQWVAPTAWTALRDAIKADPKILAQTVTIRLPAA 142

Query: 145 ANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIG 204
             ID A K            S        +LD  G L    N+GF      + P   GI 
Sbjct: 143 TAIDLAAKS---------DGSPEAEAAVARLDKAGLLTTGINWGFLTASDGTDPTQVGIW 193

Query: 205 VAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILG 264
            A  GSL  ML+ + LSFP+G+A+A+YLEE++ K + +  ++ +INNLA+VPSI++G+LG
Sbjct: 194 GAFKGSLLTMLVTLALSFPIGVATAVYLEEYARKNWMTDIIEVSINNLAAVPSIIFGLLG 253

Query: 265 SAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTV 324
            ++ +NF  +PRS ALVGG+ LALMT+P I+IA   A+++VP SIR AALG+GAS VQ V
Sbjct: 254 LSIFLNFLHLPRSAALVGGMTLALMTMPVIVIAGRNAIKSVPPSIRDAALGIGASPVQVV 313

Query: 325 FHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLW 384
           FHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AF+   P G+TD AT  PVQI+LW
Sbjct: 314 FHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFIATPPGGITDPATVLPVQIFLW 373

Query: 385 AADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           + +  + FVE+T  AI++LL+FL  +N   ++LRN+F++RW
Sbjct: 374 SDEVSKGFVEKTSAAIIVLLVFLLAMNGLAIYLRNKFERRW 414


>gi|317152750|ref|YP_004120798.1| phosphate ABC transporter inner membrane subunit PstA
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943001|gb|ADU62052.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 386

 Score =  281 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 162/421 (38%), Positives = 234/421 (55%), Gaps = 38/421 (9%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
           SI+ K LK R   +  FR Y   A+L+   FL+   + I++  + A  Q  + + + +  
Sbjct: 4   SIDPKVLKRRASRDKRFRTYAYTAILMAAAFLVFFFTDIITTALSAFKQAELLVEVHY-- 61

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
                              DY                   AL    S ++S      +  
Sbjct: 62  -----------VDEARKMGDY-------------------ALDDDVSPLVSRGFTRLIPN 91

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            +  D SL+G   E  +LA A +D  LKG          +   + K    + ++G   L 
Sbjct: 92  QMREDRSLLGTAEEKWVLAEAEVDQYLKGKPNR------LKKDERKIVDTMRAEGRARLA 145

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN GFF NG S  PE+AGI  A VGS+Y+++I    SFP G+ +AIYLEEF+        
Sbjct: 146 FNIGFFENGDSKLPEMAGIWAAAVGSMYVLIITFLFSFPTGVMTAIYLEEFAPNNRIMQV 205

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NINNLA++PSI++G+LG ++ INFF +PRS+AL GGL LALMTLP III+T  A+R 
Sbjct: 206 IEVNINNLAAIPSILFGLLGLSIFINFFGVPRSSALAGGLTLALMTLPVIIISTRAAIRA 265

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP SIR  +L LGA++ Q V  +VLPL++P ILTG+ + LA+A+GETAPLL VGM+A++ 
Sbjct: 266 VPDSIREGSLALGATRWQMVLTNVLPLSLPGILTGTIIGLAQAIGETAPLLIVGMMAYIP 325

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           D P   T  AT  P QIY W++D+ R F ERT   I++LL  +  +N   ++LRN+++ +
Sbjct: 326 DAPTSFTSAATVLPAQIYTWSSDSLRAFTERTSAGIIVLLAVMLSMNAVAIYLRNKYETK 385

Query: 425 W 425
           W
Sbjct: 386 W 386


>gi|291287536|ref|YP_003504352.1| phosphate ABC transporter, inner membrane subunit PstA
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290884696|gb|ADD68396.1| phosphate ABC transporter, inner membrane subunit PstA
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 387

 Score =  281 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 161/409 (39%), Positives = 245/409 (59%), Gaps = 38/409 (9%)

Query: 17  SEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMD 76
            E LFRF  + A+++   FL+  L+ I   G  A  QT I + + ++             
Sbjct: 17  QEKLFRFLAMFAIILATSFLVFFLADITRTGYSAFQQTEIQVDVTYNAET-------SKF 69

Query: 77  PAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKT 136
             + +  DY  L+ +   R + +                          +  +P L+  T
Sbjct: 70  THLAVPKDYQRLISRGFLRLIPLE-------------------------IKANPELMNTT 104

Query: 137 VEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASS 196
           V+  ++A+A +D  +K  +        +   Q  + + L ++G + + FN GFF NG S 
Sbjct: 105 VKRWIIATAEVDQYMKDKVNR------LKPDQKAFVESLKANGDVRMSFNTGFFTNGDSK 158

Query: 197 RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVP 256
            PE+AGI  AV+GS+Y++L+ +  S P+G+ +AIYLEEF+   +F+  ++ NINNLA++P
Sbjct: 159 LPEIAGIFSAVIGSVYVLLLTMLFSVPVGVMTAIYLEEFAPDNWFTRTIEVNINNLAAIP 218

Query: 257 SIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
           SI++G+LG A+ INFF +PRS+AL GGL LALMTLP III+T  ALR+VP +IR  A G+
Sbjct: 219 SIIFGLLGLAIFINFFGVPRSSALAGGLTLALMTLPVIIISTRAALRSVPDNIRQGAQGV 278

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATA 376
           GAS  Q V+HHVLPL++P ILTGS + LA+A+GETAPLL +GM+A++ + P G+T+ AT 
Sbjct: 279 GASGWQVVWHHVLPLSLPGILTGSIIGLAQAMGETAPLLIIGMLAYIPEAPGGITEAATV 338

Query: 377 FPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P QIY W+  + R + ERT   I++LL  L V+N   +W+RNRF+++W
Sbjct: 339 LPAQIYTWSGTSLRAYTERTALGIMVLLSVLLVLNACAVWIRNRFERKW 387


>gi|332185334|ref|ZP_08387083.1| phosphate ABC transporter, permease protein PstA [Sphingomonas sp.
           S17]
 gi|332015058|gb|EGI57114.1| phosphate ABC transporter, permease protein PstA [Sphingomonas sp.
           S17]
          Length = 404

 Score =  281 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 158/403 (39%), Positives = 242/403 (60%), Gaps = 15/403 (3%)

Query: 23  FYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLR 82
              + AV +   FL  LL ++V++GI    +T ++LP+  +   +       ++P+ +  
Sbjct: 17  LLGLAAVALSAAFLAFLLITMVAQGIRGFTETKVTLPVNLAHADL------PIEPSRVKG 70

Query: 83  ADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLL 142
              +L +  A       + +     R  + +LS  A   +R  +  DPS++ +TV  +L 
Sbjct: 71  RSADLALAGAGLEDAVATAATMRFGRDGANLLSPGAWLIVRDAIKGDPSILHRTVTFTLP 130

Query: 143 ASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAG 202
            ++  D A KG     A              +L     L   +N+ F  +  ++ P   G
Sbjct: 131 VASPYDVAAKGEGTPDAE---------GVVARLRQQRVLSTGWNWNFLTDADATDPTRVG 181

Query: 203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGI 262
           I  A  GSL  ML+ + L+FP+G+ +A+YLEE++ K  ++  ++ +INNLA+VPSI++G+
Sbjct: 182 IWGAAKGSLLTMLVTLALAFPIGVLAALYLEEYAPKNRWTDLIEVSINNLAAVPSIIFGL 241

Query: 263 LGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQ 322
           LG AV +N F +PRS  LVGGL LALMT+P I+IA   A+++VP SIR AAL +GAS+VQ
Sbjct: 242 LGLAVFLNTFGLPRSAPLVGGLTLALMTMPVIVIAGRNAIKSVPPSIRDAALAIGASRVQ 301

Query: 323 TVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIY 382
            +FHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AF+   P G+TD +T  PVQI+
Sbjct: 302 VIFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFIAAPPRGLTDPSTVLPVQIF 361

Query: 383 LWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           LW+   +R F+E+T  AI++LL+FL  +N   ++LRNRF+ RW
Sbjct: 362 LWSDQVDRGFIEKTSAAIIVLLVFLLAMNGLAIYLRNRFETRW 404


>gi|326387439|ref|ZP_08209048.1| phosphate ABC transporter permease [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208095|gb|EGD58903.1| phosphate ABC transporter permease [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 434

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 153/422 (36%), Positives = 244/422 (57%), Gaps = 17/422 (4%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
              +  L  R++ + LFR+    AV    + L+LLL+S+   G+    +  I L +    
Sbjct: 29  ERMRAGLARRHLDDRLFRWAGFAAVGFSALILVLLLASMSLNGLAGFERYEIRLDLPVKG 88

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
            ++       +DP+ L +      +       L  + +   L    S +++ T       
Sbjct: 89  ELL-------VDPSRLAQPQPLDALEVGGLPALIDAAAERQLGDGGSALIADTGWRDAGA 141

Query: 125 TLMTDPSLIG-KTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFL 183
            L+  P L+  +++ +++ AS  + +A +G                     L + G L  
Sbjct: 142 ELVAHPDLLAARSIPLTVPASDELANAARGSGAPELQARARK---------LMASGVLVH 192

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
            F++GF     ++ P++ GI  A+ GS+  ML+ + L+FP+G+ +A+YLEE++ +  ++ 
Sbjct: 193 SFDWGFLARSDATSPQMVGIWGALKGSIMTMLVTLALAFPVGVLAALYLEEYAPRNRWTD 252

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +INNLA+VPSI++G+LG AV +  F   RS  LVGG+ LALMT+P I+I+   A++
Sbjct: 253 LIEISINNLAAVPSIIFGLLGLAVFLVIFPNDRSAPLVGGMTLALMTMPVIVISGRNAIK 312

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S+R AAL +GAS +Q VFHHVLP+A+P ILTG+ + +ARALGETAPLL +GM AFV
Sbjct: 313 AVPPSLRDAALAVGASPLQVVFHHVLPMALPGILTGTIIGMARALGETAPLLMIGMRAFV 372

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  +T  AT  PVQI+LW+ + +R F+ERT  AI++LL+FL V+N   ++LRNRF+K
Sbjct: 373 ASPPATLTSPATVLPVQIFLWSDEIDRGFIERTSAAIIVLLVFLLVMNGLAIYLRNRFEK 432

Query: 424 RW 425
           RW
Sbjct: 433 RW 434


>gi|189345921|ref|YP_001942450.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           limicola DSM 245]
 gi|189340068|gb|ACD89471.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           limicola DSM 245]
          Length = 387

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 161/425 (37%), Positives = 240/425 (56%), Gaps = 38/425 (8%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           M+S + N +  + R   E  FRFY + A+++   FL+     I+ KG  A   T I   +
Sbjct: 1   MESSTFNDRRKRKRLSRERRFRFYGISAIVMAISFLLFFFVDIIQKGYKAFAMTEIHSEM 60

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
            +S+  V+                                    A        +S +   
Sbjct: 61  VYSQDAVEI--------------------------------PQLAFQEDVRDFVSYSVAR 88

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
            +   L  +PSL+GK V   ++AS  +D   KG +            + +   +L   G 
Sbjct: 89  MIPSDLERNPSLMGKNVVKWVVASDEVDQYAKGSVTRLTED------EQRRIDELKRQGR 142

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           L L FN  FF  G S  PEVAGI  AVVGSLY++ + +  S P+G+ SA+YL+EF+   F
Sbjct: 143 LRLSFNTRFFAAGDSKLPEVAGIFSAVVGSLYVIALTVLFSVPIGVMSALYLQEFAPDNF 202

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            +  ++ NI+NLA++PSI++G+LG ++ INFF +PRS+AL GGL LALMTLP III+T  
Sbjct: 203 LTRLIEVNISNLAAIPSIIFGLLGLSIFINFFGVPRSSALAGGLTLALMTLPVIIISTRA 262

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           ++  VP SIR  A  +GASK+Q V HH+LPLA+P I TG+ + +ARALGETAPLL +GM+
Sbjct: 263 SIGAVPDSIRHGAYAVGASKLQMVLHHLLPLAVPGITTGTIIGIARALGETAPLLIIGMM 322

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           A++ D P G+T+ AT  P QIY W++ ++R FVE+T   I++LL  + ++N   +WLR +
Sbjct: 323 AYIPDIPSGITEAATVLPAQIYTWSSASQRAFVEKTAAGIMVLLAVMLLLNATAIWLRRK 382

Query: 421 FKKRW 425
           ++ +W
Sbjct: 383 YEIKW 387


>gi|315635497|ref|ZP_07890763.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Arcobacter butzleri JV22]
 gi|315480255|gb|EFU70922.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Arcobacter butzleri JV22]
          Length = 359

 Score =  268 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 146/397 (36%), Positives = 222/397 (55%), Gaps = 38/397 (9%)

Query: 29  VLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLL 88
           ++    FL   L  +++KG+ A    ++ + + FS+  +                     
Sbjct: 1   MIFSIAFLAFFLFDMITKGVPAFNVAYVKVDVTFSKESL--------------------- 39

Query: 89  VRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANID 148
                       D+  A+ ++   ++S      +   L  +P  +  T  + +LA   +D
Sbjct: 40  -----------EDTRFAVDKKYRDIVSRAWLRDIPHLLKQNPDYMNTTQNLWVLADDQVD 88

Query: 149 SALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVV 208
             +K +       + + + +     +L S G +   FN  FF NG S  PE AGI  AVV
Sbjct: 89  QYIKNH------NNNLKEKEILLVDELYSQGLIEKKFNAIFFKNGDSKIPEYAGIFSAVV 142

Query: 209 GSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL 268
           GS+  ++I + ++FP+G+ +AIYLEEF+    F+ F++ NINNLA++PSI++G+LG A+ 
Sbjct: 143 GSILTLIITMLVAFPIGVMTAIYLEEFAGDNKFTRFIEININNLAAIPSILFGLLGLAIF 202

Query: 269 INFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHV 328
           IN F MPRS+ LVGGL LALMTLP II+++  ALR VP SIR A  GLG +K+Q    HV
Sbjct: 203 INLFGMPRSSPLVGGLTLALMTLPIIIVSSRAALRAVPDSIRQAGYGLGLNKIQVTRDHV 262

Query: 329 LPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADA 388
           LPLA P ILTGS + LA+A+GETAPL+ +GM+AF+ D P  VT  AT  P Q++ WA   
Sbjct: 263 LPLAFPGILTGSIIGLAQAMGETAPLIIIGMIAFIPDAPTMVTQAATVMPAQLFTWAGMP 322

Query: 389 ERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           E  ++E+T   IL+LL  L  +N   ++LR + + +W
Sbjct: 323 EGMYIEKTAAGILVLLTILISLNAIAIYLRKKLEVKW 359


>gi|126642482|ref|YP_001085466.1| high-affinity phosphate transport protein [Acinetobacter baumannii
           ATCC 17978]
          Length = 386

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 165/389 (42%), Positives = 234/389 (60%), Gaps = 22/389 (5%)

Query: 56  ISLPIEFSETIVDPQ--------------KKRFMD-PAILLRADYNLLVRKALARKLSIS 100
           +++P+ F   ++D                ++R++D    +   D++ L+   +  K    
Sbjct: 1   MNVPVYFDPKVIDAGPVPVRTQGETPAHYQERYVDWQTKMGMVDWDSLIVNGMIAKDPSL 60

Query: 101 DSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--P 158
            S        S + +++  Y LR  +  DPSLIGK   ++ L  AN+D  LKG +    P
Sbjct: 61  ASQRD---YLSSLYASSEAYRLRDMVFADPSLIGKKENLTFLGDANVDVWLKGNIDRSLP 117

Query: 159 ANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPE-VAGIGVAVVGSLYMMLIV 217
            +  ++     K    L + G L   FN   F N  S     ++G+  A +GSL+MMLIV
Sbjct: 118 DDQQQLDPEIRKLADDLKAKGVLENTFNTTLFKNPDSRSSPAISGLAGAFMGSLFMMLIV 177

Query: 218 IGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS 277
           I +S P+G+ASAIYLEEF+ K   +  ++ NINNLA+VPSIV+G+LG+A+ I +  +P S
Sbjct: 178 IIISIPIGVASAIYLEEFAPKNVITDIIEVNINNLAAVPSIVFGLLGAAIFIGWMHLPLS 237

Query: 278 TALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAIL 337
              VGGL+L+LMTLP++II T  +L+ VP SIR AALGLGASKVQTVFHHVLPLA+P I+
Sbjct: 238 APFVGGLVLSLMTLPTVIITTRASLKAVPPSIRQAALGLGASKVQTVFHHVLPLALPGIM 297

Query: 338 TGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RT 396
           TG+ + +A ALGETAPLL +GM AFV   P    D ATA PVQ+YLW  +  R F E RT
Sbjct: 298 TGAIIGVAHALGETAPLLLIGMSAFVASVPTTPFDQATALPVQVYLWQGNELRNFFEGRT 357

Query: 397 FGAILLLLIFLAVINTAMLWLRNRFKKRW 425
             AI++LL  +  +N+  +WLR +F+ RW
Sbjct: 358 AAAIIVLLALMIGLNSLAIWLRKKFEVRW 386


>gi|87200292|ref|YP_497549.1| phosphate ABC transporter permease [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135973|gb|ABD26715.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 428

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 162/403 (40%), Positives = 236/403 (58%), Gaps = 16/403 (3%)

Query: 23  FYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLR 82
           +    AV    + L  LL S+ S G     +T +   I              +D   L +
Sbjct: 42  WLGFAAVAFSAIMLAFLLVSMSSAGFAGFQRTEVKFSIPL-------AGAMQIDAQRLTQ 94

Query: 83  ADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLL 142
            D    +  A   K+    +  AL      ML+  A   +   L+ DPSL+  T++VSL 
Sbjct: 95  PDPVGGLELAGLPKVVDGAAKAALGPDGGDMLAEGAWREVAARLIEDPSLLNGTLDVSLP 154

Query: 143 ASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAG 202
           AS ++ SAL+G   +                KL  +G L   F+ GF     ++ P+  G
Sbjct: 155 ASDDLASALRGEGDASLQQ---------VATKLRGEGKLLRAFDKGFLSRSDATSPQSVG 205

Query: 203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGI 262
           I  A+ GS+  M + + L+FP+G+ +A+YLEE++ K  ++ +++ +INNLA+VPSI++G+
Sbjct: 206 IWGALKGSMLTMFVTLVLAFPVGVLAALYLEEYAPKNRWTEWIEISINNLAAVPSIIFGL 265

Query: 263 LGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQ 322
           LG AV +  F   RS  L+GG+ LALMT+P I+I+   A++ VP SIR AAL +GASKVQ
Sbjct: 266 LGLAVFLALFPHYRSAPLIGGMTLALMTMPVIVISGRNAIKAVPPSIRDAALAIGASKVQ 325

Query: 323 TVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIY 382
            VFHHVLPLA+P ILTG+ + +ARALGETAPLL +GM AFV   P G T  ++  PVQI+
Sbjct: 326 VVFHHVLPLALPGILTGTIIGMARALGETAPLLMIGMRAFVASPPSGFTAPSSVLPVQIF 385

Query: 383 LWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           LW+ + +R FVERT  AI++LL+FL ++N   ++LRNRF+KRW
Sbjct: 386 LWSDEIDRGFVERTSAAIVVLLVFLLLMNGLAIYLRNRFEKRW 428


>gi|144900228|emb|CAM77092.1| ABC-type phosphate transport system [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 309

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 151/298 (50%), Positives = 205/298 (68%), Gaps = 2/298 (0%)

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSL+G T  + L+A  ++D A+KG++     A   R++D Q  W   L+  G +   FN 
Sbjct: 12  PSLLGSTQSIWLVADDDVDMAMKGHITRTAGAEGSRLTDAQLGWLDALEKKGDVAKKFNT 71

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
             F  G S  PE AG+  AVVGS + + I + + FPLG+A+A+YLEEF+ K  ++  ++ 
Sbjct: 72  ALFTVGDSREPEQAGLWGAVVGSFFSLSITLLVCFPLGVATAVYLEEFAPKNRWTDLIEV 131

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPS+V+G+LG A+ +NFF  PRS  LVGGL+LAL++LP+IIIA   A++ VP 
Sbjct: 132 NINNLAAVPSVVFGLLGLAIFLNFFGFPRSAPLVGGLVLALISLPTIIIAGRAAMKAVPP 191

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALGLGASK+Q V  HVLPL+MP ILTG+ + +A ALGETAPLL +GMVAF+ D P
Sbjct: 192 SIREAALGLGASKLQMVTDHVLPLSMPGILTGTILGMAHALGETAPLLMIGMVAFIVDIP 251

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +   PVQ+YLWA   ER FVERT  AI++LL FL ++N   + LR +F++RW
Sbjct: 252 ASPLDPSAVLPVQVYLWADSPERAFVERTSAAIMVLLFFLGMMNVVAILLRKKFERRW 309


>gi|254472027|ref|ZP_05085428.1| phosphate transport system permease protein 2 [Pseudovibrio sp.
           JE062]
 gi|211959229|gb|EEA94428.1| phosphate transport system permease protein 2 [Pseudovibrio sp.
           JE062]
          Length = 615

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 148/298 (49%), Positives = 204/298 (68%), Gaps = 2/298 (0%)

Query: 130 PSLIGKTVEVSLLASANI--DSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           P+ +  T  + L + A +         L +P +  + SD +  +   L S G +   +N 
Sbjct: 318 PTSVTGTAFIPLSSDAAVAAGQWGIEELETPESFRKFSDKEIAYTDYLVSKGTIENQWNS 377

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF +GAS  PE+AGI  A VGS + ML+ + LSFP+G+A+AIYLEEF+ K  ++  ++ 
Sbjct: 378 IFFKSGASREPEMAGIWGAAVGSFWTMLVTLSLSFPIGVAAAIYLEEFAPKNRWTHLIEV 437

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NINNLA+VPSIV+G+LG AV +N F +PRS  +VGG++LALMTLP+IIIA+  AL+ VP 
Sbjct: 438 NINNLAAVPSIVFGLLGLAVFLNVFGLPRSAPVVGGMVLALMTLPTIIIASRAALQAVPP 497

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           SIR AALG+GAS++Q VFHHVLPLAMP ILTG+ + +A+ALGETAPLL +GMVAF+ D P
Sbjct: 498 SIREAALGVGASRLQAVFHHVLPLAMPGILTGTIIGMAQALGETAPLLMIGMVAFIVDIP 557

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
               D +T  PVQI++WA   E  F ++T  AI++LL FL  +N   + LR RF++RW
Sbjct: 558 ASPVDPSTVLPVQIFMWADFPEPAFQQKTSAAIMVLLGFLISMNAIAIVLRKRFERRW 615



 Score =  120 bits (301), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/186 (25%), Positives = 83/186 (44%), Gaps = 9/186 (4%)

Query: 1   MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
           + +    +K LK RY  E  F+ Y + A+ +   FL+LLL +IV  G+ A    ++S+P+
Sbjct: 24  VHTTDEARKRLKKRYSMEARFKAYGIGAIALAATFLVLLLFTIVGTGLPAFTYNYVSVPL 83

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
             S   VDP             A YN ++R  L  +L  + S+    R    ++S+ A  
Sbjct: 84  NLSAEKVDPANPAG--------ASYNKIIRDGLKAELPFA-SDRKNRRVLYSLVSSGANV 134

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
            L+K ++ D S++G T  V++  S   D  +KG +     +   S       +   +  A
Sbjct: 135 ILQKQVVADTSMLGGTGPVAIPLSDFADLYVKGLITQKNEITTTSAATVSGTEGQVTITA 194

Query: 181 LFLDFN 186
              +F 
Sbjct: 195 EKPEFG 200


>gi|148925971|ref|ZP_01809658.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|145844957|gb|EDK22061.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8486]
          Length = 362

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 151/417 (36%), Positives = 227/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L ++N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVMLNLSAILLRKYFQGK 360


>gi|157414897|ref|YP_001482153.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|157385861|gb|ABV52176.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|307747535|gb|ADN90805.1| Phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni M1]
          Length = 362

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 152/417 (36%), Positives = 227/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|153952260|ref|YP_001398147.1| phosphate ABC transporter permease [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939706|gb|ABS44447.1| putative phosphate ABC transporter, permease protein PstA
           [Campylobacter jejuni subsp. doylei 269.97]
          Length = 362

 Score =  244 bits (622), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 153/417 (36%), Positives = 228/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   GIGA  QT+I +    +  + 
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGIGAFKQTYIFVEANRNSPVY 61

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D                                            +LS   +  +R   +
Sbjct: 62  D--------------------------------------------LLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L     + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRALVDDLVQKDEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|86151687|ref|ZP_01069901.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315124135|ref|YP_004066139.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
 gi|85841316|gb|EAQ58564.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315017857|gb|ADT65950.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
          Length = 362

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 151/417 (36%), Positives = 226/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            + S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  AEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|57167644|ref|ZP_00366784.1| probable phosphate transport system permease protein Cj0615
           [Campylobacter coli RM2228]
 gi|57020766|gb|EAL57430.1| probable phosphate transport system permease protein Cj0615
           [Campylobacter coli RM2228]
          Length = 362

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 152/417 (36%), Positives = 226/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNSPSY 61

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D                                            +LS   +  +R   +
Sbjct: 62  D--------------------------------------------LLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|205355465|ref|ZP_03222236.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|205346699|gb|EDZ33331.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8421]
          Length = 362

 Score =  243 bits (620), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 152/417 (36%), Positives = 226/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|57238189|ref|YP_178730.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni RM1221]
 gi|57166993|gb|AAW35772.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni RM1221]
 gi|315058029|gb|ADT72358.1| Phosphate transport system permease protein PstA [Campylobacter
           jejuni subsp. jejuni S3]
          Length = 362

 Score =  243 bits (619), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 151/417 (36%), Positives = 226/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLMQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L ++N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVMLNLSAILLRKYFQGK 360


>gi|86153473|ref|ZP_01071677.1| phosphate ABC transporter, permease protein PstA [Campylobacter
           jejuni subsp. jejuni HB93-13]
 gi|85843199|gb|EAQ60410.1| phosphate ABC transporter, permease protein PstA [Campylobacter
           jejuni subsp. jejuni HB93-13]
          Length = 362

 Score =  242 bits (618), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 149/417 (35%), Positives = 225/417 (53%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNSPSY 61

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D                                            +LS   +  +R   +
Sbjct: 62  D--------------------------------------------LLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            + S         LL ++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  AEKS--------WLLVNSEVDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|121612431|ref|YP_001000317.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167005266|ref|ZP_02271024.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87250397|gb|EAQ73355.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 362

 Score =  242 bits (617), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 150/417 (35%), Positives = 225/417 (53%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNSPSY 61

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D                                            +LS   +  +R   +
Sbjct: 62  D--------------------------------------------LLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            + S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  AEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|114569031|ref|YP_755711.1| phosphate ABC transporter inner membrane subunit PstA [Maricaulis
           maris MCS10]
 gi|114339493|gb|ABI64773.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Maricaulis maris MCS10]
          Length = 580

 Score =  242 bits (617), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 147/289 (50%), Positives = 198/289 (68%), Gaps = 7/289 (2%)

Query: 141 LLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEV 200
           + A+ +    +   + +PA   R+SD    W + L++ GA+   FN   F N  S  PE+
Sbjct: 295 VEATDDWTLYV---IDTPAERRRVSDQLIVWTRALEARGAINAVFNTYLFANADSREPEL 351

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
           AG+  A+ GS+  M+I I +S P+G+ +A+YLEE++ K  F++ ++ NINNLA+VPSIV+
Sbjct: 352 AGVKGALYGSILTMIITIMISVPIGVFTALYLEEYAPKNRFTALIEVNINNLAAVPSIVF 411

Query: 261 GILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
           G+LG AV IN F +PRS  LVGGL+L+LMTLP++IIAT  AL+ VP SIR AAL +GAS+
Sbjct: 412 GLLGLAVFINAFGLPRSAPLVGGLVLSLMTLPTVIIATRAALQAVPQSIRQAALAVGASR 471

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV----GVTDIATA 376
            QTVFHHVLPLA P ILTG+ + LA+ALGETAPLL +GMVAF+ D P     G T  AT 
Sbjct: 472 TQTVFHHVLPLAAPGILTGAIIGLAQALGETAPLLMIGMVAFIADAPTLGLEGFTQPATV 531

Query: 377 FPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            PVQI+LW+  AER F  RT  AIL+LL  +   N   ++LR RF++RW
Sbjct: 532 MPVQIFLWSDGAERAFQARTGAAILVLLALMIGFNALAIYLRRRFERRW 580



 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/151 (27%), Positives = 70/151 (46%), Gaps = 3/151 (1%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
           +  +KNL  RY +E  FR   + AV      LI+LLSSIVS G+ A     ++L ++   
Sbjct: 12  TAVRKNLGARYRAELRFRAAGLGAVATAVGILIILLSSIVSGGLPAFTAHELALTVDLDR 71

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
             VDP+         L R  Y+ +++ A+  +          LR    + +      L  
Sbjct: 72  ETVDPRGDG--SEESLRRGSYSRILQDAMRAEFP-EVQGRRDLRNLFSLYTALNATRLMD 128

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYL 155
            ++ DP+LIG     ++  + ++D  LKG+L
Sbjct: 129 EVLEDPTLIGTRHTFTMPLADDLDLYLKGHL 159


>gi|284925876|gb|ADC28228.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni IA3902]
          Length = 362

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 150/417 (35%), Positives = 225/417 (53%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            + S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  AEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|305433150|ref|ZP_07402306.1| phosphate ABC superfamily ATP binding cassette transporter,
           permease protein [Campylobacter coli JV20]
 gi|304443851|gb|EFM36508.1| phosphate ABC superfamily ATP binding cassette transporter,
           permease protein [Campylobacter coli JV20]
          Length = 362

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 151/417 (36%), Positives = 226/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLMQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|218562266|ref|YP_002344045.1| putative phosphate transport system permease [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|112359972|emb|CAL34761.1| putative phosphate transport system permease protein [Campylobacter
           jejuni subsp. jejuni NCTC 11168]
 gi|315927351|gb|EFV06695.1| phosphate ABC transporter, permease protein PstA [Campylobacter
           jejuni subsp. jejuni DFVF1099]
          Length = 362

 Score =  240 bits (612), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 152/417 (36%), Positives = 226/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLMQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDSTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|88596972|ref|ZP_01100208.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|88190661|gb|EAQ94634.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni 84-25]
          Length = 362

 Score =  239 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 151/417 (36%), Positives = 225/417 (53%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNSPSY 61

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
           D                                            +LS   +  +R   +
Sbjct: 62  D--------------------------------------------LLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            + S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  AEKS--------WLLANSEVDQYMKQKYNR------LSEKQRTLVDDLMQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 304 SSIFDSTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 360


>gi|86149928|ref|ZP_01068157.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85839746|gb|EAQ57006.1| phosphate ABC transporter, permease protein PstA, putative
           [Campylobacter jejuni subsp. jejuni CF93-6]
          Length = 362

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 150/417 (35%), Positives = 227/417 (54%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+  C + + +  +FL + L S+   G  A  QT+I +    +    
Sbjct: 2   KKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS--- 58

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                                     A  +LS   +  +R   +
Sbjct: 59  -----------------------------------------PAYDLLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           T+ S         LLA++ +D  +K           +S+ Q      L   G + L FN 
Sbjct: 78  TEKS--------WLLANSEVDQYMKQKYNR------LSEKQRILVDDLMQKGEIELKFNS 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++ 
Sbjct: 124 NFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F +PRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGIPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             + D  +  P QIY W+A  ER F+ERT   I++LL  L ++N + ++LR  F+ +
Sbjct: 304 SSIFDSTSVLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVMLNLSAIFLRKYFQGK 360


>gi|222823803|ref|YP_002575377.1| phosphate ABC transporter permease [Campylobacter lari RM2100]
 gi|222539025|gb|ACM64126.1| phosphate ABC transporter, permease protein [Campylobacter lari
           RM2100]
          Length = 362

 Score =  238 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 151/417 (36%), Positives = 231/417 (55%), Gaps = 58/417 (13%)

Query: 8   KKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIV 67
           KK  K R  +   F+ +C + + +  +FL + LSS+   GIGA  QT+I           
Sbjct: 2   KKLFKQRKKASKNFKRFCKIGLYINLIFLCVFLSSVGYLGIGAFKQTYIY---------- 51

Query: 68  DPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLM 127
                                             +       + ++LS   +  +R   +
Sbjct: 52  ----------------------------------TQADRNSPSYELLSRAEQRKIRTGQI 77

Query: 128 TDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
            + S         LLA++ +D  +K         +++SD Q K   +L     + L FN 
Sbjct: 78  KEKS--------WLLANSEVDQYMKKNY------NKLSDEQKKLVDELVQKQEIKLSFNT 123

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF+NG S  PE +GI  +VVG+L +ML+ + +S P+G+ +AIYLEEF+ +  F+ F++ 
Sbjct: 124 NFFLNGDSKSPENSGIFASVVGTLLVMLVCMAVSIPIGVGAAIYLEEFAPQNVFTHFIEV 183

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLAS+PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  
Sbjct: 184 CINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDI 243

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           ++++AA  LG +K+Q +   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D  
Sbjct: 244 NMKNAAYALGMTKIQMIKGIMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVA 303

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             V    +  P QI+ W+A  ER F+ERT   I++LL  L ++N A + LR  F+ +
Sbjct: 304 NSVFAPTSVLPAQIFSWSAMPERAFLERTAAGIIVLLSLLVILNLAAILLRRYFQGK 360


>gi|58699112|ref|ZP_00373943.1| phosphate ABC transporter, permease protein PstA [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630683|ref|YP_002727474.1| phosphate ABC transporter, permease protein [Wolbachia sp. wRi]
 gi|58534372|gb|EAL58540.1| phosphate ABC transporter, permease protein PstA [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592664|gb|ACN95683.1| phosphate ABC transporter, permease protein [Wolbachia sp. wRi]
          Length = 416

 Score =  233 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 134/417 (32%), Positives = 214/417 (51%), Gaps = 21/417 (5%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
               +K +       RF    A+++     + +L SI+     AL  T I LP+E +  +
Sbjct: 16  VHARIKRKNKKNRALRFCSFTALVISLGCPVCILLSILVNSYSALTVTKILLPVEINADL 75

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTL 126
                   +    +       L+  +L +    +D      +   ++LS  +   L K  
Sbjct: 76  ALASNPSDLRYKSI------GLLNDSLRKVFGGTDF-----KDGDEILSRNSYKELEKFF 124

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                  G+  E+   AS+ I+S  K           ++D   K    L     +   FN
Sbjct: 125 RKKVKDSGEY-EIWFTASSIINSINK--------DKYLNDRYAKLLDWLKEKRRVKKFFN 175

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF-SSFV 245
              F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  K    ++ V
Sbjct: 176 KSLFLKSDSREPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPKNRLMTNIV 235

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + +INNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A   V
Sbjct: 236 EISINNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNAFANV 295

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVAF+ D
Sbjct: 296 PITIKDAAFALGAPHIKVILDHSLPIALPRIIHGTVLAIARILGESSPLLMMGMVAFIAD 355

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
            P    D AT  PVQIY+W+++ E  FVE    AI+ LL+ L  +N    +++ +F+
Sbjct: 356 TPTSFFDPATVLPVQIYIWSSNPEIAFVELAAIAIIALLLVLFALNLVANFVKRKFE 412


>gi|225631219|ref|ZP_03787913.1| phosphate ABC transporter, permease protein [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
 gi|225591082|gb|EEH12270.1| phosphate ABC transporter, permease protein [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
          Length = 417

 Score =  232 bits (592), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 134/417 (32%), Positives = 213/417 (51%), Gaps = 21/417 (5%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
               +K +       RF    A+++     + +L SI+     AL  T I LP+E +  +
Sbjct: 17  VHARIKRKNKKNRALRFCSFTALVISLGCPVCILLSILVNSYSALTVTKILLPVEINADL 76

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTL 126
                        +       L+  +L +    +D      +   ++LS  +   L K  
Sbjct: 77  ALASNPSDFRYKSV------GLLNDSLRKVFGGTDF-----KDGDEILSRNSYKELEKFF 125

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                  G+  E+   AS+ I+S  K           ++D   K    L     +   FN
Sbjct: 126 RKKVKDSGEY-EIWFTASSIINSINK--------DKYLNDRYAKLLDWLKEKRRVKKFFN 176

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF-SSFV 245
              F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  K    ++ V
Sbjct: 177 KSLFLKSDSREPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPKNRLMTNIV 236

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + +INNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A   V
Sbjct: 237 EISINNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNAFANV 296

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVAF+ D
Sbjct: 297 PITIKDAAFALGAPHIKVILDHSLPIALPRIIHGTVLAIARILGESSPLLMMGMVAFIAD 356

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
            P    D AT  PVQIY+W+++ E  FVE    AI+ LL+ L  +N    +++ +F+
Sbjct: 357 TPTSFFDPATVLPVQIYIWSSNPEIAFVELAAIAIIALLLVLFALNLVANFVKRKFE 413


>gi|99034180|ref|ZP_01314263.1| hypothetical protein Wendoof_01000943 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 409

 Score =  232 bits (591), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 127/389 (32%), Positives = 198/389 (50%), Gaps = 21/389 (5%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
               +K +       RF    A+++     + +L SI+     AL  T I LP+E +  +
Sbjct: 16  VHARIKRKNKKNRALRFCSFTALVISLGCPVCILLSILVNSYSALTVTKILLPVEINADL 75

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTL 126
                   +    +       L+  +L +    +D      +   ++LS  +   L K  
Sbjct: 76  ALASNPSDLRYKSI------GLLNDSLRKVFGGTDF-----KDGDEILSRNSYKELEKFF 124

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                  G+  E+   AS+ I+S  K           ++D   K    L     +   FN
Sbjct: 125 RKKVKDSGEY-EIWFTASSIINSINK--------DKYLNDRYAKLLDWLKEKRRVKKFFN 175

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF-SSFV 245
              F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  K    ++ V
Sbjct: 176 KSLFLKSDSREPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPKNRLMTNIV 235

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +  INNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A   V
Sbjct: 236 EIGINNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNAFANV 295

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVAF+ D
Sbjct: 296 PITIKDAAFALGAPHIKVILDHSLPIALPRIIHGTVLAIARILGESSPLLMMGMVAFIAD 355

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVE 394
            P    D AT  PVQIY+W+++ E  FVE
Sbjct: 356 TPTSFFDPATVLPVQIYIWSSNPEIAFVE 384


>gi|42520829|ref|NP_966744.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42410569|gb|AAS14678.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 416

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 133/417 (31%), Positives = 213/417 (51%), Gaps = 21/417 (5%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
               +K +       RF    A+++     + +L SI+     AL  T I LP+E +  +
Sbjct: 16  VHARIKRKNKKNRALRFCSFTALVISLGCPVCILLSILVNSYSALTVTKILLPVEINADL 75

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTL 126
                   +    +       L+  +L +    +D      +   ++LS  +   L K  
Sbjct: 76  ALASNPSDLRYKSI------GLLNDSLRKVFGGTDF-----KDGDEILSRNSYKELEKFF 124

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                  G+  E+   AS+ I+S  K           ++D   K    L     +   FN
Sbjct: 125 RKKVKDSGEY-EIWFTASSIINSINK--------DKYLNDRYAKLLDWLKEKRRVKKFFN 175

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF-SSFV 245
              F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  K    ++ V
Sbjct: 176 KSLFLKSDSREPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPKNRLMTNIV 235

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + +INNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A   V
Sbjct: 236 EISINNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNAFANV 295

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVAF+ D
Sbjct: 296 PITIKDAAFALGAPHIKVILDHSLPIALPRIIHGTVLAIARILGESSPLLMMGMVAFIAD 355

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
            P    D AT   VQIY+W+++ E  FVE    AI+ LL+ L  +N    +++ +F+
Sbjct: 356 TPTSFFDPATVLSVQIYIWSSNPEIAFVELAAIAIIALLLVLFALNLVANFVKRKFE 412


>gi|114799902|ref|YP_760729.1| phosphate ABC transporter permease PtsA [Hyphomonas neptunium ATCC
           15444]
 gi|114740076|gb|ABI78201.1| phosphate ABC transporter, permease protein PtsA [Hyphomonas
           neptunium ATCC 15444]
          Length = 525

 Score =  228 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 133/271 (49%), Positives = 184/271 (67%)

Query: 155 LYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMM 214
           +  P     +SD Q  W   L   G +     +    +  S+ PE+AG   A+VGSL+ M
Sbjct: 255 IALPEAQRVVSDQQIAWTLALQEMGRISRVPRWSLLTHSDSTYPELAGGLAALVGSLFTM 314

Query: 215 LIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM 274
           L+   ++ P+GI +A+YLEEF+ K   + F++ NINNLA+VPSIV+G+LG+AV INF  M
Sbjct: 315 LVTALVAIPIGILAAVYLEEFAPKNRLTDFIEVNINNLAAVPSIVFGLLGAAVYINFLGM 374

Query: 275 PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMP 334
           PRS  LVGGL+LALMT P +IIA   AL+ VP S+RS AL +GAS++QTVFHHV+PLA P
Sbjct: 375 PRSAPLVGGLVLALMTFPVVIIAARAALKAVPPSVRSGALAIGASQMQTVFHHVVPLAAP 434

Query: 335 AILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE 394
            ILTG+ + +ARALGETAPLL +GMVAFV D P   TD +T  PV I+ W+ +AER +  
Sbjct: 435 GILTGAILGMARALGETAPLLLIGMVAFVGDVPSSPTDESTVMPVLIFSWSNNAERAWEP 494

Query: 395 RTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            T   I++LL  L ++N  +++LR ++++RW
Sbjct: 495 MTSAMIVILLAVLLLMNGLVVFLRRKYERRW 525



 Score =  104 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/154 (24%), Positives = 64/154 (41%)

Query: 9   KNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD 68
           K LK R  S+  FR Y + A+ +    L++L  SI S+ I A         I     ++ 
Sbjct: 16  KRLKRRRASDVRFRLYGMGAIFLALGALVMLALSIGSQAISAATYHVARYDITLDPAVIA 75

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
           P  +   +        +  LVR  L      SD + A   + S+ ++  A     + +  
Sbjct: 76  PPGENTPEEIARNVDGFWELVRDNLIATFPESDRDRATRLEVSEFITRLAVLPAARKVAA 135

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYSPANVH 162
            P LIG  +E++   + ++D  LKG  ++   V 
Sbjct: 136 RPQLIGNEIELAAPLNDDLDLYLKGQAFAERRVR 169


>gi|83859332|ref|ZP_00952853.1| probable phosphate ABC transporter, permease protein (PstA)
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852779|gb|EAP90632.1| probable phosphate ABC transporter, permease protein (PstA)
           [Oceanicaulis alexandrii HTCC2633]
          Length = 581

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 147/287 (51%), Positives = 195/287 (67%), Gaps = 4/287 (1%)

Query: 143 ASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAG 202
           AS + ++     + +P+   R++D Q  W + L   G +    N   F N  S  PE+AG
Sbjct: 295 ASDSAETWSLWVIETPSIARRITDRQIVWARTLKERGLIRNGLNTTLFTNADSREPELAG 354

Query: 203 IGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGI 262
           +  A+ GS+  M++ + L+ P+G+ +AIYLEEF+ K   + F++ NINNLA+VPSIV+G+
Sbjct: 355 VAGALAGSILTMIVTMLLAVPIGVGAAIYLEEFAPKNRLTDFIEVNINNLAAVPSIVFGL 414

Query: 263 LGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQ 322
           LG AV IN F MPRS  LVGG++LALMTLP++II+   AL+ VP SIR AALG+GAS+ Q
Sbjct: 415 LGLAVFINLFGMPRSAPLVGGMVLALMTLPTVIISARAALKAVPPSIREAALGVGASRTQ 474

Query: 323 TVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV----GVTDIATAFP 378
            VFHHVLPLAMP ILTGS + LA+ALGETAPLL +GMVAF+ D P     G T+ AT  P
Sbjct: 475 AVFHHVLPLAMPGILTGSIIGLAQALGETAPLLMIGMVAFIADPPTLGLSGFTEPATVMP 534

Query: 379 VQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           VQIY+W++ AER F  RT  AIL LL  L   N   ++LR RF++RW
Sbjct: 535 VQIYIWSSSAERAFEARTAAAILALLTLLVSFNAVAIYLRRRFERRW 581



 Score =  122 bits (306), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/156 (23%), Positives = 71/156 (45%), Gaps = 3/156 (1%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
              +  L  R+ +E  F+FY + A+    +FL +LL S++ + + A     + L ++   
Sbjct: 9   DAVQARLAKRHRAEQRFQFYGLAAISAAVLFLAVLLGSLIIQSVPAFTAHKLVLDVDIRP 68

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
            I DP+       A L R  YN L++ +L  +   + S  + +R+   + S      L  
Sbjct: 69  EIADPRG--DASEASLRRGSYNTLIQNSLWAQFPEAGS-VSEMRELFGLYSAVNAARLLN 125

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPAN 160
            ++ +P ++G+T+  +L  S + D  LKG       
Sbjct: 126 EVVNNPDVLGETIRFTLPISDDADLYLKGLTTEEEF 161


>gi|190571278|ref|YP_001975636.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213018673|ref|ZP_03334481.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|190357550|emb|CAQ54987.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995624|gb|EEB56264.1| phosphate ABC transporter, permease protein, putative [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 417

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 134/417 (32%), Positives = 216/417 (51%), Gaps = 21/417 (5%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
               +K +     +  F    A++V     I +L SI+     AL  T I LP+E +  +
Sbjct: 17  VHARVKRKNKKNNILCFCSFTALIVSIGCPICILLSILVNSYSALTVTKILLPVEINADL 76

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTL 126
           +       +    +       L+  +L +    +D      +   ++LS  +   L K  
Sbjct: 77  ILTNNPGDLRYKSI------GLLNNSLRKVFEGTDF-----KDGDEILSRNSYKELEKFF 125

Query: 127 MTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN 186
                  G+  E+   AS+ I+S  K           ++D+  K    L   G +   FN
Sbjct: 126 HKKVKDSGEY-EIWFTASSIINSINK--------YKHLNDHYAKLLDWLKEKGRVRKFFN 176

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF-SSFV 245
              F+   S  PE AGI  A +GSL  +++ + L+ P+GI S I L EF  +    +S V
Sbjct: 177 KSLFLKSDSCEPENAGILGAFIGSLMTIIVCLALALPIGIMSGICLYEFMPRNRLITSIV 236

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + ++NNLA+VPSI++G++G  + +  F +PRS+ LVGG+ L+ M LP+IIIAT  A   V
Sbjct: 237 EISMNNLAAVPSIIFGVVGLTLYLGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNAFTNV 296

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVAF+ D
Sbjct: 297 PIAIKDAAFALGAPHIKVILDHSLPIALPRIIHGAVLAIARILGESSPLLMIGMVAFIAD 356

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
            P    D AT  PVQIY+W++  E  F+E    AI+ LL+ L  +N    +++ +F+
Sbjct: 357 TPTSFFDPATVLPVQIYIWSSSPEIAFIELAAIAIIALLLMLFALNLIANFVKRKFE 413


>gi|68171174|ref|ZP_00544581.1| Binding-protein-dependent transport systems inner membrane
           component [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657651|ref|YP_507307.1| putative phosphate ABC transporter, permease protein [Ehrlichia
           chaffeensis str. Arkansas]
 gi|67999405|gb|EAM86047.1| Binding-protein-dependent transport systems inner membrane
           component [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599108|gb|ABD44577.1| putative phosphate ABC transporter, permease protein [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 422

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 135/417 (32%), Positives = 224/417 (53%), Gaps = 17/417 (4%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
               +  +   + +     + A++     L ++L SIV+ G  AL  T I L I  +   
Sbjct: 16  IASRISLKNRKDRILSILSMTALVSSLGILFIILGSIVNNGYNALTTTKILLSITINNDT 75

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLS--ISDSNHALLRQASQMLSTTARYHLRK 124
           ++ Q K  +      R +    + ++L    S  I  SN    +    +++ TA ++L  
Sbjct: 76  IEQQDKLTL------RNNLIYFIHQSLEELFSNVIDLSNPDNRKIIYNIINDTAHHNLAD 129

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            L+ +P        +   +S   + A+K       N +       K   KL ++  + + 
Sbjct: 130 FLLKNPK--STKFNIWFQSSTTFNKAIK-------NKNINHAIYQKVIAKLQNENRIKVS 180

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN   F    S  PE  GI  +++GS++ ++I +  + P+GI S I L E   K   SS 
Sbjct: 181 FNDALFTKYNSRSPENTGILGSLIGSMFTIIICLTFALPIGITSGICLSELIPKNKISSI 240

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ +I NLASVPSI++GILG A+ IN F +PRS+AL+GG+ L+LM LP+++ +T  A   
Sbjct: 241 IEISITNLASVPSIIFGILGLAIYINIFDIPRSSALIGGMTLSLMMLPNLVTSTKQAFAA 300

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S++ AA  LGAS +Q + HH  P+A+P+I+ G+ +S+AR LGE++PL+ +GMVAF+ 
Sbjct: 301 VPPSVKDAAFSLGASNMQVILHHSFPIALPSIMQGAILSIARILGESSPLIMIGMVAFIV 360

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           D P    D  T  PVQIY+WA++    F++    AI+ LL+ L ++N  + ++R +F
Sbjct: 361 DIPKDFLDPTTVLPVQIYMWASNPHIEFIQLAAIAIVALLLMLLILNLIVTFIRKKF 417


>gi|315931816|gb|EFV10771.1| phosphate ABC transporter, permease protein PstA [Campylobacter
           jejuni subsp. jejuni 327]
          Length = 342

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 146/398 (36%), Positives = 219/398 (55%), Gaps = 58/398 (14%)

Query: 27  VAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYN 86
           + + +  +FL + L S+   G  A  QT+I +    +                       
Sbjct: 1   MGLYINLIFLCIFLGSVAYLGFPAFKQTYIFVEANRNS---------------------- 38

Query: 87  LLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASAN 146
                                  A  +LS   +  +R   +T+ S         LLA++ 
Sbjct: 39  ----------------------PAYDLLSRAEQRKIRTGQITEKS--------WLLANSE 68

Query: 147 IDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVA 206
           +D  +K           +S+ Q      L   G + L FN  FF+NG S  PE +GI  +
Sbjct: 69  VDQYMKQKYNR------LSEKQRTLVDDLVQKGEIELKFNSNFFLNGDSKSPENSGILSS 122

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           VVG+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++  INNLAS+PSI++G+LG  
Sbjct: 123 VVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNILTHFIEVCINNLASIPSILFGLLGLG 182

Query: 267 VLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFH 326
           V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  ++++AA  LG +KVQ V  
Sbjct: 183 VFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDINMKNAAYALGMTKVQMVKG 242

Query: 327 HVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA 386
            +LPLAMP ILTGS ++LA+A+GETAPL+ +GM+AF+ D    + D  +  P QIY W+A
Sbjct: 243 IMLPLAMPMILTGSILTLAQAIGETAPLMIIGMIAFIPDVASSIFDPTSVLPAQIYSWSA 302

Query: 387 DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 MPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 340


>gi|283956028|ref|ZP_06373517.1| putative phosphate ABC transporter, permease protein PstA
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792504|gb|EFC31284.1| putative phosphate ABC transporter, permease protein PstA
           [Campylobacter jejuni subsp. jejuni 1336]
          Length = 342

 Score =  224 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 149/398 (37%), Positives = 222/398 (55%), Gaps = 58/398 (14%)

Query: 27  VAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYN 86
           + + +  +FL + L S+   GIGA  QT+I +    +  + D                  
Sbjct: 1   MGLYINLIFLCIFLGSVGYLGIGAFKQTYIFVEANRNSPVYD------------------ 42

Query: 87  LLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASAN 146
                                     +LS   +  +R   +T+ S         LLA++ 
Sbjct: 43  --------------------------LLSRAEQRKIRTGQITEKS--------WLLANSE 68

Query: 147 IDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVA 206
           +D  +K           +S+ Q      L   G + L FN  FF+NG S  PE +GI  +
Sbjct: 69  VDQYMKQKYNR------LSEKQRALVDDLVQKGEIELKFNSNFFLNGDSKSPENSGILSS 122

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           VVG+L +ML+ + +S P+G+A+AIYLEEF+ +  F+ F++  INNLAS+PSI++G+LG  
Sbjct: 123 VVGTLLVMLVCMVVSVPIGVAAAIYLEEFAPQNLFTHFIEVCINNLASIPSILFGLLGLG 182

Query: 267 VLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFH 326
           V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  ++++AA  LG +KVQ V  
Sbjct: 183 VFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDINMKNAAYALGMTKVQMVKG 242

Query: 327 HVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA 386
            +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D    + D  +  P QIY W+A
Sbjct: 243 IMLPLAMPMILTGSILTLAGAIGETAPLMIIGMIAFIPDVASSIFDPTSVLPAQIYSWSA 302

Query: 387 DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 303 MPERAFLERTAAGIIVLLGLLVVLNLSAILLRKYFQGK 340


>gi|148658244|ref|YP_001278449.1| phosphate ABC transporter inner membrane subunit PstA [Roseiflexus
           sp. RS-1]
 gi|148570354|gb|ABQ92499.1| phosphate ABC transporter, inner membrane subunit PstA [Roseiflexus
           sp. RS-1]
          Length = 424

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 128/430 (29%), Positives = 210/430 (48%), Gaps = 42/430 (9%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
             +N+  R +   +++   V ++++  + L  L+ +IV +  G     +I++     +T 
Sbjct: 22  INRNIAARRLRGAIWQAIFVSSLIIGLLALATLIYTIVDETFG-----YIAV-----QTK 71

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL-RKT 125
           +DP++   +     L       + + L   +S          +     S  +   L  + 
Sbjct: 72  IDPEELEELTDGRPLEELSKEELIEILRANVSAGLFRRFDRDEPFSERSKESVLQLVEER 131

Query: 126 LMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
           ++    +    +  SLL    I++ ++                                 
Sbjct: 132 VVGREVVAAYKLTESLLERERIEATVRERFPRA-------------------KLEFHSWI 172

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F     SS P +AG+G A++GSL+++ I + L+ P+GI   +YLEE++   ++   +
Sbjct: 173 NREFLTRPMSSVPLLAGVGNAILGSLWVIAITMLLAIPIGILGGVYLEEYASDTWYYRLI 232

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTA------------LVGGLILALMTLPS 293
           + NINNLA VPSI+YGILG AV +   +   S A            L  GL +AL+ LP 
Sbjct: 233 ETNINNLAGVPSIIYGILGLAVFVRALEALTSGAMFGVTDSNGRTILSAGLTMALLVLPL 292

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +II    A+R VP S+R A+ GLGA+K QTV+HHVLP A+P ILTG+ +S++RA+GETAP
Sbjct: 293 MIINAREAIRAVPQSLRQASYGLGATKWQTVWHHVLPNALPGILTGTILSVSRAMGETAP 352

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           L+ +G   FV  +P  V D  T  P+QIY W +     F      AI++LL+ L  +N  
Sbjct: 353 LIVIGASTFVVFFPDSVFDKFTVIPIQIYNWTSQPGAQFRSIAAAAIIVLLVTLLALNAT 412

Query: 414 MLWLRNRFKK 423
            + LRNR ++
Sbjct: 413 AILLRNRLRR 422


>gi|58584491|ref|YP_198064.1| ABC-type phosphate transport system, permease component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418807|gb|AAW70822.1| ABC-type phosphate transport system, permease component [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 416

 Score =  223 bits (567), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 129/415 (31%), Positives = 212/415 (51%), Gaps = 21/415 (5%)

Query: 9   KNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVD 68
            ++K +   +        + +++     + +L SI+     AL  T I LPIE +     
Sbjct: 18  AHIKRKNKKDKALYSCSFMTLVISLSCPVCILLSILINSYSALTVTKILLPIEINTDFAL 77

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
                 +    +   +       +L +    +D      +   ++LS  +   L   +  
Sbjct: 78  ADNPSNLRYKSINSLN------DSLRKIFKGTDF-----KSGEEILSRNSYKELENFVRR 126

Query: 129 DPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG 188
                G+  E+   AS+ I+S  KG           + +  +    L   G +   FN  
Sbjct: 127 KVKHNGEY-EIWFTASSIINSINKG--------KYFNSHYVELLSWLKKQGRVGKFFNRS 177

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKG-FFSSFVQA 247
            F+   S  PE AGI  A +GSL  +++ + L+ P GI S I L EF  +    ++ ++ 
Sbjct: 178 LFLKSDSREPENAGILGAFIGSLMTIMVCLALALPAGIMSGICLHEFMPRNSMITNVIEV 237

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           +INNLA+VPSI++G++G  + +  F++PRS+ LVGG+ L+ M LP+IIIAT  A   V  
Sbjct: 238 SINNLAAVPSIIFGVVGLTLYLGIFELPRSSPLVGGMTLSFMMLPNIIIATKNAFANVSI 297

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           +I+ AA  LGA  ++ +  H LP+A+P I+ G+ +++AR LGE++PLL +GMVAF+TD P
Sbjct: 298 TIKDAAFALGAPHIRVILDHSLPIALPRIIHGTMLAVARVLGESSPLLMIGMVAFITDTP 357

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
               D AT  PVQIY+W++  E  FVE    AI+ LLI L  +N    +++ +F+
Sbjct: 358 RSFFDPATVLPVQIYIWSSSPEIAFVELAAIAIIALLIVLFALNLVANFVKRKFE 412


>gi|167950178|ref|ZP_02537252.1| phosphate ABC transporter, permease protein PstA [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 356

 Score =  222 bits (565), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 135/245 (55%), Gaps = 5/245 (2%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           +    K +L  RY  E  F+   + AV V  +F+  L  SIVSKG  A WQT I L I F
Sbjct: 11  ATEKVKASLAARYRRERRFKAIGIGAVCVGLLFVSFLFVSIVSKGYTAFWQTQIRLDIHF 70

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
              ++DP   R  D   L  ADY  L++++L ++      N    R   +++S+ A + L
Sbjct: 71  DAAVIDPSGNR--DLTELGHADYASLIKQSLRKRFP-EVKNRREKRTLYKLVSSGAAFDL 127

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGA 180
           R  ++ DP LIG    + LLA  ++D  +KG +    P N  R+ D    W   L + GA
Sbjct: 128 RARVLADPDLIGTRQTLWLLADDDLDMLVKGQIDRSLPENERRLKDQVIGWIDALSAQGA 187

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           + L FN  FF NG S  PE AGIG A++GSLY +LI + L+FP+G+A+++YLEEF+ +  
Sbjct: 188 VELKFNSTFFTNGDSREPEQAGIGGALMGSLYTLLITLLLAFPIGVATSVYLEEFAPRNC 247

Query: 241 FSSFV 245
           ++  +
Sbjct: 248 WTDLI 252


>gi|88607119|ref|YP_504976.1| phosphate ABC transporter, permease protein PtsA [Anaplasma
           phagocytophilum HZ]
 gi|19880590|gb|AAM00409.1|AF392616_4 phosphate ABC transporter [Anaplasma phagocytophilum]
 gi|88598182|gb|ABD43652.1| phosphate ABC transporter, permease protein PtsA [Anaplasma
           phagocytophilum HZ]
          Length = 448

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 142/410 (34%), Positives = 219/410 (53%), Gaps = 22/410 (5%)

Query: 14  RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKR 73
           R   +  F    + A+ +    L+L+L SIV+ G  AL  T I L ++          + 
Sbjct: 54  RSKQDRFFSLLSLSALGISVGMLMLVLCSIVNNGYKALTATKILLHLD--------DTES 105

Query: 74  FMDPAILLRADYNLLVRKALARKLS--ISDSNHALLRQASQMLSTTARYHLRKTLMTDPS 131
               +   R D    +  AL + LS  +  +N    R A  ++S TA Y L   +    +
Sbjct: 106 IRKDSEYFREDCIKRIHSALDKILSSHVDLNNPETKRIAYSIVSETAHYELADLI--QKN 163

Query: 132 LIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFI 191
           +      + L AS    S +K           +S    K F+  +     F  FN   F 
Sbjct: 164 VRISPDGLWLNASTEFLSGVKNN--------EISSVVLKTFEDQERIKRSF--FNKSLFT 213

Query: 192 NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINN 251
           N  S  PE AGI  A++GSL  +++ + ++ PLGI + I ++E       SS ++ +INN
Sbjct: 214 NSHSKVPENAGILGALIGSLLTIIVCLAIAIPLGIMTGICMQELLSNNKVSSIIEISINN 273

Query: 252 LASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRS 311
           L+SVPSI++G+LG  V +N F +PRS++L GG+ L++M LP +I+ T  AL  VP S++ 
Sbjct: 274 LSSVPSIIFGVLGLVVYLNIFGVPRSSSLAGGMTLSIMILPYLILTTRQALAAVPESVKH 333

Query: 312 AALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVT 371
           AAL LGA+ +Q + HH LP+A PA++ G  VS+AR +GE++PL+ +GMVAFV D P    
Sbjct: 334 AALSLGATNMQVIMHHSLPIAFPALVQGVLVSVARIIGESSPLIMIGMVAFVIDLPKTFL 393

Query: 372 DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           D A+  PVQIY+WA ++   F + +  AIL LL+ L V+N    +++ R 
Sbjct: 394 DPASVLPVQIYIWANNSSAEFTKISAIAILALLMILLVLNMIAAFIKRRL 443


>gi|254796836|ref|YP_003081673.1| phosphate ABC transporter, permease protein PstA [Neorickettsia
           risticii str. Illinois]
 gi|254590061|gb|ACT69423.1| phosphate ABC transporter, permease protein PstA [Neorickettsia
           risticii str. Illinois]
          Length = 397

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 130/397 (32%), Positives = 192/397 (48%), Gaps = 28/397 (7%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           + S  +  L  R  +   F F CV    +  VFL +LL S  S    AL QT  ++ +  
Sbjct: 2   NISYLRLKLNTRSFTNRFFSFMCVFCAFLPVVFLFVLLFSTFSGAYKALQQTKFAVDL-- 59

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
                        +   +   +    +R+     L                 S  A   +
Sbjct: 60  -------------EKVGVASGNSRYEIREKFISYLKDQLPWEEDPFTIMNFFSNYAVDEV 106

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
            + L           +V    S   D+  K         H  S    K  Q     G L 
Sbjct: 107 LEALNV------GEKKVWTTISGEADTVHK-------YGHSGSPGMKKVVQYFSEHGLLK 153

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
             FNY  FIN  S     AGI  A++GSLY + + + +SF +G+ +A++L E+S +   +
Sbjct: 154 KAFNYKLFINPDSRDSSQAGIVGALIGSLYTVFVSLLVSFFIGVLTALWLGEYSSRSSIT 213

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ +INNL+S P IV+GILG    INF  +PRS++LVGGL LA +  P ++ ++  A+
Sbjct: 214 RVLEVSINNLSSTPPIVFGILGLTFYINFLGLPRSSSLVGGLTLAFIMFPILVTSSLHAI 273

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+VP +I+ AA  LGASKVQ + HHVLP++MP I+TG+ + +AR LGE+APLL +GM AF
Sbjct: 274 RSVPDNIKQAAFALGASKVQVILHHVLPISMPGIMTGTILGIARILGESAPLLMIGMAAF 333

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA 399
           V   P  + + A  F VQIY+WA   +    E+T   
Sbjct: 334 VGSIPESIKEPANVFAVQIYIWATSPDVSTNEKTSIM 370


>gi|73667154|ref|YP_303170.1| binding-protein dependent transport system inner membrane protein
           [Ehrlichia canis str. Jake]
 gi|72394295|gb|AAZ68572.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Ehrlichia canis str. Jake]
          Length = 421

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 133/417 (31%), Positives = 219/417 (52%), Gaps = 18/417 (4%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
               +  +   + +     + A++     L ++L SIV+ G  AL  T I L I+ +   
Sbjct: 16  IASRISLKNRKDRILSTLSMSALISSLGILFIILGSIVNNGYNALTTTTILLSIKIN--- 72

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSI--SDSNHALLRQASQMLSTTARYHLRK 124
                       ++LR++    + ++L    S     SN    +    ++S TA ++L  
Sbjct: 73  ----DNIEQQDKLILRSNLINYIHQSLEELFSDVIDTSNLDNKKIIYSIVSDTAHHNLAD 128

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
            +  +P        +   +S   +  +             +    K   KL ++  +   
Sbjct: 129 FVFKNPK--ANKFNMWFKSSTTFNKII-------QTQSTDNTIYKKIITKLQNEHRIKKS 179

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           FN   F    S  PE  GI  +++GS++ ++I +  +FP+GI S I L E   K   SS 
Sbjct: 180 FNDTLFKKYNSISPENTGIIGSLIGSMFTIIICLAFAFPIGITSGICLSELIPKNKISSI 239

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ +I NLASVPSI++GILG A+ I  F +PRS+AL+GG+ L+LM LP+++IAT  A   
Sbjct: 240 IEISITNLASVPSIIFGILGLAIYIKIFNIPRSSALIGGMTLSLMMLPNLVIATKQAFTA 299

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VPSS++ AA  LGAS +Q + HH  P+A+P I+ G+ +S+AR LGE++PL+ +GMVAF+ 
Sbjct: 300 VPSSVKDAAFSLGASNMQVILHHSFPIALPGIMQGAILSIARILGESSPLIMIGMVAFIV 359

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           D P    D  T  PVQIY+WA++    F++    AI+ LL+ L ++N  + ++R +F
Sbjct: 360 DIPKNFLDPTTVLPVQIYMWASNPHIEFIQLAAIAIVALLLMLLILNLIVTFIRKKF 416


>gi|56416925|ref|YP_153999.1| phosphate ABC transporter [Anaplasma marginale str. St. Maries]
 gi|56388157|gb|AAV86744.1| phosphate ABC transporter [Anaplasma marginale str. St. Maries]
          Length = 461

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 146/411 (35%), Positives = 227/411 (55%), Gaps = 24/411 (5%)

Query: 14  RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE-TIVDPQKK 72
           R   + L     + A+ +    L+L+L SIV+ G  AL  T I L   F +   +DP   
Sbjct: 67  RSKKDRLLSVLSLGALGISVGMLVLVLCSIVNNGYKALTTTKILLS--FDQIEHIDPGDS 124

Query: 73  RFMDPAILLRADYNLLVRKALARKL--SISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            F D  I         ++ AL + +  S+  SN    R A  ++S TA Y+    +    
Sbjct: 125 GFRDVCI-------QHIQGALEKIVQNSVDLSNPETRRIAHSIISETAHYNFAHLIEKGT 177

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
           SL      V   AS++  S+  G           ++      +KL ++  +   FN   F
Sbjct: 178 SLSNA--SVWFNASSDFVSSTPGS----------NEVYDAIMRKLVAENRIKRFFNSALF 225

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
            N  S  PE AGI  A++GSL  +++ + L+ P+G+ S I ++E   +G  +S ++ +IN
Sbjct: 226 TNSHSKVPESAGITGALIGSLLTIIVCLALAIPVGVMSGICMQELLKRGKLASMIEVSIN 285

Query: 251 NLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIR 310
           NL+SVPSI++G+LG  V +N F +PRS+AL GG+ L++M LP++II+T  A   VP S++
Sbjct: 286 NLSSVPSIIFGVLGLIVYLNIFGVPRSSALAGGMTLSIMILPNLIISTRQAFAAVPESVK 345

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
            AA  LGAS++Q + HH LP+A+P ++ G  VS+AR +GE++PL+ +GMVAFV D P   
Sbjct: 346 QAAFALGASEMQVIMHHSLPIALPTVVQGVMVSVARMIGESSPLIMIGMVAFVVDLPRTF 405

Query: 371 TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
            D A+  PVQIY+WA ++   F + +  AIL LL+ L ++N     +R RF
Sbjct: 406 LDPASVLPVQIYIWANNSNIEFTKISAIAILALLVILLILNMIADLIRKRF 456


>gi|222475292|ref|YP_002563708.1| phosphate ABC transporter (pstA) [Anaplasma marginale str. Florida]
 gi|254995109|ref|ZP_05277299.1| phosphate ABC transporter (pstA) [Anaplasma marginale str.
           Mississippi]
 gi|255003275|ref|ZP_05278239.1| phosphate ABC transporter (pstA) [Anaplasma marginale str. Puerto
           Rico]
 gi|255004404|ref|ZP_05279205.1| phosphate ABC transporter (pstA) [Anaplasma marginale str.
           Virginia]
 gi|222419429|gb|ACM49452.1| phosphate ABC transporter (pstA) [Anaplasma marginale str. Florida]
          Length = 487

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 146/411 (35%), Positives = 227/411 (55%), Gaps = 24/411 (5%)

Query: 14  RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE-TIVDPQKK 72
           R   + L     + A+ +    L+L+L SIV+ G  AL  T I L   F +   +DP   
Sbjct: 93  RSKKDRLLSVLSLGALGISVGMLVLVLCSIVNNGYKALTTTKILLS--FDQIEHIDPGDS 150

Query: 73  RFMDPAILLRADYNLLVRKALARKL--SISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
            F D  I         ++ AL + +  S+  SN    R A  ++S TA Y+    +    
Sbjct: 151 GFRDVCI-------QHIQGALEKIVQNSVDLSNPETRRIAHSIISETAHYNFAHLIEKGT 203

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
           SL      V   AS++  S+  G           ++      +KL ++  +   FN   F
Sbjct: 204 SLSNA--SVWFNASSDFVSSTPGS----------NEVYDAIMRKLVAENRIKRFFNSALF 251

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
            N  S  PE AGI  A++GSL  +++ + L+ P+G+ S I ++E   +G  +S ++ +IN
Sbjct: 252 TNSHSKVPESAGITGALIGSLLTIIVCLALAIPVGVMSGICMQELLKRGKLASMIEVSIN 311

Query: 251 NLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIR 310
           NL+SVPSI++G+LG  V +N F +PRS+AL GG+ L++M LP++II+T  A   VP S++
Sbjct: 312 NLSSVPSIIFGVLGLIVYLNIFGVPRSSALAGGMTLSIMILPNLIISTRQAFAAVPESVK 371

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
            AA  LGAS++Q + HH LP+A+P ++ G  VS+AR +GE++PL+ +GMVAFV D P   
Sbjct: 372 QAAFALGASEMQVIMHHSLPIALPTVVQGVMVSVARMIGESSPLIMIGMVAFVVDLPRTF 431

Query: 371 TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
            D A+  PVQIY+WA ++   F + +  AIL LL+ L ++N     +R RF
Sbjct: 432 LDPASVLPVQIYIWANNSNIEFTKISAIAILALLVILLILNMIADLIRKRF 482


>gi|269958661|ref|YP_003328448.1| phosphate ABC transporter permease [Anaplasma centrale str. Israel]
 gi|269848490|gb|ACZ49134.1| phosphate ABC transporter permease [Anaplasma centrale str. Israel]
          Length = 415

 Score =  218 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 149/411 (36%), Positives = 226/411 (54%), Gaps = 24/411 (5%)

Query: 14  RYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE-TIVDPQKK 72
           R   + L     + A+ +    LIL+L SIV+ G  AL  T I L   F E   VDP   
Sbjct: 21  RSKKDRLLSVLSLGALGISVGVLILVLCSIVNNGYKALTTTKILLS--FDEVERVDPDDS 78

Query: 73  RFMDPAILLRADYNLLVRKALARKL--SISDSNHALLRQASQMLSTTARYHLRKTLMTDP 130
                    R+     ++ AL R +  S+   NH   R A  ++S TA Y L   +    
Sbjct: 79  A-------FRSVCIQYIQDALERVVQNSVDLGNHETRRIAHSVISETAHYDLANLIKKGT 131

Query: 131 SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
            L      V   AS++  S++ G           +       QKL ++  +   FN   F
Sbjct: 132 QLSNT--SVWFNASSDFVSSIPGN----------NVVYDAIMQKLVAENRVKRFFNSALF 179

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
            +  S  PE AGI  A++GSL  +++ + L+ P+G+ S I ++E   +G  +S ++ +IN
Sbjct: 180 TSSHSKVPESAGITGALIGSLLTIMVCLALAIPVGVMSGICMQELLKRGKLASMIEVSIN 239

Query: 251 NLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIR 310
           NL+SVPSI++G+LG  V +N F +PRS+AL GG+ L++M LP++II+T  A   VP S++
Sbjct: 240 NLSSVPSIIFGVLGLIVYLNIFGVPRSSALAGGMTLSIMILPNLIISTRQAFAAVPESVK 299

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGV 370
            AA  LGAS++Q + HH LP+A+PA++ G  VS+AR +GE++PL+ +GMVAFV D P   
Sbjct: 300 QAAFALGASEMQVIMHHSLPIALPAVVQGVMVSVARIIGESSPLIMIGMVAFVVDLPKTF 359

Query: 371 TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
            D A+  PVQIY+WA ++   F + +  AIL LLI L ++N     ++ RF
Sbjct: 360 LDPASVLPVQIYIWANNSNIEFTKISAIAILALLIILLILNMIADLIKKRF 410


>gi|88608117|ref|YP_506363.1| phosphate ABC transporter, permease protein PstA [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600286|gb|ABD45754.1| phosphate ABC transporter, permease protein PstA [Neorickettsia
           sennetsu str. Miyayama]
          Length = 397

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 129/397 (32%), Positives = 189/397 (47%), Gaps = 28/397 (7%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           + +  +  L  R      F F CV    +  VFL +LL S  S    AL QT  ++ +  
Sbjct: 2   NINYLRLKLNTRSFINKFFSFVCVFCAFLPVVFLFVLLFSTFSGAYKALQQTKFAVDL-- 59

Query: 63  SETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL 122
                        +   +   D    +R+ L   L                 S  A   +
Sbjct: 60  -------------EKVGIASGDLRYEIREKLISYLKDQLPWEEDPFIIMNFFSNYAVDEV 106

Query: 123 RKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF 182
              L           +V    S   D+  K            S    +  Q     G L 
Sbjct: 107 LGALNV------GEKKVWATISGEADTVHK-------YRRSGSPGMKRVVQYFSERGLLK 153

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              NY  F N  S     AGI  A++GSLY + + + +SF +G+ +A++L E+S +   +
Sbjct: 154 KALNYKLFTNPDSRDSSQAGIVGALIGSLYTVFVSLLVSFFIGVLTALWLGEYSSRSSIT 213

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ +INNL+S P IV+GILG    INF  +PRS++LVGGL LA +  P ++ ++  A+
Sbjct: 214 RVLEVSINNLSSTPPIVFGILGLTFYINFLGLPRSSSLVGGLTLAFIMFPILVTSSLHAI 273

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+VP +I+ AA  LGASKVQ + HHVLPL+MP I+TG+ + +AR LGE+APLL +GMVAF
Sbjct: 274 RSVPDNIKQAAFALGASKVQVILHHVLPLSMPGIMTGTILGIARILGESAPLLMIGMVAF 333

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA 399
           V   P  + + A  F VQIY+WA   +    E+T   
Sbjct: 334 VGSIPESIREPANVFAVQIYIWATSPDISTNEKTSIM 370


>gi|58617270|ref|YP_196469.1| phosphate ABC transporter permease [Ehrlichia ruminantium str.
           Gardel]
 gi|58416882|emb|CAI27995.1| Phosphate transport system permease protein pstA [Ehrlichia
           ruminantium str. Gardel]
          Length = 420

 Score =  217 bits (553), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 141/424 (33%), Positives = 224/424 (52%), Gaps = 28/424 (6%)

Query: 9   KNLKYRY---------ISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           K LK+R+           + +     + A++     L L+L SI++ G  AL  T I LP
Sbjct: 9   KLLKHRHIASRVSLKNRKDRILSILSMSALISSLGILFLILGSIINNGYNALTATEILLP 68

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSI--SDSNHALLRQASQMLSTT 117
           I  +        K      + LR      + K+L    S     S+         ++S T
Sbjct: 69  ITIN--------KSTTADNMALRGILIDSIHKSLETLFSDVVDISDPNNKNTIYSIISDT 120

Query: 118 ARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDS 177
           A ++L   +  +P     T ++   +S   +  +K         +  +        KL +
Sbjct: 121 AHHNLADFIYKNPET--TTFKMWFKSSTTFNRIIK-------QKNTYNKVYSAIITKLQN 171

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           +  +   FN   FI   S  PE +GI  +++GS++ ++I +  + P+GI S I L E   
Sbjct: 172 ENLIKQSFNNALFIKYNSRSPESSGIIGSLIGSIFSIIICLIFAVPIGITSGICLNELIP 231

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K   S  ++ +I NLA+VPSI++GILG A+ IN FK+PRS++ +GGL L+LM LP+++IA
Sbjct: 232 KNRISYIIEVSITNLAAVPSIIFGILGLAIYINIFKIPRSSSFIGGLTLSLMMLPNLVIA 291

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  AL  VPSS++ AA  LGAS +Q + HH  PLA+P I+ G  +S+AR LGE++PL+ +
Sbjct: 292 TKQALTAVPSSVKDAAFSLGASNMQVIMHHSFPLALPGIMQGVILSIARILGESSPLIMI 351

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAF+ D P    D  T  PVQIY+WA++    F++    AI+ LL+ L ++N  + ++
Sbjct: 352 GMVAFIVDIPKNFLDPTTVLPVQIYMWASNPHIEFIQLAAIAIVALLLILLILNLIVTFI 411

Query: 418 RNRF 421
           R +F
Sbjct: 412 RKKF 415


>gi|57239255|ref|YP_180391.1| phosphate ABC transporter permease [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579218|ref|YP_197430.1| phosphate ABC transporter permease [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161334|emb|CAH58257.1| putative ABC transporter, membrane-spanning protein [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417844|emb|CAI27048.1| Phosphate transport system permease protein pstA [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 420

 Score =  217 bits (552), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 141/424 (33%), Positives = 224/424 (52%), Gaps = 28/424 (6%)

Query: 9   KNLKYRY---------ISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLP 59
           K LK+R+           + +     + A++     L L+L SI++ G  AL  T I LP
Sbjct: 9   KLLKHRHIASRVSLKNRKDRILSILSMSALISSLGILFLILGSIINNGYNALTATEILLP 68

Query: 60  IEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSI--SDSNHALLRQASQMLSTT 117
           I  +        K      + LR      + K+L    S     S+         ++S T
Sbjct: 69  ITIN--------KSTTADNMALRGILIDSIHKSLETLFSDVVDISDPNNKNTIYSIISDT 120

Query: 118 ARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDS 177
           A ++L   +  +P     T ++   +S   +  +K         +  +        KL +
Sbjct: 121 AHHNLADFIYKNPET--TTFKMWFKSSTTFNRIIK-------QKNTYNKVYSAIITKLQN 171

Query: 178 DGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH 237
           +  +   FN   FI   S  PE +GI  +++GS++ ++I +  + P+GI S I L E   
Sbjct: 172 ENLIKQSFNNALFIKYNSRSPESSGIIGSLIGSIFSIIICLTFAVPIGITSGICLNELIP 231

Query: 238 KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
           K   S  ++ +I NLA+VPSI++GILG A+ IN FK+PRS++ +GGL L+LM LP+++IA
Sbjct: 232 KNRISYIIEVSITNLAAVPSIIFGILGLAIYINIFKIPRSSSFIGGLTLSLMMLPNLVIA 291

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T  AL  VPSS++ AA  LGAS +Q + HH  PLA+P I+ G  +S+AR LGE++PL+ +
Sbjct: 292 TKQALTAVPSSVKDAAFSLGASNMQVIMHHSFPLALPGIMQGVILSIARILGESSPLIMI 351

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           GMVAF+ D P    D  T  PVQIY+WA++    F++    AI+ LL+ L ++N  + ++
Sbjct: 352 GMVAFIVDIPKNFLDPTTVLPVQIYMWASNPHIEFIQLAAIAIVALLLILLILNLIVTFI 411

Query: 418 RNRF 421
           R +F
Sbjct: 412 RKKF 415


>gi|283954104|ref|ZP_06371629.1| LOW QUALITY PROTEIN: phosphate ABC transporter, permease protein
           PstC, putative [Campylobacter jejuni subsp. jejuni 414]
 gi|283794383|gb|EFC33127.1| LOW QUALITY PROTEIN: phosphate ABC transporter, permease protein
           PstC, putative [Campylobacter jejuni subsp. jejuni 414]
          Length = 666

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 144/409 (35%), Positives = 219/409 (53%), Gaps = 58/409 (14%)

Query: 16  ISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFM 75
            +   F+  C + + +  VFL + L S+   GIGA  Q++I +    +    D   +   
Sbjct: 314 KTSKYFKRLCKMGLYINLVFLCIFLGSVAYLGIGAFKQSYIFVEANRNSPAYDLLSRAEQ 373

Query: 76  DPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGK 135
               + +                                                     
Sbjct: 374 RKIRIGQI---------------------------------------------------- 381

Query: 136 TVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGAS 195
           T +  LLA++ +D  +K           +++ Q      L   G + L FN  FF+NG S
Sbjct: 382 TEKTWLLANSEVDQYMKQKYNR------LNEKQRVLVDDLVQKGEIELKFNSNFFLNGDS 435

Query: 196 SRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASV 255
             PE +GI  +V+G+L +ML+ + +S P+G+A+AIYLEEF+ +   + F++  INNLAS+
Sbjct: 436 KSPENSGILSSVIGTLLVMLVCMVVSVPMGVAAAIYLEEFAPQNILTHFIEVCINNLASI 495

Query: 256 PSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALG 315
           PSI++G+LG  V IN F MPRS+ALVGGL LA+M+LP II++T  AL++V  ++++AA  
Sbjct: 496 PSILFGLLGLGVFINLFGMPRSSALVGGLTLAIMSLPIIIVSTKAALKSVDINMKNAAYA 555

Query: 316 LGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIAT 375
           LG +KVQ V   +LPLAMP ILTGS ++LA A+GETAPL+ +GM+AF+ D    + D  +
Sbjct: 556 LGMTKVQMVKGIMLPLAMPMILTGSILALAGAIGETAPLMIIGMIAFIPDVASSIFDPTS 615

Query: 376 AFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P QIY W+A  ER F+ERT   I++LL  L V+N + + LR  F+ +
Sbjct: 616 VLPAQIYSWSAMPERAFLERTAAGIIVLLGLLVVLNFSAILLRKYFQGK 664



 Score =  130 bits (326), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 64/250 (25%), Positives = 113/250 (45%), Gaps = 17/250 (6%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           +  F     +S+  V G      G+ Y+ LI +  + PLG+  AIYL  F+ K    +++
Sbjct: 54  DTAFMNADGTSKQGVFGALSLFWGTFYISLIAMLTALPLGVMCAIYLGVFAGKKS-KNYL 112

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRS---------TALVGGLILALMTLPSIII 296
           +  +  +A +P++V+G   + V+  F     S         +AL  G I+ +M +P +  
Sbjct: 113 KPILEIIAGIPTVVFGFFAAIVVAPFIVWFFSLFGIQASFQSALGAGFIMGIMIVPIVAS 172

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
            +   +  V     + A  LG +K + VF  +LP A+P I+    + L+RALGET  ++ 
Sbjct: 173 LSQDCIEAVSEKRINGAYALGMTKKEVVFAVILPEAIPGIVAACLLGLSRALGETMIVVM 232

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE----RTFGAILLLLIFLAVINT 412
               +   +  +   +  T   V+I   A   ++ F        F   L+L I   +IN 
Sbjct: 233 AA--SLRPNLTLNFLEDMTTVTVKIV-EALSGDQAFDSSLALSAFSLGLVLFIITLIINM 289

Query: 413 AMLWLRNRFK 422
             ++L NRF 
Sbjct: 290 FSVYLINRFH 299


>gi|194333775|ref|YP_002015635.1| phosphate ABC transporter inner membrane subunit PstA
           [Prosthecochloris aestuarii DSM 271]
 gi|194311593|gb|ACF45988.1| phosphate ABC transporter, inner membrane subunit PstA
           [Prosthecochloris aestuarii DSM 271]
          Length = 449

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 121/450 (26%), Positives = 199/450 (44%), Gaps = 40/450 (8%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGA-LWQTHISLPIEFSETIVD 68
           N+  R I +  F    V +++++ + L+ +L  IV+ GI A  +Q  I         ++ 
Sbjct: 2   NIGTRKILDRSFTAMGVTSIVLMAMALLAVLVPIVNGGIKAVFFQATIE-----HRKLMY 56

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYH------- 121
            +  R     I  +      +R+ L   L+  D+    +   S   S  ++Y+       
Sbjct: 57  NEFGRGDADEIERQIRQADSIREPLFAILANFDAELETMDDVSLKRSYRSKYNQVRNHLH 116

Query: 122 --------------LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDY 167
                         LR           + V   LL     DS+    +     V R+ D+
Sbjct: 117 DLLGPLPGDTEPLLLRFQYGKTRWAQAEEVLHDLLFVTKWDSSNPNVMAKKYFVPRVDDF 176

Query: 168 QWKWF--------QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIG 219
           Q              LD        F +GF  + A       GI   + G+ ++ +  + 
Sbjct: 177 QGTALAPLFAYVETHLDEMLLPQRTFYWGFLTDKALDAHIFGGISAEIRGTFFLAIGAML 236

Query: 220 LSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-T 278
            +FPLG+ +AIY  E++   F +S +++  + LA VPSIV+G+ G A  IN  K+  S +
Sbjct: 237 FAFPLGVIAAIYFTEYAKDNFLTSMLRSANSTLAGVPSIVFGLFGLAFFINTLKVSESKS 296

Query: 279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILT 338
            L G L LA+M LP+II A   A+ +VP + R A+LGLGA+K +T+   +LP A+P I+T
Sbjct: 297 VLAGSLTLAIMILPTIIRAAEEAILSVPKTYREASLGLGATKWRTIVTVILPAALPGIMT 356

Query: 339 GSTVSLARALGETAPLLFVGM--VAFVTDYPVGVTDIATAFPVQIYLWAADAERPF--VE 394
           G  +SL RA GETAP++F     V          +    A    IY  A++ E       
Sbjct: 357 GGIISLGRAAGETAPIIFTAAVSVGATVGLADVFSQPTPALSWNIYNLASEHEAANEIRH 416

Query: 395 RTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             +G +L L+  + ++N + + LR R  K+
Sbjct: 417 VQYGMVLALISIVLLLNMSAILLRARISKK 446


>gi|58696973|ref|ZP_00372459.1| phosphate ABC transporter [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58536786|gb|EAL60024.1| phosphate ABC transporter [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 378

 Score =  214 bits (544), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 130/394 (32%), Positives = 207/394 (52%), Gaps = 21/394 (5%)

Query: 30  LVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLV 89
           ++     + +L SI+     AL  T I LP+E +  +        +    +       L+
Sbjct: 1   VISLGCPVCILLSILVNSYSALTVTKILLPVEINADLALASNPSDLRYKSI------GLL 54

Query: 90  RKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDS 149
             +L +    +D      +   ++LS  +   L K         G+  E+   AS+ I+S
Sbjct: 55  NDSLRKVFGGTDF-----KDGDEILSRNSYKELEKFFRKKVKDSGEY-EIWFTASSIINS 108

Query: 150 ALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVG 209
             K           ++D   K    L     +   FN   F+   S  PE AGI  A +G
Sbjct: 109 INK--------DKYLNDRYAKLLDWLKEKRRVKKFFNKSLFLKSDSREPENAGILGAFIG 160

Query: 210 SLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF-SSFVQANINNLASVPSIVYGILGSAVL 268
           SL  +++ + L+ P+GI S I L EF  K    ++ V+ +INNLA+VPSI++G++G  + 
Sbjct: 161 SLMTIIVCLALALPIGIMSGICLYEFMPKNRLMTNIVEISINNLAAVPSIIFGVVGLTLY 220

Query: 269 INFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHV 328
           +  F +PRS+ LVGG+ L+ M LP+IIIAT  A   VP +I+ AA  LGA  ++ +  H 
Sbjct: 221 LGIFGLPRSSPLVGGMTLSFMMLPNIIIATKNAFANVPITIKDAAFALGAPHIKVILDHS 280

Query: 329 LPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADA 388
           LP+A+P I+ G+ +++AR LGE++PLL +GMVAF+ D P    D AT  PVQIY+W+++ 
Sbjct: 281 LPIALPRIIHGTVLAIARILGESSPLLMMGMVAFIADTPTSFFDPATVLPVQIYIWSSNP 340

Query: 389 ERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           E  FVE    AI+ LL+ L  +N    +++ +F+
Sbjct: 341 EIAFVELAAIAIIALLLVLFALNLVANFVKRKFE 374


>gi|84514491|ref|ZP_01001855.1| phosphate ABC transporter, permease protein [Loktanella
           vestfoldensis SKA53]
 gi|84511542|gb|EAQ07995.1| phosphate ABC transporter, permease protein [Loktanella
           vestfoldensis SKA53]
          Length = 575

 Score =  213 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 137/382 (35%), Positives = 203/382 (53%), Gaps = 18/382 (4%)

Query: 59  PIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTA 118
            + F++           D A L    Y   +  A                  S ++  T 
Sbjct: 197 DLGFAQAADRVASIDPSDSAALAETGYQAALTDAAGAL---RQPAQFDDAALSSIIFATN 253

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGY---LYSPANVHRMSDYQWKWFQKL 175
           R  +R  L+ +P L+G T +  +    ++   L G    + +          Q      +
Sbjct: 254 RRDVRDQLVDNPDLVGTTEKTGVPIDISVTRYLSGELSGVGTAQMPPGFDIGQLALVDAM 313

Query: 176 DSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEF 235
                +   F + FF N  S   E+ GIG A++GS YMML+V+  S   G+A++IYLEEF
Sbjct: 314 VEADLISNSFRWHFFTNPYSQSGEITGIGPALMGSAYMMLVVLVFSLVFGVAASIYLEEF 373

Query: 236 SHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRST-----ALVGGLILALMT 290
           + K  F++F++ NI NLA+VPSIV+GILG+A+L     +   +     AL+GGL+L+LMT
Sbjct: 374 APKNRFTNFIEINIANLAAVPSIVFGILGAAILFTLMDLGFGSSIRGTALLGGLVLSLMT 433

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP+I+IAT  AL+ VP SI  AALG+GASKVQ VFHH LPLA P ILTG+ + +A+ALGE
Sbjct: 434 LPTIVIATRAALKAVPPSIADAALGVGASKVQMVFHHKLPLAAPGILTGTIIGIAQALGE 493

Query: 351 TAPLLFV------GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLL 403
           TAPLL +      G     + +  G+ + A + P  +YL A + + P  E     AIL++
Sbjct: 494 TAPLLLIGLSVSTGAALLSSPFSGGLLEQAQSMPTVVYLLAQNQDAPVREGLAQSAILVM 553

Query: 404 LIFLAVINTAMLWLRNRFKKRW 425
           L+ L  +N   + LR +F++RW
Sbjct: 554 LVLLFALNILAIILRRKFERRW 575



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 44/107 (41%), Gaps = 4/107 (3%)

Query: 3   SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEF 62
           S       ++ R+ +  + R+    A+ +V +FL +LL SIVS+G+ AL+Q    + + +
Sbjct: 16  SLLEQSALVRKRHRTGTILRWLGFSAITLVLMFLAILLWSIVSRGVPALFQYQAQIELYY 75

Query: 63  SETIVDPQKKRFMDPA----ILLRADYNLLVRKALARKLSISDSNHA 105
              +++P              L       +   +L   L  +  +  
Sbjct: 76  DPAVLNPDGGDVSAEEIGTINLRTGFERGIFTSSLRSTLENAGIDIE 122


>gi|159900512|ref|YP_001546759.1| phosphate ABC transporter inner membrane subunit PstA
           [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893551|gb|ABX06631.1| phosphate ABC transporter, inner membrane subunit PstA
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 416

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 123/432 (28%), Positives = 203/432 (46%), Gaps = 44/432 (10%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
              ++N+  R  +  ++R   + A ++  + L LL+ ++V++  G     +++       
Sbjct: 16  EAARRNVASRRRTGAIWRTIFLSATIIGLIALSLLIYNVVNEVFG-----YVATEYAVDP 70

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
             +  +    ++   L+    + +   A                +   ++          
Sbjct: 71  ATLSDKPIDELNKDELVAVLQDNMRANAFRTLERDKPMADRSESEVYDLVIERV------ 124

Query: 125 TLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLD 184
                  L  +T+E   L  +  + A               D Q    +  ++       
Sbjct: 125 -------LKPQTLETWTLRDSWFNKAA-------------IDAQVAS-EFPEAKLEFRSW 163

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
              GF     SS P  AG+  A++GSL+M+ I I  +FP+G+ +AIYLEE++    F+  
Sbjct: 164 LTAGFLTTPMSSDPLRAGVRTALLGSLWMIAITILFAFPIGVGAAIYLEEYATDNRFNRI 223

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRS------------TALVGGLILALMTLP 292
           +Q NINNLA VPSI+YG+LG  + +   +   S            T +   L + L+ LP
Sbjct: 224 IQTNINNLAGVPSIIYGMLGLVIFVRTLEPLTSGRIFGADSGNGRTIVAASLTMMLLILP 283

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +II    A+R VP S+R A+ GLGA+K QT++HHVLP A+P I TG+ ++++RA+GETA
Sbjct: 284 IMIINGQEAIRAVPLSLRQASYGLGATKWQTIWHHVLPNALPGIFTGTILAVSRAIGETA 343

Query: 353 PLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINT 412
           PL+ VG   F+   P G     TA P+QIY W +  +  F      AI++LL+ L  +N 
Sbjct: 344 PLIVVGASTFIVTDPDGPFAKFTALPIQIYNWTSRPQPEFAHIAASAIVVLLVMLLSLNA 403

Query: 413 AMLWLRNRFKKR 424
             + LRNRF KR
Sbjct: 404 IAVLLRNRFSKR 415


>gi|328950120|ref|YP_004367455.1| phosphate ABC transporter, inner membrane subunit PstA
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450444|gb|AEB11345.1| phosphate ABC transporter, inner membrane subunit PstA
           [Marinithermus hydrothermalis DSM 14884]
          Length = 407

 Score =  208 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 125/424 (29%), Positives = 199/424 (46%), Gaps = 31/424 (7%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSE 64
              +  L+ R  +  LF     + V++    + +LL  +V+  +   WQ           
Sbjct: 12  EQARARLRRRKGA--LFGALTFLPVVLALGLIAVLLFDVVTGAVS--WQ----------- 56

Query: 65  TIVDPQKKRFMDPAILLRADYNLLVRK---ALARKLSISDSNHALLRQASQMLSTTARYH 121
            +++P ++       L  A     V     A                +A +      R  
Sbjct: 57  -VIEPSRRSSGQTFALTEALTKRQVIALELAARGLTEEEIQAFMNDPEAMRKFEARNRVE 115

Query: 122 LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGAL 181
           L       P          ++ ++      K     P         + +   +      L
Sbjct: 116 LMWYTEDGP-------FRWVVTTSRD----KRVANYPLLEGWRRLAEIRSGLEPGQHLVL 164

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
               +  FF   AS  P +AGI  A+VG+L++M +   +S P+G+ +AIYLEE++    +
Sbjct: 165 NPWLDLSFFFRDASRTPLMAGIRAALVGTLWVMALTALISIPVGVGAAIYLEEYAPDNRW 224

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ N+ NLA VPSIVYG+LG ++ +  + +   + L   L L+L+ +P I+IA+  A
Sbjct: 225 TRLIEVNLRNLAGVPSIVYGVLGLSLFVRAWGL-GPSVLSAALTLSLLIMPVIVIASREA 283

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R VP+S+R AA GLGA++ Q V   VLP A+P I+TG  +S+ARA+GETAPLL VG  A
Sbjct: 284 IRAVPNSLRQAAYGLGATRWQVVSRVVLPSAVPGIVTGVILSVARAIGETAPLLLVGAAA 343

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           FV   P G     T  PVQIY W  + +  F       IL+LL  LAV+ +A  ++R RF
Sbjct: 344 FVPFLPSGPLSEYTVIPVQIYSWVTENDPEFAHVASAGILVLLAVLAVLYSAAFYVRRRF 403

Query: 422 KKRW 425
            ++W
Sbjct: 404 GRKW 407


>gi|193212579|ref|YP_001998532.1| phosphate ABC transporter inner membrane subunit PstA
           [Chlorobaculum parvum NCIB 8327]
 gi|193086056|gb|ACF11332.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chlorobaculum parvum NCIB 8327]
          Length = 448

 Score =  203 bits (517), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 114/449 (25%), Positives = 197/449 (43%), Gaps = 39/449 (8%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGA--LWQTHISLPIEFSETIV 67
           NL  R + +  F      +++++ + L+++L+ I SKGIGA     T     IE  + ++
Sbjct: 2   NLGTRKLLDRSFTALGFGSIVIMGLALLVVLAPIASKGIGAIVFKGT-----IEHRKLLL 56

Query: 68  DPQKKRFMDPAILLRAD---YNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRK 124
           +   +          A    Y   V   L+      D      +   +      +  LR 
Sbjct: 57  NEFHRGDAAKIGKEEASANEYRQKVFDMLSEFDQELDGMDYEQQSKYRGNYDQVKTALRG 116

Query: 125 TLMTDP----------------SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQ 168
                P                    +     LL     D +    +  P +V R ++++
Sbjct: 117 LFGPLPGDTEPALTRFRYGQTRWDKAEEKLHDLLYEQKWDYSNPDVIAKPYDVSRAAEFE 176

Query: 169 WKWF--------QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGL 220
                       + LD          +GF  + +       GI   + G++++ +  +  
Sbjct: 177 GTSLVKLFSYVEENLDKMMLPEWTVYWGFITDKSIDAHFFGGIWPEIQGTIFLAIGAMVF 236

Query: 221 SFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TA 279
           +FPLG+ +A+Y  E++  GF +S +++  + LA VPSIV+G+ G A  IN   +  S + 
Sbjct: 237 AFPLGVIAAVYFTEYAKDGFLTSMLRSANSTLAGVPSIVFGLFGLAFFINTLHVSHSKSV 296

Query: 280 LVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG 339
           L G L LA+M LP+II A   A+  VP + + A+LGLG++K  T+   +LP A+P ILTG
Sbjct: 297 LAGSLTLAIMILPTIIRAAEEAILAVPKTYKEASLGLGSTKWNTIVTVILPAALPGILTG 356

Query: 340 STVSLARALGETAPLLFVGMVAFVTDYPVG--VTDIATAFPVQIYLWAADAERPF--VER 395
             +SL RA GETAP++F   V+      +G  +     A    IY  A++ E        
Sbjct: 357 GVISLGRAAGETAPIIFTAAVSVGAAIGLGDVLNSPTPALSWNIYNLASEHEAAAEIRHV 416

Query: 396 TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +G +L L+  + ++N + + LR R  K+
Sbjct: 417 QYGMVLSLVTIVLLLNLSAIILRARISKK 445


>gi|327475174|gb|AEA77182.1| PstA [Exiguobacterium sp. EPVM]
          Length = 303

 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 98/241 (40%), Positives = 158/241 (65%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  F  N  S RPE AG+  A++G+ ++ML+++ + F +G+ +AIYLEE++ K   +S
Sbjct: 63  WVNLDFLRNFPSRRPEQAGLYPALIGTFWLMLLIVPMVFIVGVGAAIYLEEYAPKNRITS 122

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++ NI+NLA VPSIV+G+LG  + +   ++  ++ + G L L LM+LP +I+A+  ALR
Sbjct: 123 FIEVNISNLAGVPSIVFGLLGLTIFVRVMEL-GNSIMAGALTLGLMSLPIVIVASQEALR 181

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +V   +R A+L LGASK QT F+ VLP A+P I+TG  ++++RA+GETAPL+ VG   F+
Sbjct: 182 SVKMELRHASLALGASKWQTTFNVVLPSAIPGIITGIILAVSRAIGETAPLIMVGAATFI 241

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +  P  V    TA P+QIY W +  +  F       I++L+  L ++N+A +++RN++  
Sbjct: 242 STTPSSVFSDFTALPIQIYNWTSRPQAEFQNLAAAGIIVLMTMLIIMNSAAIYIRNKYTN 301

Query: 424 R 424
           R
Sbjct: 302 R 302


>gi|229916293|ref|YP_002884939.1| phosphate ABC transporter inner membrane subunit PstA
           [Exiguobacterium sp. AT1b]
 gi|229467722|gb|ACQ69494.1| phosphate ABC transporter, inner membrane subunit PstA
           [Exiguobacterium sp. AT1b]
          Length = 303

 Score =  201 bits (512), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 97/241 (40%), Positives = 156/241 (64%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  N  S RPE AG+  A++GSL++ML+++ + F +G+ +AIYLEE++ K   +S
Sbjct: 63  WVDLDFLRNFPSRRPEQAGLYPALIGSLWLMLLIVPMVFVIGVGAAIYLEEYAPKNRMTS 122

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++ NI+NLA VPSIV+G+LG  + +   ++  ++ + G L L LM+LP +I+A+  ALR
Sbjct: 123 FIEVNISNLAGVPSIVFGLLGLTIFVRVMEL-GNSIMAGALTLGLMSLPIVIVASQEALR 181

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            V   +R A+L LGASK QT F+ VLP A+P I+TG  ++++RA+GETAPL+ VG   F+
Sbjct: 182 AVKMELRHASLALGASKWQTTFNVVLPSALPGIITGIILAVSRAIGETAPLIMVGAATFI 241

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +  P  +    TA P+QIY W +  +  F       I++L+  L  +N+  +++RN++  
Sbjct: 242 STTPSNIFSDFTALPIQIYNWTSRPQAEFQNLAAAGIIVLMTMLIAMNSVAIYIRNKYTN 301

Query: 424 R 424
           R
Sbjct: 302 R 302



 Score = 38.9 bits (89), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 22/47 (46%)

Query: 3  SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          +     + +K R     +F++  +  ++   V L  L+  IVSKG G
Sbjct: 16 NRETVSQRIKRRLQLNEIFKYIFLAGLVFALVVLSTLIYDIVSKGAG 62


>gi|268317379|ref|YP_003291098.1| phosphate ABC transporter, inner membrane subunit PstA
           [Rhodothermus marinus DSM 4252]
 gi|262334913|gb|ACY48710.1| phosphate ABC transporter, inner membrane subunit PstA
           [Rhodothermus marinus DSM 4252]
          Length = 297

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 99/240 (41%), Positives = 155/240 (64%), Gaps = 1/240 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  S  PE AGI  A+VGS +MML+    S P+G+ +A+YLEE++ +G+F  
Sbjct: 55  WLDWQFLTSYPSRNPEEAGIKSAIVGSFWMMLLTALFSVPVGVGAAVYLEEYAPRGWFLR 114

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +Q NI NLA +PS++YGILG  + + +F + R + L G L ++L+ LP I+I+T  ALR
Sbjct: 115 LIQLNIANLAGIPSVIYGILGLGLFVRYFALGR-SLLAGALTMSLLVLPIIVISTQEALR 173

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP  IR +A  LGA++ Q V  H+LP+A P ILTG  ++L+RA+GETAPL+ +G + F+
Sbjct: 174 AVPQGIRESAYALGATRWQVVSSHLLPIAAPGILTGIILALSRAVGETAPLVMIGALTFI 233

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  + D  T  P+QI+ W A  +  F      AI++L++FL ++N + + LRN +++
Sbjct: 234 AFLPESLLDPFTVLPIQIFNWTARPQEEFRGLAAAAIIVLMVFLFLMNLSAILLRNYYER 293


>gi|21673726|ref|NP_661791.1| phosphate ABC transporter, permease protein, putative [Chlorobium
           tepidum TLS]
 gi|21646849|gb|AAM72133.1| phosphate ABC transporter, permease protein, putative [Chlorobium
           tepidum TLS]
          Length = 448

 Score =  199 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 113/445 (25%), Positives = 188/445 (42%), Gaps = 31/445 (6%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGA-LWQTHISLPIEFSETIVD 68
           NL  R I +  F    + +++V+ + L++++  I+  G GA  ++  I    +       
Sbjct: 2   NLGTRKILDRSFTAVGIGSIIVMAMALLVVIVPIIWNGSGAIFFKGTIE-HRKLLYNHFH 60

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
              K  +D  I     Y   V K +A      D+                +  LR  L  
Sbjct: 61  RGDKAELDREIASTDKYRQKVYKMVADFQKELDAMPPEKSADLSTEFEDVKTSLRALLGP 120

Query: 129 DP----------------SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWF 172
            P                    +     LL     DS+    +       R  D+     
Sbjct: 121 LPGDDEPVLTRFKYGQTRWDKAEDKLHDLLYVTKWDSSNPNEMAKQYFADRAPDFNGTAL 180

Query: 173 --------QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPL 224
                   + L +       F +GF  + +       GI   + G+ ++ +  +  +FPL
Sbjct: 181 YPLFGYVKENLRNMLLPKFTFYWGFITDSSIDSHIFGGIWPEIKGTFFLAVGAMLFAFPL 240

Query: 225 GIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGG 283
           GI +A+Y  E++++G+F+S +++  N LA VPSIV+G+ G A  IN   +  S + L G 
Sbjct: 241 GIVAAVYFTEYANEGWFTSMLRSANNTLAGVPSIVFGLFGLAFFINTLHVSHSKSVLAGS 300

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L LA+M LP+II A   A+  VP + + A+L LG++K  T+   +LP A+P ILTG  +S
Sbjct: 301 LTLAIMILPTIIRAAEEAILAVPKTYKEASLSLGSTKWNTIMTVILPAALPGILTGGVIS 360

Query: 344 LARALGETAPLLFVGM--VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGA 399
           L RA GETAP++F     V         +     A    IY   ++ E     R   +G 
Sbjct: 361 LGRAAGETAPIIFTAAVSVGAAVGLGDVLNTPTPALSWNIYNLVSEHEMASQIRYVQYGM 420

Query: 400 ILLLLIFLAVINTAMLWLRNRFKKR 424
           +L L+  +  +N + +  R R  K+
Sbjct: 421 VLALISIVLFLNLSAIMWRARISKK 445


>gi|300711668|ref|YP_003737482.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halalkalicoccus jeotgali B3]
 gi|299125351|gb|ADJ15690.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halalkalicoccus jeotgali B3]
          Length = 305

 Score =  199 bits (506), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 95/243 (39%), Positives = 150/243 (61%), Gaps = 1/243 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  +  S  P+ AGI  A++GS+ MM++V   + P+G+ +A+YL E++ +  F+
Sbjct: 63  RWLDWQFLTSAPSRFPDEAGIYPALIGSIMMMIVVAVATVPIGVGAALYLVEYAPQNRFT 122

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             +Q NI NLA VPS+VYG+LG A+ I  F +P  + LVGG+ + L+ LP +II+   A+
Sbjct: 123 ELIQLNIANLAGVPSVVYGLLGLALFIRVFTLPYGSVLVGGMAVGLLILPIVIISAQEAI 182

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
            +VP S R A+L +GA++ QT  + VLP A+P ILTG+ ++  RA+GETAPLL +G  A 
Sbjct: 183 DSVPDSQREASLAMGATRWQTTRNVVLPGALPGILTGTILAFGRAIGETAPLLMIGAAAT 242

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPF-VERTFGAILLLLIFLAVINTAMLWLRNRF 421
           + + P G     +A P QIY W+A     F        ++ LL  +  +N A + +RNR+
Sbjct: 243 IYNPPAGFLARFSAMPRQIYTWSAMPSPEFRYGVLAAGVVTLLAVMLSMNAAAILIRNRY 302

Query: 422 KKR 424
           ++R
Sbjct: 303 QRR 305


>gi|172056899|ref|YP_001813359.1| phosphate ABC transporter, inner membrane subunit PstA
           [Exiguobacterium sibiricum 255-15]
 gi|171989420|gb|ACB60342.1| phosphate ABC transporter, inner membrane subunit PstA
           [Exiguobacterium sibiricum 255-15]
          Length = 302

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 104/241 (43%), Positives = 158/241 (65%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  N  S RP+ AGI  A++GS+++ML++I + F LG+ +AIYLEE++ KG  +S
Sbjct: 62  WLSLDFLQNAPSRRPDRAGIYPALMGSIFLMLLIIPMIFILGVGAAIYLEEYAKKGRMTS 121

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++ NI+NLA VPSIV+G+LG    +       ST + G L LALM+LP +I+++  A+R
Sbjct: 122 FIEVNISNLAGVPSIVFGLLGLTFFVRNMGF-GSTLIAGALTLALMSLPVVIVSSQEAIR 180

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP ++R A+L LGASK QT F  VLP ++P ++TG  ++++RA+GETAPL+ VG   F+
Sbjct: 181 AVPQAMRHASLALGASKWQTTFKVVLPASLPGVITGIILAVSRAIGETAPLIMVGAAIFI 240

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P G+    TA P+QIY W +  +  F       I++L++ L  +N+  +W+RNRF K
Sbjct: 241 ARAPEGIFSEFTALPIQIYNWTSRPQADFQGLAAAGIIILMVILLTMNSLAIWIRNRFSK 300

Query: 424 R 424
           R
Sbjct: 301 R 301


>gi|262197755|ref|YP_003268964.1| phosphate ABC transporter inner membrane subunit PstA [Haliangium
           ochraceum DSM 14365]
 gi|262081102|gb|ACY17071.1| phosphate ABC transporter, inner membrane subunit PstA [Haliangium
           ochraceum DSM 14365]
          Length = 294

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 96/241 (39%), Positives = 154/241 (63%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ FF    SS   +AGI  A+ GS+Y++ +    + PLG+ +AIYLEE+  +   +S
Sbjct: 53  RLDWNFFQGNPSSDAALAGIRPALFGSVYLIALTALFALPLGVGAAIYLEEYGGQSRLAS 112

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++  I NLA VPS++YG+LG  + +  F     + L G   LAL+ LP +I+++  ALR
Sbjct: 113 TIEVAIANLAGVPSVIYGLLGLGLFVRAFGF-GPSLLAGACTLALLVLPIVIMSSREALR 171

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           TVP S+R  ALGLGA++ Q +   +LP+ +P ILTG+ +S++RA+GETAPL+ +G+  F+
Sbjct: 172 TVPDSLREGALGLGATRWQMIRRVILPMCLPGILTGAILSVSRAIGETAPLIVIGVAVFI 231

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           +  P G+    TA P+QIY W +  +R F+  +   I++L+  L V+N+  ++LRNRF+ 
Sbjct: 232 STVPSGLDSQFTALPIQIYNWVSMPQREFLTNSAAGIVVLMGTLLVLNSIAIFLRNRFQT 291

Query: 424 R 424
           R
Sbjct: 292 R 292


>gi|160915027|ref|ZP_02077240.1| hypothetical protein EUBDOL_01035 [Eubacterium dolichum DSM 3991]
 gi|158432826|gb|EDP11115.1| hypothetical protein EUBDOL_01035 [Eubacterium dolichum DSM 3991]
          Length = 415

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 106/430 (24%), Positives = 191/430 (44%), Gaps = 33/430 (7%)

Query: 6   INKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSET 65
           I   NLK R I + +      ++  +  + L  +   + ++G         SL ++    
Sbjct: 4   ITSGNLKKRRIKDTILNGITYLSSGISVLVLAAIFIFVFTQGFS-------SLSLDLLTG 56

Query: 66  IVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKT 125
                       A     D   + ++               +    +             
Sbjct: 57  NYWANNYLTTVEADRNAPDCFQVPKELGEEVAFSEAWGVGFVDALDENKEPIVLIEYIDE 116

Query: 126 LMTDPSLIGKTV-EVSLLASANIDSALK--------GYLYSPANVHRMSDYQWKWFQKLD 176
                SLI K+V +     SA +   ++        G++    N+      Q       +
Sbjct: 117 ASPFASLIDKSVHDRETKLSAEVGYQVERINYMGKDGHIKIVGNLMSNDAKQVAQALDQN 176

Query: 177 SDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS 236
           +     + F                GI  +++ +LY++++ + +S PLGIA+AIYL E++
Sbjct: 177 AQSIQEMYFKT-----------PGGGIRGSILATLYLIVVALLVSLPLGIAAAIYLREYA 225

Query: 237 HKGFFSSFVQANINNLASVPSIVYGILGSAVLINF---FKMPRSTALVGGLILALMTLPS 293
            K   + ++++ +  L+ VPSI++G++G  VL      F    +  L+GGL LA++ LP+
Sbjct: 226 SKNKLTGWIRSAVEMLSGVPSIIFGLMGVTVLFPITQLFGATTTNILLGGLTLAVILLPT 285

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           II ++  AL  VP S+R A+L LGAS+ QT+F  VLP A+P ILTG  +S+ R +GE+A 
Sbjct: 286 IIRSSEEALIVVPQSLRDASLSLGASRSQTIFKVVLPNAIPGILTGVLLSIGRVIGESAA 345

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           L++  M  +V D P  +    T+  V IY   +  +  F E      +++L+F+ ++N +
Sbjct: 346 LIYT-MGTYVNDAPQ-LLSQGTSLAVHIYNIMSSEQPNF-ELACAISIVILVFVLILNIS 402

Query: 414 MLWLRNRFKK 423
           + W+  RF K
Sbjct: 403 IKWISRRFHK 412


>gi|156740605|ref|YP_001430734.1| phosphate ABC transporter inner membrane subunit PstA [Roseiflexus
           castenholzii DSM 13941]
 gi|156231933|gb|ABU56716.1| phosphate ABC transporter, inner membrane subunit PstA [Roseiflexus
           castenholzii DSM 13941]
          Length = 419

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 129/430 (30%), Positives = 206/430 (47%), Gaps = 46/430 (10%)

Query: 7   NKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETI 66
             +N+  R +   +++ + + ++++  + L  LL +IV    G     +I++  +     
Sbjct: 21  INRNIAARRLRGKVWQAFFLSSLIIGLLALATLLYTIVDDSFG-----YIAVQTKIDPEK 75

Query: 67  VDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHL-RKT 125
           +  +    +    L          + L   +S          +     S  +   L  + 
Sbjct: 76  LSDRPLEELSKEEL---------IEILRANISPGLFRRFDRDEPFSERSKESVLQLIEER 126

Query: 126 LMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDF 185
           ++    +    +  SLL    I++ ++                                 
Sbjct: 127 VIGREVVAAYKLTESLLERDRIEATVRERFPRAE-------------------LEFHSWI 167

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           N  F     SS P +AG+G A++GSL+++ I + L+ P+GI   +YLEE++   ++   +
Sbjct: 168 NREFLTRPMSSSPILAGVGNAILGSLWVIAITMLLAIPIGILGGVYLEEYASDTWYYRLI 227

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTA------------LVGGLILALMTLPS 293
           + NINNLA VPSI+YGILG AV +   +   S A            L  GL +AL+ LP 
Sbjct: 228 ETNINNLAGVPSIIYGILGLAVFVRALEALTSGATFGVTDSNGRTILSAGLTMALLVLPL 287

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +II    A+R VP SIR A+ GLGA+K QTV+HHVLP A+P ILTG+ +S++RA+GETAP
Sbjct: 288 MIINAREAIRAVPQSIRQASYGLGATKWQTVWHHVLPNALPGILTGTILSMSRAMGETAP 347

Query: 354 LLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTA 413
           L+ VG   FV  +P  V D  T  P+QIY W       F      AI++LL+ L ++N  
Sbjct: 348 LIVVGASTFVVFFPDSVFDKFTVIPIQIYNWTQQPGAQFRSIAAAAIIVLLVTLLLLNAT 407

Query: 414 MLWLRNRFKK 423
            + LRNRFK+
Sbjct: 408 AILLRNRFKR 417


>gi|89099175|ref|ZP_01172053.1| phosphate ABC transporter, permease protein, putative [Bacillus sp.
           NRRL B-14911]
 gi|89086021|gb|EAR65144.1| phosphate ABC transporter, permease protein, putative [Bacillus sp.
           NRRL B-14911]
          Length = 292

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 96/241 (39%), Positives = 156/241 (64%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  +  S +PE+AG+  A++G++++M +V  +S  LG+ +AIYLEE++ K  F+ 
Sbjct: 52  YLDMQFLQSLPSRKPELAGVKTALIGTIWLMGVVAPVSLLLGVGTAIYLEEYAKKNKFTD 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F+Q NI+NLA VPSIV+G+LG  V +       ++ +  GL ++L+ LP II+A+  A+R
Sbjct: 112 FIQVNISNLAGVPSIVFGLLGLTVFVRAAGF-GTSVIAAGLTMSLLVLPIIIVASQEAIR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP  +R A+ G+GA+K QT+   V+P A+P ILTG  ++L+RA+GETAPL+ +G+  F+
Sbjct: 171 SVPKELREASYGMGATKWQTIVRVVMPAAVPGILTGGILALSRAIGETAPLVVLGLPLFL 230

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  V D+ T  P+QIY W    +  F       I++LL+ L  +N+  + +RN+F+K
Sbjct: 231 AFLPRSVFDMFTVLPMQIYNWTGRPQEEFQALAAAGIIVLLVLLIGMNSVAVLIRNKFQK 290

Query: 424 R 424
           R
Sbjct: 291 R 291


>gi|119356867|ref|YP_911511.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides DSM 266]
 gi|119354216|gb|ABL65087.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chlorobium phaeobacteroides DSM 266]
          Length = 448

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 110/444 (24%), Positives = 194/444 (43%), Gaps = 29/444 (6%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
           NL  R I +  F      +++V+ + L+ +L  IV  G+GA++ T      +   T  + 
Sbjct: 2   NLGTRKILDRSFTSIGFGSIIVMALALLFVLVPIVINGVGAVFFTGTLEHRKMLLTEFNR 61

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             +  ++        Y   +   LA   +  +      ++  Q      R  L+  L   
Sbjct: 62  GNRTAVEQQSASSESYRQQIYVMLADFETELEQMEPEQKREYQGRYAEVRSALQALLGPL 121

Query: 130 P----------------SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWF- 172
           P                    +     LL  +  D++    +     V R + +Q     
Sbjct: 122 PGDAPPVLTRLKYGQTRWEKAEEKLHGLLYESKWDTSDPTAMSKEYFVGRAASFQGTSLV 181

Query: 173 -------QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
                  + +           +GF  + +       GI   + G+ ++ +  +  +FP+G
Sbjct: 182 RLFPYVEKNIVHILEPEFTVYWGFLTDSSLDSHIFGGIWPEIQGTFFLAIGAMLFAFPVG 241

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGL 284
           + +A+Y  E++ +GFF+S +++  + LA VPSIV+G+ G A  IN  K+  S + L G L
Sbjct: 242 VIAAVYFTEYAKEGFFNSMLRSANSTLAGVPSIVFGLFGLAFFINTMKVSESKSVLAGSL 301

Query: 285 ILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL 344
            LA+M LP+II A   A+ +VP + + A+L LG++K  T+   ++P A+P ILTG  +SL
Sbjct: 302 TLAIMILPTIIRAAEEAILSVPKTYKEASLSLGSTKWNTIVTVIIPAALPGILTGGIISL 361

Query: 345 ARALGETAPLLFVGM--VAFVTDYPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAI 400
            RA GETAP++F     V          T    A    IY  A++ E         +G +
Sbjct: 362 GRAAGETAPIIFTAAVSVGSAIGLADVFTSPTPALSWNIYNLASEHEMAGEIRHVQYGMV 421

Query: 401 LLLLIFLAVINTAMLWLRNRFKKR 424
           L L+  + ++N + + LR R  K+
Sbjct: 422 LALVSIVLILNLSAILLRARISKK 445


>gi|326204678|ref|ZP_08194534.1| phosphate ABC transporter, inner membrane subunit PstA [Clostridium
           papyrosolvens DSM 2782]
 gi|325985245|gb|EGD46085.1| phosphate ABC transporter, inner membrane subunit PstA [Clostridium
           papyrosolvens DSM 2782]
          Length = 284

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 91/236 (38%), Positives = 145/236 (61%), Gaps = 1/236 (0%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF N  S  P+ AGI   + GS+Y++++ I  + P+G+ +A+YLEE++    F+ F++ 
Sbjct: 47  QFFTNFPSRFPKKAGILPGIYGSVYIIVLTILFAVPIGLGTAVYLEEYAKNNRFTKFIKI 106

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI+NL+  PSIVYG+LG  V +    +   + L G L ++L+ LP +I+++  A++ VP 
Sbjct: 107 NISNLSGTPSIVYGLLGLTVFVKTLGL-GKSILAGALTMSLVVLPIVIVSSQEAIKAVPQ 165

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
            +R  +  LGA+K QT+   V+P A+P I TG  +S++RALGETAPL+ VG   +V+  P
Sbjct: 166 YLRHGSYALGATKWQTIRKIVIPAALPGIFTGVILSVSRALGETAPLIMVGAATYVSKLP 225

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            G+  I TA P+QIY W    +  F +     I++LL  L   N   + LRN+++K
Sbjct: 226 EGLNSIFTALPMQIYYWMGLPKEQFKDLAAAGIIVLLGILLTTNAIAIVLRNKYQK 281


>gi|194336739|ref|YP_002018533.1| phosphate ABC transporter, inner membrane subunit PstA [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194309216|gb|ACF43916.1| phosphate ABC transporter, inner membrane subunit PstA [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 448

 Score =  196 bits (499), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 109/444 (24%), Positives = 192/444 (43%), Gaps = 29/444 (6%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
           N+  R I +  F      +++V+ + L++++  IV+ GIGA++ T      +        
Sbjct: 2   NIGTRKILDRSFTAVGFGSIIVMAMALMIVVVPIVTNGIGAVFFTGTVEHRKMLHNEFSR 61

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
              + +   +     Y   V   LA   +  ++     ++         R  L+  L   
Sbjct: 62  GDNQSLSSEVASSERYRAKVYDMLAVFETELETMEPEKKREYTGKYAQVRTALQALLGPL 121

Query: 130 P----------------SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWF- 172
           P                    +     LL  +  D++    +     V R   ++     
Sbjct: 122 PGDSAPMLTRFKYGQTRWEKAEEKLHDLLYESKWDNSNPNVMSKEYFVSRAIGFEGTSLV 181

Query: 173 -------QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
                  + L+          +GF  + +       GI   + G+ ++ +  +  +FPLG
Sbjct: 182 KLFPYVKENLEKILLPEFTVYWGFITDSSVDSHFFGGIWPEIQGTFFLAIGAMLFAFPLG 241

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGL 284
           + +A+Y  E++  GF +S +++  + LA VPSIV+G+ G A  IN  K+  S + L G L
Sbjct: 242 VIAAVYFTEYAKPGFLNSMLRSANSTLAGVPSIVFGMFGLAFFINTMKVSESKSVLAGAL 301

Query: 285 ILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL 344
            LA+M LP+II A   A+  VP + R A+L LG++K  T+   +LP A+P ILTG  +SL
Sbjct: 302 TLAIMILPTIIRAAEEAILAVPKTYREASLSLGSTKWNTIATVILPAALPGILTGGVISL 361

Query: 345 ARALGETAPLLFVGM--VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFV--ERTFGAI 400
            RA GETAP++F     V         ++    A    IY  A++ E         +G +
Sbjct: 362 GRAAGETAPIIFTAAVSVGSAIGLADVLSSPTPALSWNIYNLASEHEAASQIRHVQYGMV 421

Query: 401 LLLLIFLAVINTAMLWLRNRFKKR 424
           L L+  + ++N + + LR R  K+
Sbjct: 422 LALVSIVLLLNLSAIVLRARISKK 445


>gi|138896032|ref|YP_001126485.1| phosphate ABC transporter permease [Geobacillus thermodenitrificans
           NG80-2]
 gi|196248925|ref|ZP_03147625.1| phosphate ABC transporter, inner membrane subunit PstA [Geobacillus
           sp. G11MC16]
 gi|134267545|gb|ABO67740.1| Phosphate ABC transporter [Geobacillus thermodenitrificans NG80-2]
 gi|196211801|gb|EDY06560.1| phosphate ABC transporter, inner membrane subunit PstA [Geobacillus
           sp. G11MC16]
          Length = 289

 Score =  194 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 100/241 (41%), Positives = 155/241 (64%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  N  S RPE AG+   ++GSL++M+IV  +SF LG+ +AIYLEE++ K  F++
Sbjct: 49  WLDGDFLNNFPSRRPEEAGMKSGLIGSLWLMMIVAPVSFILGVGTAIYLEEYALKNRFTA 108

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F+Q NI+NL  VPSIV+G+LG  + +    + R + L  GL ++L+  P I++A   A+R
Sbjct: 109 FIQTNISNLTGVPSIVFGLLGLTIFVRELGLGR-SVLAAGLTMSLLVFPVIVVAAQEAIR 167

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP  +R A+  +GA+K QT+   VLP A+P +LTG+ ++L+RA+GETAPL+ +G+  F+
Sbjct: 168 AVPQQLREASYAMGATKWQTICRVVLPAALPGMLTGAILALSRAVGETAPLVVLGIPTFI 227

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P GV D  T  P+QIY W    +  F       I++LL FL ++N+  + +RN+F+K
Sbjct: 228 AYLPSGVLDTFTVMPLQIYNWTGRPQEEFQHVAAAGIVVLLGFLIMMNSVAVLIRNKFQK 287

Query: 424 R 424
           R
Sbjct: 288 R 288


>gi|220929518|ref|YP_002506427.1| phosphate ABC transporter inner membrane subunit PstA [Clostridium
           cellulolyticum H10]
 gi|219999846|gb|ACL76447.1| phosphate ABC transporter, inner membrane subunit PstA [Clostridium
           cellulolyticum H10]
          Length = 284

 Score =  194 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 91/241 (37%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 FF +  S  P+ AGI   + GS+Y++L+ I  + P+G+ +A+YLEE++    F+
Sbjct: 42  PYLTKNFFTSFPSRFPKKAGILPGIYGSVYIILLTILFAVPIGLGTAVYLEEYAKNNRFT 101

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ NI+NL+  PSIVYG+LG  V +    + +S    G L ++L+ LP +I+++  A+
Sbjct: 102 KFIKINISNLSGTPSIVYGLLGLTVFVKTLGLGKSIV-AGALTMSLVVLPIVIVSSQEAI 160

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP  +R  +  LGA+K QT+   V+P A+P I TG  +S++RALGETAPL+ VG   +
Sbjct: 161 KAVPQYLRHGSYALGATKWQTIRKIVIPTALPGIFTGVILSVSRALGETAPLIMVGAATY 220

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           V+  P G+  I TA P+QIY W    +  F +     I++LL  L   N   + LRN+++
Sbjct: 221 VSKLPEGLNSIFTALPLQIYYWMGLPKEQFKDLAAAGIIVLLAILLTTNAITIVLRNKYQ 280

Query: 423 K 423
           K
Sbjct: 281 K 281


>gi|257387839|ref|YP_003177612.1| phosphate ABC transporter inner membrane subunit PstA
           [Halomicrobium mukohataei DSM 12286]
 gi|257170146|gb|ACV47905.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halomicrobium mukohataei DSM 12286]
          Length = 565

 Score =  193 bits (490), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 102/290 (35%), Positives = 164/290 (56%), Gaps = 13/290 (4%)

Query: 147 IDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALF--------LDFNYGFFINGASSRP 198
           +   ++G +     V  ++               +            ++GF  +  S   
Sbjct: 275 VGIYVEGVVGRREGVRGLAFPVTAVLGVAVGSVVVEAAGFAGPDSWIDWGFLTSATSRTA 334

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH----KGFFSSFVQANINNLAS 254
             AGI  A+VGS+ M+++++  +FP+G+ +AIYLEE++      G F + V+ NI NLA 
Sbjct: 335 ADAGIYPAMVGSVMMIIVIVLATFPVGVGAAIYLEEYAPSEGPMGKFVTLVEINIGNLAG 394

Query: 255 VPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAAL 314
           VPS+VYG+LG A+ I   + P+ + +V GL + L+ LP +II++  A+R+VP S R A+ 
Sbjct: 395 VPSVVYGLLGLALFIRIVQWPQGSIVVAGLAVGLLILPIVIISSQEAIRSVPDSFRQASY 454

Query: 315 GLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIA 374
           G+GA++ QT+   VLP A+P ILTG+ ++L RA+GETAPLL +G  A V   P G  D+A
Sbjct: 455 GMGATRWQTIRQVVLPEALPGILTGTILALGRAIGETAPLLMIGAAASVRLAPNGFFDVA 514

Query: 375 TAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P QIY W+++ E  F        ++ LL  L V+N   + +RNR+++
Sbjct: 515 GMMPRQIYSWSSELEPAFRHGVLAAGVITLLAVLLVMNATAIVIRNRYQR 564


>gi|158320153|ref|YP_001512660.1| phosphate ABC transporter, inner membrane subunit PstA
           [Alkaliphilus oremlandii OhILAs]
 gi|158140352|gb|ABW18664.1| phosphate ABC transporter, inner membrane subunit PstA
           [Alkaliphilus oremlandii OhILAs]
          Length = 299

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 99/243 (40%), Positives = 147/243 (60%), Gaps = 2/243 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF- 241
              N+ F  +  S  P+ AGI  A+VGS++ + +    S P+G+ +AIYLEE++ K  + 
Sbjct: 56  EWINWDFITSMPSRFPQKAGIFSALVGSIWTIGLTALFSLPIGVGTAIYLEEYADKRTWH 115

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  +Q NI+NLA VPSIVYGILG  V + FF   R + L G L L L+ LP II++   A
Sbjct: 116 NKVLQLNISNLAGVPSIVYGILGLTVFVRFFNFER-SILSGALTLTLLILPVIIVSAQEA 174

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +++VP+S+R  +L LG +K QTV   VLP A+P ILTGS ++++RA+GE APL+ VG   
Sbjct: 175 IKSVPNSLREGSLALGVTKWQTVTGVVLPYALPGILTGSILAISRAMGEAAPLIMVGAAG 234

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           +V   P G  D  T  P+QI+ W +  +  F       I++L+  L   N   + LRN++
Sbjct: 235 YVAFLPRGPMDSFTVLPIQIFNWTSRPQAEFQNIASAGIIVLMFLLLSANAVAIILRNKY 294

Query: 422 KKR 424
           + R
Sbjct: 295 QNR 297


>gi|288931343|ref|YP_003435403.1| phosphate ABC transporter inner membrane subunit PstA [Ferroglobus
           placidus DSM 10642]
 gi|288893591|gb|ADC65128.1| phosphate ABC transporter, inner membrane subunit PstA [Ferroglobus
           placidus DSM 10642]
          Length = 282

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 100/242 (41%), Positives = 148/242 (61%), Gaps = 1/242 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  +  S  PE AGI  A+V S+YM+ +V     PLG+ +A+YLEE++ KG  + 
Sbjct: 37  WLDLQFLTSPPSRFPEKAGIYPALVSSVYMITLVGIFVLPLGVGAALYLEEYAKKGKLTR 96

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +  NI+NLA+VPSIVYG+LG  + +  FK+   T LVG L L L+ +P +I+    ALR
Sbjct: 97  IIDVNISNLAAVPSIVYGLLGIGLFVATFKLKPGTVLVGALTLTLLVVPIVIVTAQEALR 156

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S+R A+  LGA+K QT+   VLP A P ILTG  ++L+RA+GETAPL+ +GM   V
Sbjct: 157 AVPKSVREASFALGATKWQTIKEVVLPQAFPGILTGVILALSRAIGETAPLIMIGMATTV 216

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFK 422
              P  +   ATA P+QI++W    +  F+       +++LL  +  +N   ++LRNRF 
Sbjct: 217 FVAPKDIFSPATAMPLQIFMWTDMPQEEFLHGVAPAGVIVLLAVMLSMNALAIYLRNRFY 276

Query: 423 KR 424
           ++
Sbjct: 277 RK 278


>gi|304407965|ref|ZP_07389615.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus curdlanolyticus YK9]
 gi|304342984|gb|EFM08828.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus curdlanolyticus YK9]
          Length = 291

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 99/235 (42%), Positives = 144/235 (61%), Gaps = 1/235 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
            F N  S R   AG+  A+VG+LYM+ I++ LSF LG+ +AIYLEE++ K   +  +Q N
Sbjct: 56  LFNNFPSRRATQAGMKSAIVGTLYMLAIMLPLSFVLGVGAAIYLEEYAKKNRLTRIIQLN 115

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+ LA VPSIVYGILG  + +    + R + L G   + L+ LP II++   A+R VP S
Sbjct: 116 ISTLAGVPSIVYGILGLTIFVRMMHLDR-SLLSGAFTMTLLVLPIIIVSAQEAIRAVPKS 174

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
            R A+  LGA+K QTV   VLP ++  ILTG  ++++RA+GETAPL+ +G + FV   P 
Sbjct: 175 RRDASFALGATKWQTVARSVLPSSISGILTGVILAMSRAIGETAPLVMIGALTFVAFLPD 234

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              D  T  P+QIY W +  +  F E     I++LL  L ++N + + LRN++ K
Sbjct: 235 SPMDSFTVMPIQIYNWVSRPQEAFQELAAAGIIVLLAMLLLMNFSAIMLRNKYNK 289


>gi|110597977|ref|ZP_01386258.1| Phosphate transport system permease protein 2 [Chlorobium
           ferrooxidans DSM 13031]
 gi|110340426|gb|EAT58915.1| Phosphate transport system permease protein 2 [Chlorobium
           ferrooxidans DSM 13031]
          Length = 448

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 109/444 (24%), Positives = 198/444 (44%), Gaps = 29/444 (6%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
           NL  R + +  F    + +++++ + L+++L  IV+ G+GA++ T      +   +  + 
Sbjct: 2   NLGTRKLLDRSFTSVGIGSIVIMALALMVVLVPIVTNGLGAVFFTGTVEHRKMLLSEFNR 61

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
              R ++ AI     Y   V + L+   S   +     +   +      +  ++  L   
Sbjct: 62  GDSRELETAIASSDRYRAKVYEMLSGFESEMAAMTPERQDEYRPKYGQVKTAVQALLGPL 121

Query: 130 P----------------SLIGKTVEVSLLASANIDSALKGYL------YSPANVHRMSDY 167
           P                    +     LL     D++    +          +    S  
Sbjct: 122 PGDPEPMLTRFKYGQTRWEKAEEKLHDLLYETKWDNSDPNAMSKEYFANRSESFAGTSLV 181

Query: 168 QWKWFQKLDSDGALFLDF--NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
           +   + + +    L  +F   +GF  + +       GI   + G+ ++ +  +  +FPLG
Sbjct: 182 KLFPYVRENMSNMLLPEFTVYWGFITDSSVDSHIFGGIWPEIQGTFFLAVGAMLFAFPLG 241

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGL 284
           + +A+Y  E++  GFF+S +++  + LA VPSIV+G+ G A  IN  K+  S + + G L
Sbjct: 242 VIAAVYFTEYAKSGFFNSMLRSANSTLAGVPSIVFGMFGLAFFINTLKVSESKSVIAGSL 301

Query: 285 ILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL 344
            LA+M LP+II A   A+  VP + R A+L LG++K  T+   +LP A+P ILTG  +SL
Sbjct: 302 TLAIMILPTIIRAAEEAILAVPKTYREASLSLGSTKWNTIATVILPAALPGILTGGVISL 361

Query: 345 ARALGETAPLLFVGM--VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFV--ERTFGAI 400
            RA GETAP++F     V          +    A    IY  A++ E         +G +
Sbjct: 362 GRAAGETAPIIFTAAVSVGSAIGLADVFSSPTPALSWNIYNLASEHEAAAQIRHVQYGMV 421

Query: 401 LLLLIFLAVINTAMLWLRNRFKKR 424
           L L+  + ++N + + LR R  K+
Sbjct: 422 LALVSIVLLLNLSAIVLRARISKK 445


>gi|298484080|ref|ZP_07002248.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           D22]
 gi|298269761|gb|EFI11354.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           D22]
          Length = 291

 Score =  190 bits (483), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 135/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWDFITSAPTDGMTGGGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGKLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P G+ D   A P  +Y+ +         +   +G  L+L++ +  +N     LR  F
Sbjct: 225 PQLPTGIFDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIMIILFVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|237712827|ref|ZP_04543308.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262408816|ref|ZP_06085361.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_22]
 gi|294648190|ref|ZP_06725730.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           ovatus SD CC 2a]
 gi|294810768|ref|ZP_06769416.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           xylanisolvens SD CC 1b]
 gi|229447155|gb|EEO52946.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262353027|gb|EEZ02122.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_22]
 gi|292636465|gb|EFF54943.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           ovatus SD CC 2a]
 gi|294442101|gb|EFG10920.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           xylanisolvens SD CC 1b]
          Length = 291

 Score =  189 bits (481), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 135/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWNFITSAPTDGMTGGGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGKLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P G+ D   A P  +Y+ +         +   +G  L+L++ +  +N     LR  F
Sbjct: 225 PQLPTGIFDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIMIILFVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|218295961|ref|ZP_03496741.1| phosphate ABC transporter, inner membrane subunit PstA [Thermus
           aquaticus Y51MC23]
 gi|218243699|gb|EED10227.1| phosphate ABC transporter, inner membrane subunit PstA [Thermus
           aquaticus Y51MC23]
          Length = 401

 Score =  189 bits (480), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 112/341 (32%), Positives = 171/341 (50%), Gaps = 10/341 (2%)

Query: 85  YNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLAS 144
           +   +R AL ++    +   A+L+   ++ +   +  +     T    +   V       
Sbjct: 71  WQEALRAALLQEGYTEEEAEAMLKDPKELRALLNQNRVELMWNTHEGPLRYVVT------ 124

Query: 145 ANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIG 204
               S  +  L  P         + K          L    +  F     S  P +AGIG
Sbjct: 125 ---GSYDERVLDLPLLQGLRRWEELKAGLGEGERLVLNPWLDQTFLTRFPSRNPLIAGIG 181

Query: 205 VAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILG 264
           VAV G+++++ + + ++ P+G+ +AI LEE+  +G  +  ++ N+ NLA VPSIVYG+LG
Sbjct: 182 VAVAGTVWVLTLALLIAIPVGVGTAILLEEYLREGRLNRILEVNLRNLAGVPSIVYGLLG 241

Query: 265 SAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTV 324
            A  +    +   T L   L LAL+ +P I +    ALR VP S R AA  LGA++ Q V
Sbjct: 242 LAFFVREMGL-GPTVLAAALTLALLGIPVITVTAREALRAVPESQRQAAFALGATRRQVV 300

Query: 325 FHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLW 384
           F  VLP A+P ++TG  +S AR +GE APLL VG  A+V  YP G     T  PVQIYLW
Sbjct: 301 FRVVLPAALPGVVTGVILSAARLIGEAAPLLLVGAAAYVPFYPSGPLSEYTVIPVQIYLW 360

Query: 385 AADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            +  +  F       IL++L+ L+ +  A L+LRNRF++ W
Sbjct: 361 VSQPQPEFARVAAAGILVMLLVLSGLYLAALYLRNRFRREW 401


>gi|242280929|ref|YP_002993058.1| phosphate ABC transporter inner membrane subunit PstA
           [Desulfovibrio salexigens DSM 2638]
 gi|242123823|gb|ACS81519.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio salexigens DSM 2638]
          Length = 318

 Score =  189 bits (479), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 78/241 (32%), Positives = 131/241 (54%), Gaps = 3/241 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F            GI   +VG++ +    + ++ P GIA+AIYL E++        +
Sbjct: 76  SWEFLTENPRESMTAGGIFPCIVGTIVLSYGALMIALPWGIATAIYLNEYATSPRLVRII 135

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +  INNLA VPS+V+G+ G ++ +    M   + + G   L  + LP +I A+  ALR+V
Sbjct: 136 RLGINNLAGVPSVVFGLFGLSLFVTVMGMGV-SIMAGVCTLGALALPLVIGASEEALRSV 194

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R A+LGLGA+K QT++  VLP A+P +LTG+ ++L+RA GETA ++F   V F  +
Sbjct: 195 PQTYREASLGLGATKWQTIYKVVLPAALPGMLTGAILTLSRAAGETAAIMFTAAVFFTPE 254

Query: 366 YPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P  + D   A P  IY+ A             +G  L+L+  +  +N   +++R + +K
Sbjct: 255 MPESLFDDVMALPYHIYVLATAGTEIEKTRHIQYGTSLVLITLVLSMNMLAIYIRAKMQK 314

Query: 424 R 424
           +
Sbjct: 315 K 315


>gi|55378284|ref|YP_136134.1| phosphate ABC transporter permease [Haloarcula marismortui ATCC
           43049]
 gi|55231009|gb|AAV46428.1| phosphate ABC transporter permease protein [Haloarcula marismortui
           ATCC 43049]
          Length = 566

 Score =  189 bits (479), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 98/287 (34%), Positives = 162/287 (56%), Gaps = 13/287 (4%)

Query: 150 ALKGYLYSPANVHRMSDYQWKWFQKLDSDGA--------LFLDFNYGFFINGASSRPEVA 201
            ++G +     V  ++              A             ++GF  +  S     A
Sbjct: 278 YVEGVIRRGEGVRGLAFPVVAVLGVAAGAVATSALGFAGPNPWLDWGFLTSATSRTAADA 337

Query: 202 GIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH----KGFFSSFVQANINNLASVPS 257
           GI  ++VGS+ M+++++  +FP+G+ +AIYLEE++      G F + ++ NI NLA VPS
Sbjct: 338 GIYPSMVGSVMMIIVIVLTTFPVGVGAAIYLEEYAPSQGLMGKFVTLIEINIGNLAGVPS 397

Query: 258 IVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLG 317
           +VYG+LG A+ I   + P+ + +V GL + L+ LP +II+   A+R+VP S R A+ G+G
Sbjct: 398 VVYGLLGLALFIRVLQWPQGSVIVAGLAVGLLILPIVIISAQEAIRSVPDSFRQASYGMG 457

Query: 318 ASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAF 377
           A++ QT+   VLP A+P ILTG+ ++L RA+GETAPLL +G  A V   P    D+A+  
Sbjct: 458 ATRWQTIRQVVLPEALPGILTGTILALGRAIGETAPLLMIGAAASVRLAPNSFFDVASMM 517

Query: 378 PVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFKK 423
           P QI+ W+++ +  F        ++ LL  L V+N   + +RNR+++
Sbjct: 518 PRQIFSWSSELDPAFRHGVLAAGVITLLAVLLVMNATAIVIRNRYQR 564


>gi|242373682|ref|ZP_04819256.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis M23864:W1]
 gi|242348650|gb|EES40252.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis M23864:W1]
          Length = 301

 Score =  188 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 101/236 (42%), Positives = 153/236 (64%), Gaps = 1/236 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AG+  AV+GS+++++ +I ++  LGI +AIYLEE++    F+S V+ +
Sbjct: 66  FFTNFSSSTPADAGVKGAVIGSIWLIVSIIPITIILGIGTAIYLEEYAKDNIFTSIVKIS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPSIV+G+LG  + +    M  ++ L   L ++L+ LP II+++  A+R VP S
Sbjct: 126 ISNLAGVPSIVFGLLGYTLFVGAAGM-GNSVLAAALTMSLLILPVIIVSSQEAIRAVPGS 184

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +   P 
Sbjct: 185 VREASFGLGANKWQTIRKVVLPAALPGILTGFILSLSRALGETAPLVVIGIPTILLATPS 244

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           G+ D  +A P QIY WA   +  F       I++LL+ L  +N   + LRN+F K+
Sbjct: 245 GLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLAMNAIAILLRNKFSKK 300


>gi|332705973|ref|ZP_08426046.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1, membrane
           protein 2 [Lyngbya majuscula 3L]
 gi|332355233|gb|EGJ34700.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1, membrane
           protein 2 [Lyngbya majuscula 3L]
          Length = 302

 Score =  187 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 96/242 (39%), Positives = 155/242 (64%), Gaps = 2/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N  F  +  S +P+ AGI   ++GS+++++I   +SFPLG+ +AIYLEE++     +
Sbjct: 58  PRLNGQFISSPPSRKPDQAGIFPPLIGSVWLLVITAMVSFPLGVGAAIYLEEYATDNLLT 117

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFK--MPRSTALVGGLILALMTLPSIIIATGV 300
             ++ NI NLA+VPSI+YG+LG  V + +        + L G L L+L+ LP II+AT  
Sbjct: 118 QIIEINIANLAAVPSIIYGLLGLQVFVRWLAPITNGRSILTGALTLSLLILPIIIVATRE 177

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           +LR +P+S+R A   LGA++ Q +  H+ PLA+P ILTG+ ++L+RA+GETAPL+ +G +
Sbjct: 178 SLRAIPNSLRQAGYALGATRWQVIREHIFPLALPGILTGTILALSRAIGETAPLITIGAL 237

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           +F+T  P+   D  TA P+Q+Y W +  +  F       I++L+I L V+N   ++LRN+
Sbjct: 238 SFITRPPMNPQDPFTALPIQVYNWISRPQEAFHTNAAAGIVMLMIVLLVMNAGAIFLRNK 297

Query: 421 FK 422
           F+
Sbjct: 298 FQ 299


>gi|218779279|ref|YP_002430597.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfatibacillum alkenivorans AK-01]
 gi|218760663|gb|ACL03129.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfatibacillum alkenivorans AK-01]
          Length = 310

 Score =  187 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 132/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F            GI   +VG+L + L  + ++FP+G+ASAIYL E++  G   
Sbjct: 66  RAINWEFLTTAPYDSMTKGGILPCIVGTLCLGLGAMVVAFPIGVASAIYLNEYARPGKVL 125

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G A  + + +M  S    G L LA M+LP II A+  AL
Sbjct: 126 RIIRLGINNLAGVPSVVFGLFGLAFFVIYLEMGVSLL-AGALTLAAMSLPVIIGASEEAL 184

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           ++VP + R A+LGLGA+K QT++  VLP AMP ILTG  + L+RA GE AP++F   V F
Sbjct: 185 KSVPDTYREASLGLGATKWQTIYRVVLPAAMPGILTGGILGLSRAAGELAPVMFTAAVYF 244

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
               P          P  IY+ A             +G+ L+L++ +  +N A +  R R
Sbjct: 245 APKLPSSPFSEVMTLPYHIYVLATAGTEIEATRPLQYGSALVLIVLVLGMNLAAIIYRAR 304

Query: 421 FKKR 424
            + R
Sbjct: 305 LRNR 308


>gi|83816144|ref|YP_446399.1| phosphate ABC transporter, permease protein PstA [Salinibacter
           ruber DSM 13855]
 gi|294508336|ref|YP_003572394.1| phosphate transport system permease protein pstA [Salinibacter
           ruber M8]
 gi|83757538|gb|ABC45651.1| phosphate ABC transporter, permease protein PstA [Salinibacter
           ruber DSM 13855]
 gi|294344664|emb|CBH25442.1| Phosphate transport system permease protein pstA [Salinibacter
           ruber M8]
          Length = 314

 Score =  187 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 107/243 (44%), Positives = 153/243 (62%), Gaps = 1/243 (0%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
               +  F  +  S  P  AGI  A+ GSL++M +   +S PLG+ASA+YLEE++  G+F
Sbjct: 69  TPWLDGRFITSFPSRNPGEAGIKSALFGSLWLMGLTALISVPLGVASAVYLEEYARDGWF 128

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
              +Q NI NLA VPS+VYGILG A+ + F  + + + L G L L+L+ LP III+T  A
Sbjct: 129 LRLIQINIANLAGVPSVVYGILGLALFVRFAALGQ-SLLAGALTLSLLILPIIIISTQEA 187

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR++PS IR  A  LGA++ Q ++ HVLP+A P I TG  ++L+RA+GETAPL+ +G + 
Sbjct: 188 LRSIPSGIRENAYALGATRWQVIWSHVLPMAAPGIFTGVILALSRAIGETAPLILIGALT 247

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           FV   P G  D  TA P+QI+ W A  +  F      AI++L+I L  +N   + LRN F
Sbjct: 248 FVPFLPRGALDQFTALPIQIFNWTARPQSEFEGLAAAAIVVLMILLFTMNLTAILLRNYF 307

Query: 422 KKR 424
           ++R
Sbjct: 308 EER 310


>gi|224367369|ref|YP_002601532.1| PstA2 [Desulfobacterium autotrophicum HRM2]
 gi|223690085|gb|ACN13368.1| PstA2 [Desulfobacterium autotrophicum HRM2]
          Length = 284

 Score =  187 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 92/252 (36%), Positives = 140/252 (55%), Gaps = 3/252 (1%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
                  +   ++ F     +      GI   +VG+L +M + + ++ P+G+ASAIYL E
Sbjct: 31  WFMVSRGWRAISWSFLTMPPTDSMTRGGIFPCIVGTLCLMGVALVVALPVGVASAIYLNE 90

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++ +G F   ++  INNLA VPS+V+G+ G A      KM   + + GGL L LMTLP I
Sbjct: 91  YAAQGRFVRIIRLGINNLAGVPSVVFGLFGLAFFCIVLKMGV-SVIAGGLTLGLMTLPVI 149

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I  +  AL++VP + R A+LGLGA+K QT++  VLP A P I+TG  + L+RA GETAP+
Sbjct: 150 IGTSEEALKSVPKTYREASLGLGATKWQTIYRVVLPSAFPGIITGGILGLSRAAGETAPI 209

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINT 412
           ++ G V F  + P  + D   A P  IY+ A         R   +G  L+L+  +  +N 
Sbjct: 210 MYTGAVFFTPELPGSLFDEVMALPYHIYVLATAGTNIATTRPLQYGTALVLIALIFGMNL 269

Query: 413 AMLWLRNRFKKR 424
             + LR R +K+
Sbjct: 270 GAILLRTRIRKK 281


>gi|171058339|ref|YP_001790688.1| phosphate ABC transporter inner membrane subunit PstA [Leptothrix
           cholodnii SP-6]
 gi|170775784|gb|ACB33923.1| phosphate ABC transporter, inner membrane subunit PstA [Leptothrix
           cholodnii SP-6]
          Length = 306

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 88/251 (35%), Positives = 137/251 (54%), Gaps = 14/251 (5%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF +  S R   AGI  A VGS+ +M +   ++ P+GIA A+YLEE++ K +F+  ++ 
Sbjct: 57  DFFTSFPSRRAGQAGILSAWVGSILVMGVTALVAVPVGIAGAVYLEEYARKNWFTDVIEI 116

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI NLA VPSI+YG+L   + +  F + +S    G  +  L+ LP +I  T  ALR++P 
Sbjct: 117 NITNLAGVPSIIYGLLALGLFVYTFGLGQSILTAGLTLALLI-LPIVITTTREALRSIPQ 175

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
            +R  A   GAS+ Q V  H+LP + P ILTG  + L+RA+GETAP++ +G + F+   P
Sbjct: 176 HVREGAYACGASQYQVVSQHLLPYSTPGILTGVIIGLSRAIGETAPIITIGALTFIAFLP 235

Query: 368 -----------VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
                        +    T  P+QI+ W +  +  F +    A  +L+     +N   +W
Sbjct: 236 PVPFTEGVGAFDWLFSPFTVMPIQIFNWTSRPDPAFHQNAAAASFVLVFMTLGMNALAIW 295

Query: 417 LRNRFKK--RW 425
           LR R +K  +W
Sbjct: 296 LRYRLRKNIKW 306


>gi|239908521|ref|YP_002955263.1| putative phosphate transport system permease protein PstA
           [Desulfovibrio magneticus RS-1]
 gi|239798388|dbj|BAH77377.1| putative phosphate transport system permease protein PstA
           [Desulfovibrio magneticus RS-1]
          Length = 292

 Score =  187 bits (475), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 85/244 (34%), Positives = 134/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   ++G++Y+ L  + ++FPLG+ASA+YL E++  G   
Sbjct: 49  PAISWSFLTEMPRDSMTAGGILPCILGTIYLSLGTMCVAFPLGVASAVYLNEYARPGRTL 108

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G A  + FF +   + L G L L+++ LP II     AL
Sbjct: 109 RLIRLGINNLAGVPSVVFGLFGLAFFVTFFGLGV-SLLSGILTLSILVLPVIIGTAEEAL 167

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           ++VP + R A+LGLGA+K QT+   VLP AMP +LTG+ + L+R  GETA ++F   V F
Sbjct: 168 KSVPQTYREASLGLGATKWQTIRLVVLPAAMPGMLTGAILGLSRVAGETAAIMFTASVFF 227

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPF--VERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  +TD   A P  IY+ A             +G  L+L++ +  +N   +  R +
Sbjct: 228 TPYLPTNITDSVMALPYHIYVLATAGTDIDKTRPLQYGTALVLIVLVLGMNLGAILYRAK 287

Query: 421 FKKR 424
            +K+
Sbjct: 288 LQKK 291


>gi|76801637|ref|YP_326645.1| phosphate ABC transporter permease [Natronomonas pharaonis DSM
           2160]
 gi|76557502|emb|CAI49082.1| ABC-type transport system permease protein I (probable substrate
           phosphate) 1 [Natronomonas pharaonis DSM 2160]
          Length = 301

 Score =  187 bits (474), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 141/247 (57%), Gaps = 3/247 (1%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
             +   L    ++  F          AG+  A++GS++++ +    +  LG+ +AIYLEE
Sbjct: 55  WLTIDFLTHPPSW--FPENYQPGGRGAGLYPAIIGSVFLIALTALFTIFLGVGAAIYLEE 112

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++     + F++ANI NLA VPSIVYG+LG A+ +    +  S+ L G L L L+ LP +
Sbjct: 113 YAPDNRLTRFIEANIANLAGVPSIVYGLLGLAIFVRAAGL-GSSLLAGALTLTLLILPIV 171

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I++   A+R VP S R AA G+GA+K Q     VLP A+P I+TG+ +SL+RA+GETAP+
Sbjct: 172 IVSAQEAIRAVPDSRRQAAYGVGATKWQVTRDVVLPSALPGIMTGTILSLSRAIGETAPI 231

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           L VG   F+   P  +    +A P+Q++ WA   +  F        ++LL  L ++N   
Sbjct: 232 LMVGAATFMIAPPDSLLGPFSAMPMQVFEWAKQPDPAFQHIAAAGSIVLLTVLVLMNATA 291

Query: 415 LWLRNRF 421
           + +RN++
Sbjct: 292 ILIRNKY 298


>gi|254424358|ref|ZP_05038076.1| phosphate ABC transporter, permease protein PstA [Synechococcus sp.
           PCC 7335]
 gi|196191847|gb|EDX86811.1| phosphate ABC transporter, permease protein PstA [Synechococcus sp.
           PCC 7335]
          Length = 309

 Score =  187 bits (474), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 100/242 (41%), Positives = 150/242 (61%), Gaps = 2/242 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N+ F  +  S + E AGI  A+ G++++M +V   +FP+G+ + IYLEEF+   +F+ 
Sbjct: 65  TLNWNFVTSFPSRKAERAGIVAALAGTVWLMGLVALFAFPIGVGAGIYLEEFAGDNWFTR 124

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFK--MPRSTALVGGLILALMTLPSIIIATGVA 301
           FV+ NI NLA VPSI+YG+LG AV +   +      + L G L ++L+ LP +I+AT  A
Sbjct: 125 FVEINIGNLAGVPSIIYGLLGLAVFVRIMEPITGGRSVLSGSLTISLLILPIVIVATREA 184

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR +P S+R A   LGA++ Q V  HVLP A P ILTG  ++L+RA+GETA L+ VG   
Sbjct: 185 LRAIPESLRLAGYALGATRWQVVRSHVLPAAAPGILTGMILALSRAIGETASLIAVGAAV 244

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F++  P G+    TA P+QIY W +  +  F       I++L+  L V+N   ++LRNRF
Sbjct: 245 FISFLPEGLNSQFTAMPIQIYNWISRPQDEFHYIAASGIIVLMTALLVMNGLAIYLRNRF 304

Query: 422 KK 423
           ++
Sbjct: 305 QQ 306


>gi|221633803|ref|YP_002523029.1| phosphate ABC transporter permease PstA [Thermomicrobium roseum DSM
           5159]
 gi|221155671|gb|ACM04798.1| phosphate ABC transporter, permease protein PstA [Thermomicrobium
           roseum DSM 5159]
          Length = 298

 Score =  186 bits (472), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 110/242 (45%), Positives = 159/242 (65%), Gaps = 1/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  +  S RPE AGI  A+VGS Y++++V  ++FPLG+A+AIYLEEF+ +   +
Sbjct: 55  RALSWDFLTSYPSRRPEQAGIRSALVGSFYILILVALIAFPLGVAAAIYLEEFAPQNRLT 114

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           + ++ N++NLA+VPSIVYG+LG  V +  F + R + L G L L+L+ LP IIIA+  AL
Sbjct: 115 ATIEINLSNLAAVPSIVYGLLGLGVFVRTFMLGR-SLLAGALTLSLLVLPIIIIASREAL 173

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP SIR A L LGAS  QTV   VLP A+P ILTG+ ++LARA+GETAPL+ +G + +
Sbjct: 174 RAVPPSIREAGLALGASHWQTVRLFVLPAALPGILTGTILALARAIGETAPLITIGALTY 233

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           V   P  + D  T  P+QI+ W +  +  F ER    I++LL  L + N   ++LR R +
Sbjct: 234 VAFTPKSLFDPFTVLPIQIFNWISRPQPAFHERAAAGIIVLLAVLLLFNGLAIFLRARLQ 293

Query: 423 KR 424
           +R
Sbjct: 294 RR 295


>gi|327439647|dbj|BAK16012.1| ABC-type phosphate transport system, permease component
           [Solibacillus silvestris StLB046]
          Length = 292

 Score =  186 bits (472), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 102/237 (43%), Positives = 156/237 (65%), Gaps = 1/237 (0%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F  N AS  PE AGI  A+VGSL++M +V  +S  LG+++A+YLEE++ +   + F++ 
Sbjct: 56  NFITNFASRIPENAGIKAALVGSLWLMSVVAPVSIILGVSTALYLEEYAKQNKLNDFIRI 115

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           NI+NLA VPSIV+G+LG  + +  F     + L  GL ++L+ LP II+A   A+R+VP+
Sbjct: 116 NISNLAGVPSIVFGLLGLTIFVRLFGF-EKSILAAGLTMSLLILPVIIVAAQEAIRSVPN 174

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
             R A+ G+GA+K QT+   VLP A+P ILTGS ++L+RA+GETAPL+ +G+   +   P
Sbjct: 175 EQREASYGMGATKWQTIVRVVLPAAIPGILTGSILALSRAIGETAPLVVIGIPVILQFLP 234

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            G  D  TA P+QI+ WA   +  F       I++L+IFL  +N+  +++RN+F+KR
Sbjct: 235 TGYLDTFTALPMQIFDWAKRPQEAFQYVASAGIIVLMIFLLTMNSIAIFIRNKFQKR 291



 Score = 37.0 bits (84), Expect = 6.0,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 26/53 (49%)

Query: 5  SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHIS 57
           +  K +  R  S  +++   ++A     V L +LL  I+S+GIG L    I+
Sbjct: 7  DLVMKRMNKRLNSNKMWKIIFIIATSFALVSLGMLLYRILSQGIGFLDMNFIT 59


>gi|224476519|ref|YP_002634125.1| putative phosphate ABC transporter permease [Staphylococcus
           carnosus subsp. carnosus TM300]
 gi|222421126|emb|CAL27940.1| putative phosphate ABC transporter permease protein [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 309

 Score =  186 bits (471), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 100/246 (40%), Positives = 156/246 (63%), Gaps = 4/246 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 FF N +SS P++AGI  A+VG+L++M+ +I +S  LG+ +AIYLEE++H   F+
Sbjct: 63  PYLKPSFFTNFSSSMPQMAGIKGALVGTLWLMITIIPISIILGVGTAIYLEEYAHDNAFT 122

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIAT 298
           SF++ +I+NLA VPS+V+G+LG  + +    +       + L   L ++L+ LP II+++
Sbjct: 123 SFIKISISNLAGVPSVVFGLLGLTIFVRGMGIESLSLGKSVLAAALTMSLLILPVIIVSS 182

Query: 299 GVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVG 358
             A+R VP S+R A+ GLG +K QT++  VLP A+P I+TG  +SL+RALGETAPL+ +G
Sbjct: 183 QEAIRAVPKSVREASYGLGGNKWQTIYKIVLPAALPGIMTGFILSLSRALGETAPLILIG 242

Query: 359 MVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLR 418
           +   +   P  + D   A P+QIY WA   +  F       I++LLI L  +N   ++LR
Sbjct: 243 IPTILLRLPSSIFDQFQAMPIQIYNWAKMPQEAFQHVASAGIIVLLILLLAMNGLAIFLR 302

Query: 419 NRFKKR 424
           N+F K+
Sbjct: 303 NKFSKK 308


>gi|317484886|ref|ZP_07943776.1| phosphate ABC transporter [Bilophila wadsworthia 3_1_6]
 gi|316923868|gb|EFV45064.1| phosphate ABC transporter [Bilophila wadsworthia 3_1_6]
          Length = 291

 Score =  186 bits (471), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 83/245 (33%), Positives = 134/245 (54%), Gaps = 3/245 (1%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
               ++ F            G+   +VG+  +    + ++FPLG+ASA+YL E+  KG +
Sbjct: 47  SPAISWEFLTEPPRRMMTAGGVWPCIVGTFLLAFGAMLIAFPLGVASAVYLHEYGGKGRY 106

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + +++  I+NLA VPS+V+G+ G A  + F  M   + L G L LA++TLP II  T  A
Sbjct: 107 TRYLRLGISNLAGVPSVVFGLFGLAFFVTFLGMGV-SLLAGVLTLAVLTLPVIINTTEEA 165

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR VP + R A+L LGA++ QT+   VLP A+P +LTG+ + LARA GETA ++F   V 
Sbjct: 166 LRQVPDAWREASLALGATRSQTIARVVLPAAVPGMLTGAILGLARAAGETAAIMFTAAVF 225

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRN 419
           +    P  V     + P  +Y+ A             +G  L+LL+ +  +N   + +R+
Sbjct: 226 YTPKMPDSVFSAVMSLPYHMYVLATAGTEIEKTRPLQYGTALILLVLVLGMNLIAIIIRD 285

Query: 420 RFKKR 424
           R +++
Sbjct: 286 RMQRK 290


>gi|303248512|ref|ZP_07334770.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio fructosovorans JJ]
 gi|302490132|gb|EFL50052.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio fructosovorans JJ]
          Length = 292

 Score =  185 bits (470), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 86/244 (35%), Positives = 135/244 (55%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   ++G++Y+ L  + ++FPLG+ASA+YL E++  G   
Sbjct: 49  PAISWSFLTEMPRDSMTAGGILPCILGTIYLSLGTMAVAFPLGVASAVYLNEYATPGRTL 108

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G A  + FF +   + L G L L+++ LP II     AL
Sbjct: 109 RLIRLGINNLAGVPSVVFGLFGLAFFVTFFGLGV-SLLSGILTLSILVLPVIIGTAEEAL 167

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           ++VP + R A+LGLGA+K QT+   VLP AMP +LTG+ + L+RA GETA ++F   V F
Sbjct: 168 KSVPQTYREASLGLGATKWQTIRLVVLPAAMPGMLTGAILGLSRAAGETAAIMFTAAVFF 227

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPF--VERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  +TD   A P  IY+ A             +G  L+L++ +  +N   +  R +
Sbjct: 228 TPYLPTHLTDSVMALPYHIYVLATAGTEIDKTRPLQYGTALVLIVLVLGMNLGAILYRAK 287

Query: 421 FKKR 424
            +K+
Sbjct: 288 LQKK 291


>gi|212638724|ref|YP_002315244.1| phosphate ABC transporter permease [Anoxybacillus flavithermus WK1]
 gi|212560204|gb|ACJ33259.1| ABC-type phosphate transport system, permease component
           [Anoxybacillus flavithermus WK1]
          Length = 293

 Score =  185 bits (470), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 106/241 (43%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N+ F  N  S RPE AGI   +VGSL++M+IV  +S  LG+ +AIYLEE++ K  F+ 
Sbjct: 53  WLNFDFLNNFPSRRPEDAGIKAGLVGSLWLMVIVAPVSLILGVGTAIYLEEYAKKNRFTD 112

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F+Q NI+NLA VPSIV+G+LG  + +    + R + L  GL ++L+ LP I++A   ALR
Sbjct: 113 FIQTNISNLAGVPSIVFGLLGLTLFVRELNLGR-SILAAGLTMSLLVLPVIVVAAQEALR 171

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP+ +R A+ G+GA+K QT++  VLP A+P ILTGS ++L+RA+GETAPL+ +G+  F+
Sbjct: 172 AVPNQLREASYGMGATKWQTIYRIVLPAAIPGILTGSILALSRAIGETAPLVVLGIPTFL 231

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P G+ D  T  P+QIY W +  +  F       I++LL+ L ++N+  +++RN+F+K
Sbjct: 232 AYLPRGILDTFTVMPMQIYNWTSRPQADFQHVAAAGIVVLLVVLILMNSIAIFIRNKFQK 291

Query: 424 R 424
           R
Sbjct: 292 R 292


>gi|330684710|gb|EGG96408.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis VCU121]
          Length = 309

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 156/241 (64%), Gaps = 4/241 (1%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF N +SS P +AG+  A+VG+L++M+ +I +S  LG+ +AIYLEE++ K  F++FV+ 
Sbjct: 68  SFFTNFSSSTPSMAGVKGALVGTLWLMITIIPISIVLGVGTAIYLEEYARKNPFTNFVKV 127

Query: 248 NINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATGVALR 303
            I+NLA VPS+V+G+LG  + +    +       + L G L ++L+ LP II+A   A+R
Sbjct: 128 CISNLAGVPSVVFGLLGLTLFVRGMGVESLSLGKSILAGALTMSLLILPVIIVAAQEAIR 187

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S+R A+ GLGA+K QT++  VLP A+P ILTG  ++L+RALGETAPL+ +G+   +
Sbjct: 188 AVPKSVREASYGLGANKWQTIYKVVLPAALPGILTGFILALSRALGETAPLILIGIPTIL 247

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P G+ D   A P+QIY WA   +  F       I++LL+ L ++N   ++ RN+F K
Sbjct: 248 LRLPSGIMDQFQALPIQIYNWAKMPQEEFQNVASAGIIVLLVILLLMNGLAIFFRNKFSK 307

Query: 424 R 424
           +
Sbjct: 308 K 308


>gi|78356107|ref|YP_387556.1| phosphate ABC transporter permease [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78218512|gb|ABB37861.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 297

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 126/244 (51%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F            GI   ++G++ +    + ++ P G+ +AIYL E++  G F 
Sbjct: 53  PAVNWEFLTAHPRDAMTAGGIFPCILGTIALSYGSMLIALPWGVCTAIYLHEYARPGPFV 112

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G A  +   +M   + L G   LA + LP II A+  AL
Sbjct: 113 HAMRLAINNLAGVPSVVFGLFGLAFFVTLMQMGV-SLLAGMFTLAALILPLIIGASEEAL 171

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+V  + R A+L LGA+K QT+   VLP A P ILTG+ + + RA GETA ++F   + F
Sbjct: 172 RSVSQTYREASLALGATKWQTLAKVVLPAATPGILTGAILGIGRAAGETAAIMFTAAMFF 231

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  V D   A P  IY+ A             +G  L+L++ +  +N   + +R R
Sbjct: 232 SPKLPGSVFDSVMALPYHIYVLATAGIDIEKTRPLQYGTALVLIVLVLGMNLLAIIIRAR 291

Query: 421 FKKR 424
            +++
Sbjct: 292 LQRK 295


>gi|302391643|ref|YP_003827463.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Acetohalobium arabaticum DSM 5501]
 gi|302203720|gb|ADL12398.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Acetohalobium arabaticum DSM 5501]
          Length = 283

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 91/243 (37%), Positives = 134/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N+GF            GI  A+VG+  + LI   ++ PLGI +AIYL E++++G  + 
Sbjct: 40  VINWGFITEAPKQGMTAGGIWPAIVGTFLVTLITAAVAIPLGIFAAIYLNEYANQGKITR 99

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +I NLA VPSIVYG+ G A  +N   +  ++ L  GL L LMTLP  I A+  AL+
Sbjct: 100 LIRMSIRNLAGVPSIVYGLFGLAFFVNILGL-GTSVLSAGLTLGLMTLPVTITASEEALK 158

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP + R  AL LGASK  ++  +VLP A+P ILTG+ + LARA GETAP+LF G   F+
Sbjct: 159 AVPDAYRQGALALGASKWYSIRTNVLPHAIPGILTGTILGLARAAGETAPILFTGAAFFL 218

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFV--ERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  ++    A P  +Y+ A             +G  L+L+  +  +N   + LR   
Sbjct: 219 PFLPKSLSSQFMALPYHLYIMATQHHDIAQVRPLAYGTALVLITLVLAMNLIAILLRFWL 278

Query: 422 KKR 424
           +K+
Sbjct: 279 RKK 281


>gi|76803411|ref|YP_327680.1| phosphate ABC transporter permease [Natronomonas pharaonis DSM
           2160]
 gi|76559226|emb|CAI50830.1| ABC-type transport system permease protein I (probable substrate
           phosphate) 2 [Natronomonas pharaonis DSM 2160]
          Length = 303

 Score =  184 bits (468), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 101/235 (42%), Positives = 148/235 (62%), Gaps = 2/235 (0%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F     S RPE++G   A+V S+ +M +   LSF +G+ SAIYLEE++     +  ++A
Sbjct: 68  DFVTRDGSRRPELSGFRGAIVASVMLMALTAFLSFFIGVGSAIYLEEYAPDNRITRLIEA 127

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           N+ NLA VPSIVYG+L  A L N   +     LVGG+ LAL+ +P II+++  ALR VP 
Sbjct: 128 NLANLAGVPSIVYGLLALAALRNGIGL-GPIVLVGGVALALLVMPIIIVSSQEALRAVPD 186

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           S+R  +   GA++ QT+   VLP A+P I TG+ ++LARA+GETAPLL VG + FV   P
Sbjct: 187 SVRRGSYATGATQWQTIRKVVLPAALPGIFTGTILALARAIGETAPLLMVGAL-FVNRMP 245

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
            G+ D  +  P QIY WAA+  + F+      I++LL F+ V+N   ++LRN+++
Sbjct: 246 RGLMDRFSGMPTQIYSWAAEPSQHFIHLAAVGIVVLLTFMLVMNGIAVYLRNKYE 300


>gi|257093587|ref|YP_003167228.1| phosphate ABC transporter inner membrane subunit PstA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046111|gb|ACV35299.1| phosphate ABC transporter, inner membrane subunit PstA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 318

 Score =  184 bits (468), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 91/256 (35%), Positives = 144/256 (56%), Gaps = 14/256 (5%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           F   ++ FF +  S R   AGI  A VG++ +ML+   ++ PLG+ + IYLEE++ K   
Sbjct: 61  FPHLSWDFFTSFPSRRAASAGILSAWVGTILVMLVTAVVAVPLGVGAGIYLEEYAPKNLL 120

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ N+ NLA VPSI+YG+L  A+ +  F + + +    GL LAL+ LP +I+AT  A
Sbjct: 121 TDIIEINVTNLAGVPSIIYGLLALALFVYQFGLGQ-SIAAAGLTLALLILPVVIVATREA 179

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +RT+P  IR  A   GA+K Q V HH++P ++P I+TG  + LARA+GETAP++ +G + 
Sbjct: 180 IRTIPQQIREGAYACGATKWQVVAHHIVPYSLPGIMTGVIIGLARAIGETAPIITIGALT 239

Query: 362 FVTDYPVGVTD-------------IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           F+   P                    T  P+Q++ W +  E  F      A L+L++   
Sbjct: 240 FIAFLPPSPFGNPGHLISFDWLTAPFTVMPIQMFNWISRPEAAFQANAAAAGLVLVVMTL 299

Query: 409 VINTAMLWLRNRFKKR 424
            +N   +W+R  F+KR
Sbjct: 300 SMNAIAIWIRYHFRKR 315


>gi|283853671|ref|ZP_06370903.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio sp. FW1012B]
 gi|283570942|gb|EFC18970.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio sp. FW1012B]
          Length = 292

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 85/244 (34%), Positives = 133/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   ++G++Y+ L  + ++FPLG+ASA+YL E++  G   
Sbjct: 49  PAISWSFLTEMPRDSMTAGGILPCILGTIYLSLGTMAVAFPLGVASAVYLNEYATPGRTL 108

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G A  + FF +   + L G L L+++ LP II     AL
Sbjct: 109 RLIRLGINNLAGVPSVVFGLFGLAFFVTFFGLGV-SLLSGILTLSILVLPVIIGTAEEAL 167

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP + R A+LGLGA+K QT+   VLP AMP +LTG+ + L+R  GETA ++F   V F
Sbjct: 168 KAVPQTYREASLGLGATKWQTIRLVVLPAAMPGMLTGAILGLSRVAGETAAIMFTAAVFF 227

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPF--VERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  +TD   A P  IY+ A             +G  L+L++ +  +N   +  R +
Sbjct: 228 TPYLPTNLTDSVMALPYHIYVLATAGTDIDKTRPLQYGTALVLIVLVLGMNLGAILYRAK 287

Query: 421 FKKR 424
            +K+
Sbjct: 288 LQKK 291


>gi|323699485|ref|ZP_08111397.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio sp. ND132]
 gi|323459417|gb|EGB15282.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio desulfuricans ND132]
          Length = 310

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 88/249 (35%), Positives = 138/249 (55%), Gaps = 6/249 (2%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           F   ++ F     +      GI   +VG+ Y+ L  + L+ PLG+A+AIYL E++  G F
Sbjct: 60  FPAISWDFLTTQPTEGGLAGGIFPCIVGTFYLSLGSMALALPLGVAAAIYLHEYAAPGPF 119

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS----TALVGGLILALMTLPSIIIA 297
              V+  INNLA VPS+V+G+ G A  +    +       +   G + LA++ LP II  
Sbjct: 120 MRVVRLCINNLAGVPSVVFGLFGMAFFVAGRDLGGLGMGVSIASGCMTLAVLILPVIIGT 179

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           +  ALR+VP++ R A+LGLGA+K QT+F  VLP AMP +LTGS +S++RA GETA ++F 
Sbjct: 180 SEEALRSVPNTYREASLGLGATKWQTIFKVVLPSAMPGVLTGSILSISRAAGETAAIMFT 239

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVINTAML 415
              ++    P  + D   A P QIY  +  +      +   +G  L+L+  +  +N   +
Sbjct: 240 AAASYNPTLPGSIFDEVMALPYQIYSLSVSSTDPEATLPLQYGTSLVLVALVLGMNLVAI 299

Query: 416 WLRNRFKKR 424
            LR+  +K+
Sbjct: 300 MLRSHLRKK 308


>gi|325300706|ref|YP_004260623.1| phosphate ABC transporter, inner membrane subunit PstA [Bacteroides
           salanitronis DSM 18170]
 gi|324320259|gb|ADY38150.1| phosphate ABC transporter, inner membrane subunit PstA [Bacteroides
           salanitronis DSM 18170]
          Length = 294

 Score =  184 bits (467), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 130/243 (53%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N+ F     +      GI  A+VG+ Y+M+     SFP+G+ S IY+ E++ KG   +
Sbjct: 49  VINWDFLTQAPTDGMTKGGILPAIVGTFYLMIGSAVFSFPVGVMSGIYMNEYAPKGKMVN 108

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNLA +PSIV+G+ G A  +N+      + + G L L L+ LP +I  T  A +
Sbjct: 109 FIRTMTNNLAGIPSIVFGLFGMAFFVNYLDF-GDSIIAGSLTLGLLALPIVIRTTEEAFK 167

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P+S R  +L LGA+K QT++  +LP+AMP I+TG  +SL R  GETAP+LF     F+
Sbjct: 168 DIPNSYREGSLALGATKAQTIWKVLLPMAMPRIITGLILSLGRVSGETAPILFTCAAYFL 227

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ A             +G   +L++ + ++N     +R  F
Sbjct: 228 PKLPESIFDQCMALPYHLYVIATSGTDIEAQTPIAYGTAFVLIVIVLIMNLLANNIRKYF 287

Query: 422 KKR 424
           + +
Sbjct: 288 ENK 290


>gi|226349693|ref|YP_002776807.1| putative phosphate ABC transporter permease protein [Rhodococcus
           opacus B4]
 gi|226245608|dbj|BAH55955.1| putative phosphate ABC transporter permease protein [Rhodococcus
           opacus B4]
          Length = 303

 Score =  184 bits (466), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 99/244 (40%), Positives = 144/244 (59%), Gaps = 2/244 (0%)

Query: 184 DFNYGFFINGASSRPEV-AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS-HKGFF 241
            F++       S      +G+  A+ G+L++ML  I L+ P+GIA A+YLEE++    ++
Sbjct: 60  RFDWNLISQQPSRLHPETSGVQSAIFGTLWVMLGTIILAIPIGIAGAVYLEEYADSTKWW 119

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NI NL +VP+I+YGIL  A ++          L G + LAL+ LP III T  A
Sbjct: 120 NRLIELNIQNLVAVPTIIYGILTLAFVVRGPISLGPVVLAGSVALALLILPVIIITTREA 179

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR+VP  IR A+L LGA+  QT +  VLP A+  I TG+ ++L+RA+GE APLL VG   
Sbjct: 180 LRSVPRDIRDASLALGATLWQTTWKQVLPSAISGIATGTILALSRAIGEAAPLLLVGATV 239

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           FVT  P G  D  T  PVQI+      E    +  +  ILLL++ L  +N   +W+RNRF
Sbjct: 240 FVTVNPEGFLDRYTVLPVQIFNLVKLPEEANQQLAWATILLLMVILLAMNGLAIWMRNRF 299

Query: 422 KKRW 425
           ++RW
Sbjct: 300 QRRW 303


>gi|302342496|ref|YP_003807025.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfarculus baarsii DSM 2075]
 gi|301639109|gb|ADK84431.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfarculus baarsii DSM 2075]
          Length = 290

 Score =  184 bits (466), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 86/243 (35%), Positives = 135/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F            GI  A+VG+LY+ +  I +S PLG+A+AIYL E++  G    
Sbjct: 46  AISWEFLTEAPRDAMTKGGIFPAIVGTLYLTIGAIVVSLPLGVAAAIYLSEYARDGRLLQ 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            V+  I NLA VPS+V+G+ G A+ + FF M   + L G L L L+ LP++I A+  ALR
Sbjct: 106 IVRLGIQNLAGVPSVVFGLFGLALFVGFFGM-GISMLAGSLTLGLLVLPTVIGASEEALR 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP + R A+L LGA++ +T++  VLP A+P ILTGS ++L RA GETAP++F  +  + 
Sbjct: 165 QVPPTFREASLALGATRWETIYKVVLPAALPGILTGSILALGRAAGETAPIMFTAVTFYT 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P        A P  +Y+ A             +G +L+L+  +  ++   + +R R 
Sbjct: 225 LHLPTSPLHEVMALPYHVYVLATAGTHIEQTRPLQYGTVLVLIALVLGLSLVAVIIRTRM 284

Query: 422 KKR 424
           +K+
Sbjct: 285 RKK 287


>gi|170078882|ref|YP_001735520.1| phosphate ABC transporter, permease protein [Synechococcus sp. PCC
           7002]
 gi|169886551|gb|ACB00265.1| phosphate ABC transporter, permease protein [Synechococcus sp. PCC
           7002]
          Length = 303

 Score =  183 bits (465), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 96/247 (38%), Positives = 154/247 (62%), Gaps = 6/247 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++    +  S RPE AG+  A+VG++++M++   ++FP+G+ + I+LEEFS +  F+
Sbjct: 57  PRLDWKLLTSFPSRRPEDAGLKSALVGTIWLMILTAIITFPIGVGAGIFLEEFSAENTFT 116

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFF--KMPRSTALVGGLILALMTLPSIIIATGV 300
             ++ NINNLA+VPSI+YG+LG  V +          + L G L L+L+ LP +I+AT  
Sbjct: 117 KIIEVNINNLAAVPSIIYGLLGLQVFVRLLSPMTGGRSVLAGALTLSLLILPIVIVATRE 176

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           AL+ VP S+R A L LGA+K Q V   + PLA+P ILTG+ ++L+RA+GETAPL+ +G +
Sbjct: 177 ALKAVPDSLRQAGLALGATKWQVVREQIFPLALPGILTGTILALSRAIGETAPLITLGAL 236

Query: 361 AFVTDYPV----GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
            F+   P     G+    TA P+QI+ W +  +  F       I++L++ L  +N   ++
Sbjct: 237 TFIAFLPSLSLEGLQTPFTALPIQIFNWVSRPQEEFHTVAAAGIIVLMVVLLAMNGTAIF 296

Query: 417 LRNRFKK 423
           LRN+F+K
Sbjct: 297 LRNKFQK 303



 Score = 38.1 bits (87), Expect = 2.3,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 23/48 (47%)

Query: 2  KSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
           + ++    LK RY  +  F+    +AV++  V L +LL  +   G+ 
Sbjct: 10 NTNTLFDTRLKTRYRWDTAFQTLSWIAVILSIVVLAVLLIDVFFDGLP 57


>gi|289550795|ref|YP_003471699.1| Phosphate transport system permease protein PstA [Staphylococcus
           lugdunensis HKU09-01]
 gi|315658290|ref|ZP_07911162.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus lugdunensis M23590]
 gi|289180327|gb|ADC87572.1| Phosphate transport system permease protein PstA [Staphylococcus
           lugdunensis HKU09-01]
 gi|315496619|gb|EFU84942.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus lugdunensis M23590]
          Length = 306

 Score =  183 bits (465), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF N +SS P  AGI  A+VG+L++ML +I  S  LG+ +AIYLEE++ K  F+ F++ 
Sbjct: 65  SFFTNFSSSTPSQAGIKGALVGTLWLMLTIIPFSIILGVGTAIYLEEYAKKNPFTDFIKV 124

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMP----RSTALVGGLILALMTLPSIIIATGVALR 303
            I+NLA VPS+V+G+LG  + +    +      ++ L G L + L+ LP II+A   A+R
Sbjct: 125 CISNLAGVPSVVFGLLGLTIFVRGMNIQALSLGNSILAGALTMTLLILPVIIVAAQEAIR 184

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VPSS+R A+ GLGA+K QT+   VLP A+P ILTG  ++L+RALGETAPL+ +G+   +
Sbjct: 185 AVPSSVREASYGLGANKWQTIRKVVLPAALPGILTGFILALSRALGETAPLILIGIPTIL 244

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  V D   A P+ IY WA   +  F       I++LL+ L ++N   ++ RN+F K
Sbjct: 245 LRLPNSVMDQFQALPMAIYNWAKLPQAEFQNVASAGIIVLLVILLLMNGLAIYFRNKFSK 304

Query: 424 R 424
           +
Sbjct: 305 K 305


>gi|149182007|ref|ZP_01860493.1| phosphate ABC transporter (permease) [Bacillus sp. SG-1]
 gi|148850272|gb|EDL64436.1| phosphate ABC transporter (permease) [Bacillus sp. SG-1]
          Length = 294

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 101/243 (41%), Positives = 157/243 (64%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             + GF     S  PE AGI  A++G++++ML+V  ++  LG+ +AIYLEE++ +G   S
Sbjct: 52  WIDMGFLSGKLSVNPEKAGILGAILGTVWLMLVVAPVTMFLGVGTAIYLEEYAKEGKLKS 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +Q NI+NLA VPS+V+GILG  V +    +  +  L GGL ++L+ LP +++A+  ALR
Sbjct: 112 IIQTNISNLAGVPSVVFGILGLTVFVRMADL-GNIVLAGGLTMSLLVLPIVVVASQEALR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP  +R A+ G+GA+K QTV + VLP A+P ILTG  ++L+RA+GETAPL+ +G+ A +
Sbjct: 171 SVPQFLREASYGMGATKWQTVKNIVLPTAIPGILTGVILALSRAIGETAPLVVIGIPALL 230

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P GV D  T  P+QIY W  D+     +       I++LL+ L  +N+  + +RN+F
Sbjct: 231 IPLPDGVFDKFTVMPMQIYYWTVDSALTDEYAYLAAATIVVLLVVLFAMNSIAIVIRNKF 290

Query: 422 KKR 424
           +KR
Sbjct: 291 QKR 293


>gi|158521938|ref|YP_001529808.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfococcus oleovorans Hxd3]
 gi|158510764|gb|ABW67731.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfococcus oleovorans Hxd3]
          Length = 294

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 85/244 (34%), Positives = 133/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F     +      GI   ++G+ Y+    I  + P+G+ASA+Y+ E++ KG   
Sbjct: 49  EAISWEFLTQPPTDSMTKGGIFPCILGTFYLAAGAICFALPIGVASAVYMNEYAAKGRVL 108

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPSIV+G+ G A       +   + L G L L ++TLP II AT  AL
Sbjct: 109 RIIRFGINNLAGVPSIVFGLFGLAFFCIVLGLGV-SLLAGILTLGVLTLPVIIGATEEAL 167

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP   R A+L LGA++ QT++  VLP A+P ILTG+ + L+RA GETAP++F   V F
Sbjct: 168 KAVPDDYRKASLALGATQWQTIYRVVLPAAIPEILTGAILGLSRAAGETAPIMFTAAVFF 227

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNR 420
               P  + D   A P  IY+ A       + R   +G  L+L++ +  +N   +  R++
Sbjct: 228 TPVLPSSLFDEVMALPYHIYVLATAGTDIALTRPLQYGTALVLIVLVCGMNLFAIITRSK 287

Query: 421 FKKR 424
            +K+
Sbjct: 288 MRKK 291


>gi|305665603|ref|YP_003861890.1| phosphate ABC transporter permease [Maribacter sp. HTCC2170]
 gi|88710359|gb|EAR02591.1| phosphate ABC transporter, permease protein [Maribacter sp.
           HTCC2170]
          Length = 284

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 95/243 (39%), Positives = 161/243 (66%), Gaps = 1/243 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++GF  +  S +PE +GI  A++GS++++L+   ++FPLG+A+ IYLEE+  K  F+
Sbjct: 42  RRIDWGFISSLPSRKPEKSGIYTALMGSIWILLLTTVIAFPLGVAAGIYLEEYGKKNRFA 101

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NI+NLA VPSI+YG+LG  V +    +  ++ L G L L+L+ LP +I+AT  A+
Sbjct: 102 GILEINISNLAGVPSIIYGLLGLEVFVRIMNL-GASVLAGSLTLSLLILPIVIVATREAI 160

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP++++ A+  LGASK QT++H +LP +   ILTG  ++L+RA+GETAPL+ VG +A+
Sbjct: 161 KAVPTTVKDASYALGASKWQTIWHQILPASSGGILTGVILALSRAVGETAPLIVVGALAY 220

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           V   P    D  +  P+QI+ W +  +  F+E    AI++LL+   ++N   ++ RN+++
Sbjct: 221 VPFAPESPMDEFSVLPIQIFNWISRPQHGFIENAAAAIIILLLITFIMNGIAVYFRNKWQ 280

Query: 423 KRW 425
           K+W
Sbjct: 281 KKW 283


>gi|293400680|ref|ZP_06644825.1| phosphate ABC transporter, permease protein PstA
           [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305706|gb|EFE46950.1| phosphate ABC transporter, permease protein PstA
           [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 414

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 106/446 (23%), Positives = 191/446 (42%), Gaps = 60/446 (13%)

Query: 5   SINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGAL------------- 51
              +     R  ++ +       + ++  + L+ +   I SKG G L             
Sbjct: 3   ETMRNQKNKRRYTDGILNMLTYASSVICVLLLLSIFIFIFSKGSGMLGMKLLTGDYWAKN 62

Query: 52  WQTHISLPIEFSETIVDPQKKRF----MDPAILLRADYNLLVRKALARKLSISDSN---- 103
           + T I        T   P+         +   +   D      +A+    +I D++    
Sbjct: 63  YMTSIQEKNNHPSTYKSPEDASDDMYWSERWGVGFVDARNENNEAIVLVEAIDDASPFAH 122

Query: 104 -HALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVH 162
                RQ    +S  + Y L             T   + LA   +    K  +    +  
Sbjct: 123 LKDESRQNKPSISAESGYLLENLSYQ------TTQGTTRLAGNIVSQDAKT-VARLLDQD 175

Query: 163 RMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSF 222
            +S  +  +                         +    GI  +++ +LY+++I + ++ 
Sbjct: 176 AVSINKIYF-------------------------KTPGGGIRGSLLTTLYLIMISLLIAL 210

Query: 223 PLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPR---STA 279
           PLGI +AIYL E++ K   +S +++ I  L  VPSI++G++G AVL    K+     +  
Sbjct: 211 PLGIGAAIYLHEYAAKNKITSGIRSAIEMLTGVPSIIFGLMGVAVLFPLTKLAGADTTNV 270

Query: 280 LVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTG 339
           L+G L +A++ LP II +   AL  VP ++R A+L LGA++ QT+F  VLP A+P IL+G
Sbjct: 271 LLGSLTMAIILLPIIIRSCEEALAIVPQTLRDASLSLGANQSQTIFKIVLPCAVPGILSG 330

Query: 340 STVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA 399
             +S+ R +GE+A L++  M  +V D P  +    T+  V IY   +  +  F E     
Sbjct: 331 VLLSIGRVIGESAALIYT-MGTYVNDSPT-LLSQGTSLAVHIYNIMSSEQPNF-ELACAI 387

Query: 400 ILLLLIFLAVINTAMLWLRNRFKKRW 425
            +++L+F+ ++N  +  +  RF K W
Sbjct: 388 SIVILVFVFMLNLLVKLMSRRFNKAW 413


>gi|323490094|ref|ZP_08095315.1| phosphate ABC transporter, permease protein PstA [Planococcus
           donghaensis MPA1U2]
 gi|323396390|gb|EGA89215.1| phosphate ABC transporter, permease protein PstA [Planococcus
           donghaensis MPA1U2]
          Length = 292

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 98/241 (40%), Positives = 157/241 (65%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  N AS  PE AGI  A+VGSL++ML+V   S  LG+ SAIYLEE++ +   ++
Sbjct: 52  HLSIEFLTNFASRFPEKAGIKAALVGSLWLMLVVAPTSIILGVGSAIYLEEYAKQNRITT 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++ NI+NLA VPS+V+G+LG  + +    +  ++ L  G  ++L+ LP I++++  A+R
Sbjct: 112 FIRMNISNLAGVPSVVFGLLGLTIFVRALAL-GNSVLAAGFTMSLLILPVIVVSSQEAIR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP  +R A+ G+GA+K QT+   +LP A+P ILTGS ++L+RA+GETAPL+ +G+   +
Sbjct: 171 SVPRELRDASFGMGATKWQTIIKIILPAAIPGILTGSILALSRAIGETAPLIVIGVPVII 230

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P GV D  TA P+QIY W++  ++ F       I++L+  L  +N+  + +RN+F K
Sbjct: 231 QFLPAGVMDTFTALPMQIYDWSSRPQQEFQTVAAAGIMVLMAVLLFMNSIAVIIRNKFDK 290

Query: 424 R 424
           R
Sbjct: 291 R 291


>gi|239637076|ref|ZP_04678070.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           warneri L37603]
 gi|239597426|gb|EEQ79929.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           warneri L37603]
          Length = 309

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 157/241 (65%), Gaps = 4/241 (1%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF N +SS P +AGI  A+VG+L++M+ +I +S  LG+ +AIYLEE++ K  F++FV+ 
Sbjct: 68  SFFTNFSSSTPSMAGIKGALVGTLWLMITIIPISIVLGVGTAIYLEEYARKNPFTNFVKV 127

Query: 248 NINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATGVALR 303
            I+NLA VPS+V+G+LG  + +    +       + + G L ++L+ LP II+A   A+R
Sbjct: 128 CISNLAGVPSVVFGLLGLTLFVRGMGVESLSLGKSIIAGALTMSLLILPVIIVAAQEAIR 187

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP+S+R A+ GLGA+K QT++  VLP A+P ILTG  ++L+RALGETAPL+ +G+   +
Sbjct: 188 AVPNSVREASYGLGANKWQTIYKVVLPAALPGILTGFILALSRALGETAPLILIGIPTIL 247

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P G+ D   A P+QIY WA   +  F       I++LL+ L ++N   ++ RN+F K
Sbjct: 248 LRLPSGIMDQFQALPIQIYNWAKMPQEEFQNVASAGIIVLLVILLLMNGLAIFFRNKFSK 307

Query: 424 R 424
           +
Sbjct: 308 K 308


>gi|327475172|gb|AEA77181.1| PstA [Bacillus sp. 15.4]
          Length = 294

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 101/243 (41%), Positives = 157/243 (64%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++GF     S  P+ AGI  A++G++++ML+V  ++  LG+ +AIYLEE++ +G   S
Sbjct: 52  WIDFGFLSGKLSVNPDKAGILGAILGTVWLMLVVAPVTMFLGVGTAIYLEEYAKEGKLKS 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +Q NI+NLA VPS+V+GILG  V +    +  +  L GGL ++L+ LP +++A+  ALR
Sbjct: 112 IIQTNISNLAGVPSVVFGILGLTVFVRMADL-GNIVLAGGLTMSLLVLPIVVVASQEALR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP  +R A+ G+GA+K QTV + VLP A+P ILTG  ++L+RA+GETAPL+ +G+ A +
Sbjct: 171 AVPQFLREASYGMGATKWQTVKNIVLPTAIPGILTGVILALSRAIGETAPLVVIGIPALL 230

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P GV D  T  P+QIY W  D+     +       I++LLI L  +N+  + +RN+F
Sbjct: 231 IPLPEGVFDKFTVMPMQIYYWTVDSALTDEYAYLAAATIVVLLIVLFAMNSIAIIIRNKF 290

Query: 422 KKR 424
           +KR
Sbjct: 291 QKR 293


>gi|224024788|ref|ZP_03643154.1| hypothetical protein BACCOPRO_01516 [Bacteroides coprophilus DSM
           18228]
 gi|224018015|gb|EEF76022.1| hypothetical protein BACCOPRO_01516 [Bacteroides coprophilus DSM
           18228]
          Length = 294

 Score =  182 bits (463), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 126/243 (51%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N+ F     S      GI  A+ G+  +M      +FP G+ S IY+ E++  G    
Sbjct: 49  VINWEFLSQAPSDGMTKGGIWPAIFGTCCLMAGSALFAFPTGVMSGIYMNEYAKDGKLVR 108

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A  +N+      + L G L L L+ LP +I  T  A +
Sbjct: 109 FIRMMTNNLSGIPSIVFGLFGMAFFVNWLDF-GDSILAGSLTLGLLALPIVIRTTEEAFK 167

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S R  +L LGA+K QT+++ +LP+AMP I+TG  +SL R  GETAP+LF     F+
Sbjct: 168 DLPDSFREGSLALGATKAQTIWNVLLPMAMPRIITGLILSLGRVSGETAPILFTCAAYFL 227

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ A         +   +G   +L++ + ++N A   +R  F
Sbjct: 228 PKLPDSIFDQCMALPYHLYVVATSGTDIEAQMPIAYGTAFVLILIVLLMNLAANSIRKFF 287

Query: 422 KKR 424
           + +
Sbjct: 288 ENK 290


>gi|116750313|ref|YP_847000.1| phosphate ABC transporter inner membrane subunit PstA
           [Syntrophobacter fumaroxidans MPOB]
 gi|116699377|gb|ABK18565.1| phosphate ABC transporter, inner membrane subunit PstA
           [Syntrophobacter fumaroxidans MPOB]
          Length = 288

 Score =  182 bits (463), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 82/244 (33%), Positives = 129/244 (52%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   + G+  +    + ++FP G+ASAI+L E++  G   
Sbjct: 45  RAVDWTFLSQPPLDSMTRGGIFPCIAGTFLLGFGSMLVAFPWGVASAIFLHEYARPGPAL 104

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G A  + + K+   + L G L L ++ LP II     AL
Sbjct: 105 RVIRLGINNLAGVPSVVFGLFGLAFFVTWCKLGV-SILSGVLTLGVLILPVIIGTAEEAL 163

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+VP++ R A+L LGA+K QT+   VLP A P +LTGS + ++RA GETA ++F   V F
Sbjct: 164 RSVPATYREASLALGATKWQTILRVVLPAAFPGMLTGSILGISRAAGETAAIMFTAAVFF 223

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNR 420
               P  + D   A P  IY+ A    +  V R   +G  L+L+  +  +N   +  R R
Sbjct: 224 TPHLPASLFDPVMALPYHIYVLATAGTQIEVTRPLQYGTALVLIALVFGMNLVAIVCRAR 283

Query: 421 FKKR 424
            +++
Sbjct: 284 LQRK 287


>gi|302388939|ref|YP_003824760.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Thermosediminibacter oceani DSM 16646]
 gi|302199567|gb|ADL07137.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Thermosediminibacter oceani DSM 16646]
          Length = 294

 Score =  182 bits (462), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 105/241 (43%), Positives = 152/241 (63%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  +  S  PE AGI  A+ G++Y+M+I    + PLGIA+A++LEE+S K  F S
Sbjct: 51  WLDLQFITSFPSRSPEKAGILPALYGTIYVMIITAVFAIPLGIAAAVFLEEYSKKSKFLS 110

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F+Q NI NLA +PSIVYGILG  V + +  + R + L GGL + L+ LP II+    A+R
Sbjct: 111 FIQVNIYNLAGIPSIVYGILGLTVFVRWMMLGR-SLLAGGLTMGLLILPVIIVTAQEAIR 169

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S R A+  LGASK QT+ + VLP A+P ILTG  ++L+RA+GETAPL+ +G + FV
Sbjct: 170 AVPQSWRHASYALGASKWQTIRYVVLPSALPGILTGIILALSRAIGETAPLIPIGALTFV 229

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  + D  +  P+QIY W +  +  F       I++LL+ L  +N+A + LRN+++ 
Sbjct: 230 RVIPRSLFDSFSVLPIQIYNWTSRPQDDFRAIAAAGIVVLLVVLLGMNSAAILLRNKYQG 289

Query: 424 R 424
           R
Sbjct: 290 R 290


>gi|150392303|ref|YP_001322352.1| phosphate ABC transporter, inner membrane subunit PstA
           [Alkaliphilus metalliredigens QYMF]
 gi|149952165|gb|ABR50693.1| phosphate ABC transporter, inner membrane subunit PstA
           [Alkaliphilus metalliredigens QYMF]
          Length = 281

 Score =  182 bits (462), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 127/238 (53%), Gaps = 1/238 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N+ F            GI  A++G+LY++L  +  + PLGI SAIYL E++ +G  S  
Sbjct: 40  INWEFLTAMPRKGMTEGGIYPAIIGTLYLVLGTVLFALPLGIGSAIYLTEYAKQGILSRL 99

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++  I NLA VPS+VYG+ G  + + F     S+ L G L LA + LP +I A+  AL++
Sbjct: 100 IRLAILNLAGVPSVVYGLFGLGLFVLFLGF-GSSILAGSLTLACLILPIVITASEEALKS 158

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S R A+L LGA+K QT+   VLP A P I TG+ + + RA GETAP+L      F+ 
Sbjct: 159 VPQSYREASLALGATKWQTIQKVVLPHATPGITTGAILGIGRAAGETAPILLTVAAFFLP 218

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             P    D A   P  +Y+ +        E  +G  L+LL  + V       +R +FK
Sbjct: 219 RLPKSFFDQAMVLPYHLYIISTQVPNMPEEIKYGTALVLLGIVGVFFMIATTIRIKFK 276


>gi|30249003|ref|NP_841073.1| phosphate permease component of ATP-dependent phosphate uptake
           system [Nitrosomonas europaea ATCC 19718]
 gi|30138620|emb|CAD84911.1| Phosphate permease component of ATP-dependent phosphate uptake
           system [Nitrosomonas europaea ATCC 19718]
          Length = 311

 Score =  182 bits (462), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 92/258 (35%), Positives = 145/258 (56%), Gaps = 16/258 (6%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
               + FF +  S +PE AGI  A VG+  +ML+    + PLG+A+ +YLEE++ K   +
Sbjct: 55  PRLTWEFFTSFPSRKPEAAGILSAWVGTTLIMLVTAAAAVPLGVAAGVYLEEYAPKNLIT 114

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ N+ NLA VPSI+YG+L   + +    + + + L  GL LAL+ LP +I+AT  A+
Sbjct: 115 EIIEINVTNLAGVPSIIYGLLALGLFVYQLGLGQ-SILSAGLTLALLILPIVIVATREAI 173

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R++P SIR  A  LGA+K QTV  HVLP +   ILTG  + LARA+GETAP++ +G + F
Sbjct: 174 RSIPVSIREGAYALGATKWQTVSDHVLPYSAAGILTGVIIGLARAIGETAPIITIGALTF 233

Query: 363 VTDYPVGV-------------TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                 +  T  P+Q++ W +  +  F      A L+L++   +
Sbjct: 234 IAFLPPSPIQDQFPFVSFQWLMEPFTVMPIQMFNWISRPQEAFQHNAAAAGLVLVVMTLL 293

Query: 410 INTAMLWLRNRFKK--RW 425
           +N   ++LR R +K  +W
Sbjct: 294 MNGLAIYLRYRLRKNIKW 311


>gi|149178898|ref|ZP_01857476.1| phosphate ABC transporter, permease protein PstA [Planctomyces
           maris DSM 8797]
 gi|148842237|gb|EDL56622.1| phosphate ABC transporter, permease protein PstA [Planctomyces
           maris DSM 8797]
          Length = 292

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 100/254 (39%), Positives = 153/254 (60%), Gaps = 1/254 (0%)

Query: 171 WFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAI 230
                +         ++GF  +  S  P  AGI  A+ GS++++ +    S PLG+ +A+
Sbjct: 37  MVLIWNIILQGKDWLSWGFIDHLPSRFPHKAGIKSALWGSIWLISLTAMFSVPLGVGAAV 96

Query: 231 YLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMT 290
           YLEE++ +  +   +Q NI NLA VPSIVYGILG  + +    + R + L G L L L+ 
Sbjct: 97  YLEEYAPRSRWRKLIQLNIANLAGVPSIVYGILGLGLFVRALSLER-SVLSGALTLTLVV 155

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP II+A+  ALR VP SIR +A  LGA++ QTV++ VLP ++P I+TG  +SL+RALGE
Sbjct: 156 LPIIILASQEALRAVPDSIRRSAYALGATRWQTVWYQVLPASLPGIMTGVILSLSRALGE 215

Query: 351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
            APL+ VG +A+V   P  +TD  TA P+QI+ W +  +  F       IL+LL+ L  +
Sbjct: 216 AAPLIAVGAMAYVPFVPEKLTDEFTALPIQIFNWTSRPQEDFHHLAAAGILVLLVVLVSM 275

Query: 411 NTAMLWLRNRFKKR 424
           N   +++R+++ K+
Sbjct: 276 NAIAIFVRHKYGKK 289


>gi|224535456|ref|ZP_03675995.1| hypothetical protein BACCELL_00319 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522922|gb|EEF92027.1| hypothetical protein BACCELL_00319 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 232

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 78/229 (34%), Positives = 131/229 (57%), Gaps = 3/229 (1%)

Query: 198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPS 257
               GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG+   F++   NNL+ +PS
Sbjct: 1   MTAGGIWPAIVGTFYLMIGSALFAFPVGVMSGIYMNEYAPKGWIVRFIRMMTNNLSGIPS 60

Query: 258 IVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLG 317
           IV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+ +P ++R  +  LG
Sbjct: 61  IVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALKAIPDTLREGSRALG 119

Query: 318 ASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAF 377
           A+K+QT++H +LP+AMP ++TG  ++L R  GETAP+LF     F+   P  + D   A 
Sbjct: 120 ATKLQTIWHVILPMAMPNVITGLILALGRVSGETAPILFTCAAYFLPQLPTSILDQCMAL 179

Query: 378 PVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           P  +Y+ +         +   +G  L+L+I +  +N     LR  F+K+
Sbjct: 180 PYHLYVISTSGTDMEAQLPLAYGTALVLIIIILFVNLLANALRKYFEKK 228


>gi|20089773|ref|NP_615848.1| phosphate ABC transporter, permease protein [Methanosarcina
           acetivorans C2A]
 gi|19914712|gb|AAM04328.1| phosphate ABC transporter, permease protein [Methanosarcina
           acetivorans C2A]
          Length = 307

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/243 (32%), Positives = 130/243 (53%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  F       R    GI  A+VG++ +++  + ++ PLGI +A+YL E++ +   + 
Sbjct: 63  AINVEFLTEIPRMRMTQGGIYPAIVGTVLLIIGSMAVALPLGILAAVYLNEYAGETRTTW 122

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++  INNLA  PS+V+G+ G A+ + +F    S+ L   L L+ + +P II ++  AL 
Sbjct: 123 LIEMAINNLAGTPSVVFGLFGLALFVKYFGF-GSSILSASLTLSFLIIPVIIRSSQEALI 181

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP   R ++L LG SK QT+ H VLP A+P I+TGS +S+ R  GETAP+L  G   F+
Sbjct: 182 AVPKEYRESSLALGISKWQTIRHVVLPAAIPGIVTGSILSIGRVAGETAPILLTGAAYFL 241

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  +     A P  +++ A             +G  L+LL+ +  +N   + +R  +
Sbjct: 242 PRLPDSIYSQFMALPYHLFVLATSGTSIVKTRPLQYGTALVLLMIVLGMNAIAVLIRRHY 301

Query: 422 KKR 424
           +K+
Sbjct: 302 RKK 304


>gi|284045942|ref|YP_003396282.1| phosphate ABC transporter inner membrane subunit PstA [Conexibacter
           woesei DSM 14684]
 gi|283950163|gb|ADB52907.1| phosphate ABC transporter, inner membrane subunit PstA
           [Conexibacter woesei DSM 14684]
          Length = 312

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 96/246 (39%), Positives = 149/246 (60%), Gaps = 2/246 (0%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK-GF 240
               +     +  S+ P  AG   A+VG+LY++  V+ L  P+GI +A+YLEE++ K  +
Sbjct: 67  SPALSTQLITDPPSAIPSRAGFRPAIVGTLYLIAGVVFLVVPIGIGAAVYLEEYADKTRW 126

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
           ++  ++ NI NLA VPSI+YGILG A ++            G L LAL+ LP++I+A+  
Sbjct: 127 WNRLIELNIQNLAGVPSIIYGILGLAFIVRGPLNLGFILAAGSLTLALLVLPTVILASRE 186

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           A+R VP SIR  +L LGA++ QT+   VLP ++P I+TG  ++++RA+GETAPLL VG  
Sbjct: 187 AIRAVPPSIREGSLALGATQWQTIRRQVLPASIPGIITGVILAISRAIGETAPLLLVGAA 246

Query: 361 AFVTDYPVGV-TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
            FVT  P     D  TA PV I+ +A   +  F       ++++L+ L  +N   +WLRN
Sbjct: 247 TFVTFNPSFFSNDGYTALPVLIFNYATRPQDEFRVLASAGVIVMLVVLLAMNAFAVWLRN 306

Query: 420 RFKKRW 425
           R++++W
Sbjct: 307 RYERQW 312


>gi|11498954|ref|NP_070187.1| phosphate ABC transporter, permease protein (pstA) [Archaeoglobus
           fulgidus DSM 4304]
 gi|2649217|gb|AAB89888.1| phosphate ABC transporter, permease protein (pstA) [Archaeoglobus
           fulgidus DSM 4304]
          Length = 283

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 95/279 (34%), Positives = 154/279 (55%), Gaps = 1/279 (0%)

Query: 147 IDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVA 206
            D   +G     A    +            +        +  F  +  S  PE AGI  +
Sbjct: 3   ADEIKEGLFMLLALAATVFGVVVLAALLAYTFVEAAAWLDLQFLTSPPSRFPEKAGIFPS 62

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           +VGS+  + +V  +  PLG+ +AIYLEE++ K + +  ++ NI+NLA+VPSIVYG+LG  
Sbjct: 63  LVGSIMAIALVGVMVLPLGVGAAIYLEEYARKNWLTKLIEINISNLAAVPSIVYGLLGLG 122

Query: 267 VLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFH 326
           + ++   +     LVG L L L+ LP +I+A   +LR VP S+R A+L +GA+K QTV  
Sbjct: 123 LFVSTLGLKPGIVLVGSLTLTLLVLPIVIVAAQESLRAVPFSLREASLAVGATKWQTVKS 182

Query: 327 HVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAA 386
            VLP ++P I+TG  ++L+RA+GETAPL+ +G+       P  +    +A P+ I++W  
Sbjct: 183 VVLPSSLPGIMTGVILALSRAIGETAPLIMIGVATATFTAPKDIFSTYSALPMLIFMWTD 242

Query: 387 DAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             +  F+      AI++LL  +  +N   ++LRN+F +R
Sbjct: 243 MPKEEFLHGLAPAAIVVLLAIMLSMNAFAVYLRNKFARR 281


>gi|320162175|ref|YP_004175400.1| phosphate ABC transporter permease protein [Anaerolinea thermophila
           UNI-1]
 gi|319996029|dbj|BAJ64800.1| phosphate ABC transporter permease protein [Anaerolinea thermophila
           UNI-1]
          Length = 409

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 129/428 (30%), Positives = 206/428 (48%), Gaps = 44/428 (10%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
           NL  R+     F+   + + ++  + L +L+ ++V K       T   + +      VDP
Sbjct: 12  NLSVRHQWGKFFQGLFLFSTVIGLIVLGILILTVVDK-------TFTLVAVT---NKVDP 61

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
                     L   +   ++R  L    +   +    +   +QM        +   ++  
Sbjct: 62  ATLADRPLEELSAEELRQILRDKLR--PARLRTIERDMGPIAQMGEADLTALIMAEIVKP 119

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGF 189
            +     +  SL   A I++ ++             D Q  +              ++ F
Sbjct: 120 TTRASYPLFQSLTRRAEIEAEIRKEYP---------DAQIYF----------KAWLSWDF 160

Query: 190 FINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS-HKGFFSSFVQAN 248
                ++ P++AG+  A+ GSL ++LI I  +FP+G+ +AIYLEE++  +   +  +Q N
Sbjct: 161 LQRSMATNPDLAGVRQAIKGSLLIILITILFAFPIGVGAAIYLEEYADKRNRINRILQTN 220

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTA------------LVGGLILALMTLPSIII 296
           I NLA VPSI+YGILG AV +       S A            L GGL +AL+ LP +II
Sbjct: 221 IENLAGVPSIIYGILGLAVFVRALAPITSGAAFGMDAGSGRTILSGGLTMALLVLPILII 280

Query: 297 ATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLF 356
           ++  ALR VP+S+R A+  +GA++ QT++HHVLP A+P ILTG+ ++++RALGETAPL+ 
Sbjct: 281 SSQEALRAVPNSLREASFAMGATRWQTIWHHVLPYALPGILTGTILAVSRALGETAPLIL 340

Query: 357 VGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLW 416
           VG  + +   P  V    TA P QIY W    +  F      AIL+LL  L  +N   + 
Sbjct: 341 VGASSLINKDPQSVFSFFTALPFQIYNWTVRPQPEFRNIAAAAILVLLAVLLSLNATAIV 400

Query: 417 LRNRFKKR 424
           LRNR  KR
Sbjct: 401 LRNRLSKR 408


>gi|78187105|ref|YP_375148.1| phosphate ABC transporter permease [Chlorobium luteolum DSM 273]
 gi|78167007|gb|ABB24105.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chlorobium luteolum DSM 273]
          Length = 448

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/445 (24%), Positives = 192/445 (43%), Gaps = 31/445 (6%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGA-LWQTHISLPIEFSETIVD 68
           NL  R I +  F    + +++V+ + L+++++ I+  G+GA  ++  I    +       
Sbjct: 2   NLGTRKILDRSFTALGIGSIVVMALALLIVITPIIYNGLGAVFFKGTIE-HRKLLYNEFH 60

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMT 128
                 ++  I   A Y     + LA      +       +  +M     +  L+  L  
Sbjct: 61  RGDGAELEREIAEVAVYRDQAYRMLADFELELEGMDPEKAREYRMQYGPVKTALQTLLGP 120

Query: 129 DP----------------SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWF 172
            P                    +    +LL  +  D +    +     V R   ++    
Sbjct: 121 PPGDDSAILTRFRYGQTRWEKAEEKLHALLYESKWDYSDPDVMAKEYFVRRAESFEGTKL 180

Query: 173 QKL--------DSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPL 224
             +        +          +GF  + +       GI   + G+ ++ +  +  +FPL
Sbjct: 181 APMFGFVEKNAEKMLLPRFTLYWGFLTDSSIDAHIFGGIWPEIQGTFFLAIGAMLFAFPL 240

Query: 225 GIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGG 283
           G+ +AIY  E++  G F+S +++  + LA VPSIV+G+ G A  IN   +  S + L G 
Sbjct: 241 GVVAAIYFTEYAKDGVFTSMLRSANSTLAGVPSIVFGLFGLAFFINTLNVSESKSVLAGA 300

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L LA+M LP+II A   A+  VP + + A+LGLG++K  T+   +LP A+P I+TG  +S
Sbjct: 301 LTLAIMILPTIIRAAEEAILAVPKTYKEASLGLGSTKWNTIVTVILPAALPGIITGGVIS 360

Query: 344 LARALGETAPLLFVGM--VAFVTDYPVGVTDIATAFPVQIYLWAADAERPF--VERTFGA 399
           L RA GETAP++F     V         ++    A    IY  A++ E         +G 
Sbjct: 361 LGRAAGETAPIIFTAAVSVGSAIGIADVLSSPTPALSWNIYNLASEHEAAAEIRHVQYGM 420

Query: 400 ILLLLIFLAVINTAMLWLRNRFKKR 424
           +L L+  + ++N + + LR R  K+
Sbjct: 421 VLALVSIVLLLNLSAVLLRARISKK 445


>gi|88604210|ref|YP_504388.1| phosphate ABC transporter permease [Methanospirillum hungatei JF-1]
 gi|88189672|gb|ABD42669.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanospirillum hungatei JF-1]
          Length = 649

 Score =  181 bits (458), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 77/242 (31%), Positives = 129/242 (53%), Gaps = 2/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 F      +     GI  A++G+ Y+++  I ++ PLGI +AIYL E++ +   +
Sbjct: 407 PYVTLDFLTESPRNLGRGGGIFPAIIGTFYLVIGSILIALPLGIGAAIYLVEYTKENILT 466

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++   + L   PSIV+G+ G   L+ F      + L G + LALM LP++I  T  AL
Sbjct: 467 RFIRTATDLLNGTPSIVFGLFGFTFLVLFLGF-GISLLAGMITLALMVLPTVIRTTEEAL 525

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           ++VP S+R  +  LGA++ QTV   VLP ++P I+TG+ +S+ RA GETAP++F  +V  
Sbjct: 526 KSVPDSLREGSYALGATRWQTVRRVVLPPSVPGIITGAILSIGRAAGETAPIMFTAVVFM 585

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
               P    D   A P  +++ A +         +   ++LLI + +I    + +RN + 
Sbjct: 586 QRRLPDSFFDPVMALPYHLFILATNV-PGARNNQYATAVILLILVIMIYGGAILIRNHYD 644

Query: 423 KR 424
           K+
Sbjct: 645 KK 646



 Score =  130 bits (327), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 60/240 (25%), Positives = 112/240 (46%), Gaps = 9/240 (3%)

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
               +S     G+   +VG+L + +  +  + P GIA AI++ E +      + ++  + 
Sbjct: 65  RWDPTSIMPKYGLVPLIVGTLLVTMGAMVFAVPFGIACAIFIAELASPRM-RNILKPAVE 123

Query: 251 NLASVPSIVYGILGSAVLINFFK-----MPRSTALVGGLILALMTLPSIIIATGVALRTV 305
            LA +PS+VYG  G A+L+ F +         + L G ++L +M+LP+II  +  A+ +V
Sbjct: 124 LLAGIPSVVYGFFGLAILVKFLQDLLSVPSGESVLAGSILLGIMSLPTIISVSEDAISSV 183

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P  ++  +L LGA+  QT+   ++P A+  I     + + RA+GET  ++ V   A +  
Sbjct: 184 PRYLKEGSLALGATHWQTISQVIVPAALSGITAAVILGIGRAVGETMAVIMVTGNAAIIP 243

Query: 366 YP-VGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
            P   +          + +   +           FG  ++LL+   +IN   L +  R K
Sbjct: 244 SPIWNILSPVRTLTGTLGIEMGEVAVGSLHYHALFGVAVILLLITLIINLTALTVMKRLK 303


>gi|217968824|ref|YP_002354058.1| phosphate ABC transporter inner membrane subunit PstA [Thauera sp.
           MZ1T]
 gi|217506151|gb|ACK53162.1| phosphate ABC transporter, inner membrane subunit PstA [Thauera sp.
           MZ1T]
          Length = 307

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 139/254 (54%), Gaps = 14/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N  FF +  S R   AGI  A VGSL +ML+    + PLG+A+ +YLEE++ K   +
Sbjct: 51  ERLNPDFFTSFPSRRAANAGILSAWVGSLLVMLVTALSAVPLGVAAGVYLEEYAPKNLVT 110

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ N+ NLA VPSIVYG+L   V +  F   + + L  GL L L+ LP II+AT  AL
Sbjct: 111 DIIEINVTNLAGVPSIVYGLLALGVFVYMFGFGQ-SVLTAGLTLGLLILPVIIVATREAL 169

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P  +R  A G GA++ Q V  H++P A P I+TG  + L+RA+GETAP++ +G + F
Sbjct: 170 RAIPVHVREGAYGCGATQWQVVSDHLVPYATPGIMTGVIIGLSRAIGETAPIITIGALTF 229

Query: 363 VTDYPVGVTDIA-------------TAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                    T  P+Q++ W +  E  F +    A L+L++   +
Sbjct: 230 IAFLPASPISSTAPFINFDWLWSGFTVMPIQMFNWTSRPEEAFQQNAAAAGLILVLMTLL 289

Query: 410 INTAMLWLRNRFKK 423
           +N   +WLR R +K
Sbjct: 290 MNALAIWLRYRLRK 303


>gi|167630153|ref|YP_001680652.1| phosphate abc transporter, permease protein psta [Heliobacterium
           modesticaldum Ice1]
 gi|167592893|gb|ABZ84641.1| phosphate abc transporter, permease protein psta [Heliobacterium
           modesticaldum Ice1]
          Length = 281

 Score =  180 bits (457), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 87/242 (35%), Positives = 131/242 (54%), Gaps = 1/242 (0%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           F    + F            GI  A+VG+ Y++L  I  + P+G+ +A+YL E++ + + 
Sbjct: 37  FPALTWEFITENPRKGMTEGGIFPAIVGTFYLVLATILFALPVGVMTAVYLVEYARESWA 96

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++  + NLA VPS+V+G+ G    + F      + L G L LALM LP II  T  A
Sbjct: 97  TRIIRLAVVNLAGVPSVVFGLFGLGFFVLFLDFGV-SILSGSLTLALMILPVIITTTEEA 155

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR VP+  R A+L LGA+K+QT+   VLP AMP ILTGS + +ARA GETAP+L      
Sbjct: 156 LRAVPNGYREASLALGATKLQTILLIVLPNAMPGILTGSILGVARAAGETAPILLTAAAF 215

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           F+   P  V D   A P  +Y+ A        +  +G   +L+I +  +N   + LR+ F
Sbjct: 216 FLPRLPSSVFDQVMALPYHLYVIATQVPNADPKIPYGTATVLMILVLGLNLVAILLRSYF 275

Query: 422 KK 423
           ++
Sbjct: 276 RR 277


>gi|85859335|ref|YP_461537.1| phosphate ABC transporter permease [Syntrophus aciditrophicus SB]
 gi|85722426|gb|ABC77369.1| ABC-type phosphate transport system, permease component [Syntrophus
           aciditrophicus SB]
          Length = 291

 Score =  180 bits (457), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 87/244 (35%), Positives = 132/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F  +         GI  A++G+LY+ L  I ++ PLGIASA+YL E++ +G   
Sbjct: 46  QAINWEFLTSPPRDSMTRGGIMPAILGTLYLTLGAITVALPLGIASAVYLTEYARQGLII 105

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  +N LA +PS+V+G+ G    + F +   S  L G L L  + LP+II A+  AL
Sbjct: 106 RIIRLGVNCLAGIPSVVFGLFGLGFFVVFLQF-GSCILSGALTLGFLVLPTIIGASEEAL 164

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP + R A+L LG SK +T+   VLP A+P ILTGS + + RA GETAP++F     F
Sbjct: 165 KAVPQTFREASLALGVSKWRTISRIVLPNALPGILTGSILGIGRAAGETAPIMFTAAAFF 224

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAER--PFVERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  + D   A P  IY+ A    R        FG  L+L+  +  I+   + +R+R
Sbjct: 225 TAKLPSSIFDEVMALPYHIYVLATAGTRIEETRPLQFGTALVLMALVLGIDLFAIIIRSR 284

Query: 421 FKKR 424
            +K+
Sbjct: 285 MRKK 288


>gi|124485937|ref|YP_001030553.1| hypothetical protein Mlab_1117 [Methanocorpusculum labreanum Z]
 gi|124363478|gb|ABN07286.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methanocorpusculum labreanum Z]
          Length = 627

 Score =  180 bits (457), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 87/242 (35%), Positives = 135/242 (55%), Gaps = 2/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F     S+     GI  A++G+L ++   I ++ P+GI SAIYL E+S     +
Sbjct: 386 PAISWEFLTTSPSNMGLEGGIFPAIIGTLQLVGGAILIALPIGIGSAIYLHEYSRDNILT 445

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++   + LA  PSIV+G+ G A L+ F        L G + LALM LP+II  T  AL
Sbjct: 446 RLLRTGNDLLAGTPSIVFGVFGFAFLVIFLGWGV-CLLAGMVCLALMILPTIIKTTEEAL 504

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           ++VP+S+R A+LGLGA+K QT+ + VLP A P ILTG+ +S+ RA GETAP++F  +V  
Sbjct: 505 KSVPNSLREASLGLGATKWQTLKNVVLPSAAPGILTGTILSIGRAAGETAPIMFTAVVFS 564

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
                + + D   A P  +Y+ A         + +G  ++L+  +  I    + +R RF+
Sbjct: 565 KRFISMDLFDPVMALPFHLYVLATSV-PGSQTQQYGTAVVLISLVMAIYLVAIVIRKRFQ 623

Query: 423 KR 424
           KR
Sbjct: 624 KR 625



 Score =  120 bits (300), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 108/246 (43%), Gaps = 12/246 (4%)

Query: 188 GFFINGASS---RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
           GFF N   +        GI   ++ +L +    +  + PLGI SA++L   + +      
Sbjct: 51  GFFFNTVWNPTGSTPSYGIATLIIDTLLVTFGAMIFAVPLGIISAVFLAYLAPQK-VRDI 109

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFK-----MPRSTALVGGLILALMTLPSIIIATG 299
           V+  I  LA +PS+VYG  G  VL +F +         + L   ++L +M LP+I+  + 
Sbjct: 110 VKPAIELLAGIPSVVYGFFGMVVLCSFLQSTLNIPSGFSWLAASILLGIMALPTIVSVSE 169

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            AL  VP   + A+LGLGA+K QT+   ++P A   I     + + RA+GET  ++ V  
Sbjct: 170 DALYVVPKDYKEASLGLGATKWQTISRVLIPAAASGISAAVILGIGRAIGETMAVMMVAG 229

Query: 360 VAFVTDYP-VGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLW 416
            A V   P   V          + +   +           FG   +LL+   +IN     
Sbjct: 230 NAAVIPSPIWDVLSPVRTLTATLGIELGEVATGSMHYYALFGVAAVLLLITLLINLLSGR 289

Query: 417 LRNRFK 422
           +  + +
Sbjct: 290 ITKKIQ 295


>gi|163845862|ref|YP_001633906.1| phosphate ABC transporter inner membrane subunit PstA [Chloroflexus
           aurantiacus J-10-fl]
 gi|222523574|ref|YP_002568044.1| phosphate ABC transporter inner membrane subunit PstA [Chloroflexus
           sp. Y-400-fl]
 gi|163667151|gb|ABY33517.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chloroflexus aurantiacus J-10-fl]
 gi|222447453|gb|ACM51719.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chloroflexus sp. Y-400-fl]
          Length = 311

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 102/243 (41%), Positives = 153/243 (62%), Gaps = 1/243 (0%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
                + FF N  S  P+ AG   A+VG+LY + + I  +FPLG+A+AIYLEE++   +F
Sbjct: 69  TNWLTWDFFNNFDSRFPQRAGAKAAIVGTLYTISLTILFAFPLGVAAAIYLEEYARDNWF 128

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           S  V+ NI+NLA+VPSI+YG+LG  V   +  + RS       +  L+ +P II+A+  +
Sbjct: 129 SRLVEINISNLAAVPSIIYGLLGLQVFARWLLLGRSILTGALTLALLV-VPIIIVASRES 187

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R VP S+R A+  LGA++ QTV+H VLP ++  ILTGS ++++RA+GETAPL+ +G + 
Sbjct: 188 IRAVPLSLRQASYALGATRWQTVWHVVLPQSIGGILTGSILAVSRAIGETAPLITIGALT 247

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           FV   P  + DI T  P+QI+ W +  +  F       IL+LL  L  IN   ++LRNR+
Sbjct: 248 FVPFLPRNILDIFTVLPIQIFNWTSRPQDEFRALAAAGILVLLTILLTINALAIYLRNRY 307

Query: 422 KKR 424
           +KR
Sbjct: 308 QKR 310


>gi|49483578|ref|YP_040802.1| ABC transporter permease [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257425452|ref|ZP_05601877.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428112|ref|ZP_05604510.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430743|ref|ZP_05607125.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433503|ref|ZP_05609861.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436344|ref|ZP_05612391.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus M876]
 gi|282903968|ref|ZP_06311856.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus C160]
 gi|282905733|ref|ZP_06313588.1| phosphate ABC transporter permease PstA [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282908704|ref|ZP_06316522.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282910968|ref|ZP_06318770.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282914176|ref|ZP_06321963.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M899]
 gi|282919098|ref|ZP_06326833.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus C427]
 gi|282924281|ref|ZP_06331955.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus C101]
 gi|283958150|ref|ZP_06375601.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|293501203|ref|ZP_06667054.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293510164|ref|ZP_06668872.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus M809]
 gi|293526756|ref|ZP_06671441.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M1015]
 gi|295427901|ref|ZP_06820533.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297591138|ref|ZP_06949776.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49241707|emb|CAG40397.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|257271909|gb|EEV04047.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274953|gb|EEV06440.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278871|gb|EEV09490.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281596|gb|EEV11733.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284626|gb|EEV14746.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus M876]
 gi|282313668|gb|EFB44061.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus C101]
 gi|282316908|gb|EFB47282.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus C427]
 gi|282322244|gb|EFB52568.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M899]
 gi|282324663|gb|EFB54973.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282326968|gb|EFB57263.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282331025|gb|EFB60539.1| phosphate ABC transporter permease PstA [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282595586|gb|EFC00550.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus C160]
 gi|283790299|gb|EFC29116.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|290920828|gb|EFD97891.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus M1015]
 gi|291096208|gb|EFE26469.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291467108|gb|EFF09626.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus M809]
 gi|295128259|gb|EFG57893.1| phosphate ABC transporter [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297576024|gb|EFH94740.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|312438212|gb|ADQ77283.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315195279|gb|EFU25666.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 305

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 101/245 (41%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           ++ K+
Sbjct: 300 KYSKK 304


>gi|15924377|ref|NP_371911.1| phosphate ABC transporter permease [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926967|ref|NP_374500.1| hypothetical protein SA1219 [Staphylococcus aureus subsp. aureus
           N315]
 gi|57651887|ref|YP_186274.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus COL]
 gi|87160734|ref|YP_493978.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|88195113|ref|YP_499913.1| phosphate ABC transporter permease [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267875|ref|YP_001246818.1| phosphate ABC transporter, inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus JH9]
 gi|150393939|ref|YP_001316614.1| phosphate ABC transporter inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus JH1]
 gi|151221510|ref|YP_001332332.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156979706|ref|YP_001441965.1| hypothetical protein SAHV_1375 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509553|ref|YP_001575212.1| phosphate ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|221140588|ref|ZP_03565081.1| phosphate ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus str. JKD6009]
 gi|253317020|ref|ZP_04840233.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus str. CF-Marseille]
 gi|253733365|ref|ZP_04867530.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006176|ref|ZP_05144777.2| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus Mu50-omega]
 gi|257795558|ref|ZP_05644537.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9781]
 gi|258413366|ref|ZP_05681642.1| ABC phosphate transporter ATP-binding protein [Staphylococcus
           aureus A9763]
 gi|258420527|ref|ZP_05683469.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9719]
 gi|258434701|ref|ZP_05688775.1| phosphate ABC transporter [Staphylococcus aureus A9299]
 gi|258447442|ref|ZP_05695586.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A6300]
 gi|258449283|ref|ZP_05697386.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A6224]
 gi|258451784|ref|ZP_05699808.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A5948]
 gi|258454663|ref|ZP_05702627.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A5937]
 gi|262049856|ref|ZP_06022719.1| hypothetical protein SAD30_0585 [Staphylococcus aureus D30]
 gi|262052197|ref|ZP_06024404.1| hypothetical protein SA930_0547 [Staphylococcus aureus 930918-3]
 gi|269203009|ref|YP_003282278.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus ED98]
 gi|282926209|ref|ZP_06333843.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9765]
 gi|282928947|ref|ZP_06336536.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A10102]
 gi|284024388|ref|ZP_06378786.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus 132]
 gi|294848392|ref|ZP_06789139.1| phosphate ABC transporter [Staphylococcus aureus A9754]
 gi|295406332|ref|ZP_06816139.1| phosphate ABC transporter [Staphylococcus aureus A8819]
 gi|296276663|ref|ZP_06859170.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus MR1]
 gi|297244561|ref|ZP_06928444.1| phosphate ABC transporter [Staphylococcus aureus A8796]
 gi|304381037|ref|ZP_07363691.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|13701184|dbj|BAB42479.1| SA1219 [Staphylococcus aureus subsp. aureus N315]
 gi|14247158|dbj|BAB57549.1| similar to phosphate ABC transporter [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|57286073|gb|AAW38167.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus COL]
 gi|87126708|gb|ABD21222.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|87202671|gb|ABD30481.1| phosphate ABC transporter, permease protein, putative
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740944|gb|ABQ49242.1| phosphate ABC transporter, inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149946391|gb|ABR52327.1| phosphate ABC transporter, inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus JH1]
 gi|150374310|dbj|BAF67570.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156721841|dbj|BAF78258.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368362|gb|ABX29333.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253728633|gb|EES97362.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257789530|gb|EEV27870.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9781]
 gi|257839930|gb|EEV64398.1| ABC phosphate transporter ATP-binding protein [Staphylococcus
           aureus A9763]
 gi|257843475|gb|EEV67882.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9719]
 gi|257849062|gb|EEV73044.1| phosphate ABC transporter [Staphylococcus aureus A9299]
 gi|257853633|gb|EEV76592.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A6300]
 gi|257857271|gb|EEV80169.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A6224]
 gi|257860615|gb|EEV83439.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A5948]
 gi|257863046|gb|EEV85810.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A5937]
 gi|259159941|gb|EEW44978.1| hypothetical protein SA930_0547 [Staphylococcus aureus 930918-3]
 gi|259162080|gb|EEW46659.1| hypothetical protein SAD30_0585 [Staphylococcus aureus D30]
 gi|262075299|gb|ACY11272.1| phosphate ABC transporter, permease protein [Staphylococcus aureus
           subsp. aureus ED98]
 gi|269940883|emb|CBI49265.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282589456|gb|EFB94546.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A10102]
 gi|282592273|gb|EFB97291.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9765]
 gi|285817065|gb|ADC37552.1| Phosphate transport system permease protein PstA [Staphylococcus
           aureus 04-02981]
 gi|294825192|gb|EFG41614.1| phosphate ABC transporter [Staphylococcus aureus A9754]
 gi|294968920|gb|EFG44942.1| phosphate ABC transporter [Staphylococcus aureus A8819]
 gi|297178591|gb|EFH37837.1| phosphate ABC transporter [Staphylococcus aureus A8796]
 gi|302751217|gb|ADL65394.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304340346|gb|EFM06286.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|312829782|emb|CBX34624.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus ECT-R 2]
 gi|315131193|gb|EFT87177.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315196353|gb|EFU26705.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140282|gb|EFW32140.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus MRSA131]
 gi|320143946|gb|EFW35718.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus MRSA177]
 gi|329314063|gb|AEB88476.1| Phosphate ABC transporter, inner membrane subunit PstA
           [Staphylococcus aureus subsp. aureus T0131]
 gi|329727410|gb|EGG63866.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus 21172]
 gi|329728712|gb|EGG65139.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus 21189]
 gi|329728914|gb|EGG65332.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus 21193]
          Length = 305

 Score =  180 bits (456), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|311030802|ref|ZP_07708892.1| phosphate ABC transporter (permease) [Bacillus sp. m3-13]
          Length = 294

 Score =  180 bits (456), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 99/255 (38%), Positives = 157/255 (61%), Gaps = 3/255 (1%)

Query: 172 FQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
                         +  F  N  S+  + AGI  A++G+L++ML+V  ++  LG+ +AIY
Sbjct: 40  ILFYRVISQSMGWIDLQFITNKLSTMADRAGIMGAIMGTLWLMLVVAPITLFLGVGTAIY 99

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTL 291
           LEE++ KG    F+Q NI+NLA VPSIV+GILG  + +    +  +  L GGL +AL+ L
Sbjct: 100 LEEYAKKGRLQRFLQTNISNLAGVPSIVFGILGLTIFVRAAGL-GNIVLAGGLTMALLVL 158

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +++A+  A+R+VP  +R A+ G+GA+K QT+ + VLP ++P ILTG  ++L+RA+GET
Sbjct: 159 PIVVVASQEAIRSVPGYLREASYGMGATKWQTIKNIVLPASLPGILTGVILALSRAIGET 218

Query: 352 APLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAV 409
           APL+ +G+ A +   P G+ D  T  P+QIY W  DA     +       I++LL  L V
Sbjct: 219 APLVVLGIPALLIPLPEGIFDKFTVLPMQIYYWTIDAALVAEYANLAAATIVVLLFILLV 278

Query: 410 INTAMLWLRNRFKKR 424
           +N+  + +RN+F++R
Sbjct: 279 MNSIAVIIRNKFQRR 293


>gi|70726525|ref|YP_253439.1| hypothetical protein SH1524 [Staphylococcus haemolyticus JCSC1435]
 gi|68447249|dbj|BAE04833.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 306

 Score =  179 bits (455), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 100/241 (41%), Positives = 157/241 (65%), Gaps = 4/241 (1%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF N +SS P  AGI  A+ G++++M+ +I +S  LG+ +AIYLEE++   FF+SFV+ 
Sbjct: 65  DFFTNFSSSTPSQAGIKGALAGTIWLMISIIPISIVLGVGTAIYLEEYAKDNFFTSFVKI 124

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMP----RSTALVGGLILALMTLPSIIIATGVALR 303
           +I+NLA VPSIV+G+LG  + +    +      ++ +   L ++L+ LP II+++  A+R
Sbjct: 125 SISNLAGVPSIVFGLLGLTLFVRGGGIQALALGNSVIAAALTMSLLILPIIIVSSQEAIR 184

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +
Sbjct: 185 AVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLILIGIPTIL 244

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  +  + TA P QIY WA   +  F      AI++LL+ L ++N   ++LRN+F +
Sbjct: 245 LATPTSIMSMFTALPTQIYTWAKMPQAEFQNVASAAIIILLVILLLMNAVAIFLRNKFSR 304

Query: 424 R 424
           +
Sbjct: 305 K 305


>gi|333031398|ref|ZP_08459459.1| phosphate ABC transporter, inner membrane subunit PstA [Bacteroides
           coprosuis DSM 18011]
 gi|332741995|gb|EGJ72477.1| phosphate ABC transporter, inner membrane subunit PstA [Bacteroides
           coprosuis DSM 18011]
          Length = 284

 Score =  179 bits (455), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 81/244 (33%), Positives = 133/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F     +      GI  A++G+L +++  +  +FPLG+ SAIY  E++  G+  
Sbjct: 38  DVISWEFLTTAPTDGMTSGGIYPAIIGTLCLIVGSMLFAFPLGVMSAIYTSEYAGNGWII 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++   NNLA +PSIV+G+ G ++ +N   +   + + G L L L+ LP +I  T  AL
Sbjct: 98  KVIRVMTNNLAGIPSIVFGLFGMSLFVNTMGL-GDSIIAGSLTLGLLVLPIVIRTTEEAL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +++P+S R+A+L LGASK+QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F
Sbjct: 157 KSIPNSFRNASLALGASKLQTIRKVVLPMAFPNIITGLILSIGRVSGETAPILFTVAAYF 216

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           +   P  + D   A P  +Y+ A             +G  L+L+  + ++N     LR  
Sbjct: 217 LPKLPSSMFDQVMALPYHLYVIATSGTDIEASRPIAYGTALVLIAIVLIMNLLATALRRY 276

Query: 421 FKKR 424
           F K+
Sbjct: 277 FSKK 280


>gi|56478172|ref|YP_159761.1| phosphate ABC transporter, permease protein [Aromatoleum aromaticum
           EbN1]
 gi|56314215|emb|CAI08860.1| Phosphate ABC transporter, permease protein [Aromatoleum aromaticum
           EbN1]
          Length = 307

 Score =  179 bits (455), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 87/253 (34%), Positives = 139/253 (54%), Gaps = 16/253 (6%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            FF +  S R   AGI  A VGS+ +ML+    + PLG+A+ +YLEE++ + F +  ++ 
Sbjct: 56  DFFTSFPSRRAGQAGILSAWVGSVLVMLVTAVSAVPLGVAAGVYLEEYATRSFVTDLIEI 115

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           N+ NLA VPSIVYG+L   V +  F   + + L  GL L L+ LP +I+AT  A+R++P 
Sbjct: 116 NVTNLAGVPSIVYGLLALGVFVYAFGFGQ-SILSAGLTLGLLILPVVIVATREAIRSIPQ 174

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
            IR  A  LGA++ Q    H++P +MP ILTG  + ++RA+GETAP++ +G + F+   P
Sbjct: 175 HIREGAYALGATRWQVTRDHIVPYSMPGILTGVIIGMSRAIGETAPVITIGALTFIAFLP 234

Query: 368 VGVTDI-------------ATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
                               T  P+Q++ W +  E  F +    A  +L++    +N   
Sbjct: 235 ESPIGPEFPWVNFEWLKSGFTVMPIQMFNWTSRPEEAFQQNAAAAGFVLVLMTLAMNAIS 294

Query: 415 LWLRNRFKK--RW 425
           +W+R   +K  +W
Sbjct: 295 IWIRYHLRKDIKW 307


>gi|298694683|gb|ADI97905.1| probable phosphate ABC transporter permease [Staphylococcus aureus
           subsp. aureus ED133]
 gi|323441172|gb|EGA98879.1| phosphate ABC transporter permease [Staphylococcus aureus O11]
 gi|323444041|gb|EGB01652.1| phosphate ABC transporter permease [Staphylococcus aureus O46]
          Length = 305

 Score =  179 bits (455), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|302333000|gb|ADL23193.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           JKD6159]
          Length = 305

 Score =  179 bits (455), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNIASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|22299709|ref|NP_682956.1| permease protein of phosphate ABC transporter [Thermosynechococcus
           elongatus BP-1]
 gi|22295893|dbj|BAC09718.1| permease protein of phosphate ABC transporter [Thermosynechococcus
           elongatus BP-1]
          Length = 309

 Score =  179 bits (455), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 97/256 (37%), Positives = 144/256 (56%), Gaps = 16/256 (6%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            N+ FF +  S  P  AGI  A VGSL ++L+ I ++ PLG+A+ IYLEE++ K +   F
Sbjct: 55  LNWKFFTSPPSGDPAEAGILTAWVGSLLVILVTIVVAVPLGVAAGIYLEEYAPKNWLLDF 114

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI NLA VPSI+YG+L     +   K    + L  G  LAL+ LP II+AT  A+R 
Sbjct: 115 IEINITNLAGVPSIIYGLLALGFFVYILKW-GESILTAGCTLALLILPVIIVATREAIRA 173

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           +P  IR  A  +GA++ QT+  H+LP +M  ILTG  V ++RALGETAPL+ +G + F+T
Sbjct: 174 IPQGIREGAYAVGATRWQTIADHILPYSMGGILTGVIVGVSRALGETAPLVTIGALTFIT 233

Query: 365 DYPVGVT-------------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVIN 411
             P                    T  P+Q++ W +  +  F      A ++LL+    +N
Sbjct: 234 FLPDAPLKGEFPYVSFKWLWSPFTVLPIQMFNWVSRPQEEFQVNAAAAGIVLLVLTLGVN 293

Query: 412 TAMLWLRNRFKK--RW 425
              ++LR RF+K  +W
Sbjct: 294 AMAIYLRYRFRKSIKW 309


>gi|258444723|ref|ZP_05693052.1| phosphate ABC transporter [Staphylococcus aureus A8115]
 gi|282892879|ref|ZP_06301114.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A8117]
 gi|257850216|gb|EEV74169.1| phosphate ABC transporter [Staphylococcus aureus A8115]
 gi|282764876|gb|EFC05001.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A8117]
          Length = 305

 Score =  179 bits (455), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|282916654|ref|ZP_06324412.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus D139]
 gi|283770459|ref|ZP_06343351.1| phosphate transport system permease [Staphylococcus aureus subsp.
           aureus H19]
 gi|282319141|gb|EFB49493.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           subsp. aureus D139]
 gi|283460606|gb|EFC07696.1| phosphate transport system permease [Staphylococcus aureus subsp.
           aureus H19]
          Length = 305

 Score =  179 bits (454), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|258423651|ref|ZP_05686539.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9635]
 gi|257846149|gb|EEV70175.1| phosphate ABC transporter, permease PstA [Staphylococcus aureus
           A9635]
          Length = 305

 Score =  179 bits (454), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASFGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|283470601|emb|CAQ49812.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           aureus subsp. aureus ST398]
          Length = 305

 Score =  179 bits (454), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPTSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|21283004|ref|NP_646092.1| hypothetical protein MW1275 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486229|ref|YP_043450.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207959|ref|ZP_06924390.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300912043|ref|ZP_07129486.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21204443|dbj|BAB95140.1| MW1275 [Staphylococcus aureus subsp. aureus MW2]
 gi|49244672|emb|CAG43104.1| ABC transporter permease protein [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887202|gb|EFH26104.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300886289|gb|EFK81491.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 305

 Score =  179 bits (454), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 103/245 (42%), Positives = 156/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+GILG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGILGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|154151458|ref|YP_001405076.1| phosphate ABC transporter, inner membrane subunit PstA [Candidatus
           Methanoregula boonei 6A8]
 gi|154000010|gb|ABS56433.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methanoregula boonei 6A8]
          Length = 604

 Score =  179 bits (454), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 77/242 (31%), Positives = 135/242 (55%), Gaps = 2/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F     +      GI  A+VG+LY++   I ++ PLG+ +AIYL E++ +G  +
Sbjct: 362 PAISWQFLTQSPTDLGRGGGIFPAIVGTLYLVAGAILIALPLGVGAAIYLIEYTREGRIT 421

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  ++ L   PSIV+G+ G A L+ F  +   + + G + LALM LP++I  T  AL
Sbjct: 422 KLIRTGVDLLNGTPSIVFGLFGFAFLVLFLNVGV-SLIAGMITLALMVLPTVIRTTEEAL 480

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VP S+R  +L LGA+K QT+ + V+P A+P I+TG+ +S+ RA GETAP++F  +V  
Sbjct: 481 KNVPQSLREGSLALGATKWQTIKNVVIPPAVPGIVTGAILSIGRAAGETAPIMFTAVVFS 540

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
               P  +     A P  +++ + +       + +G  L+LL+ +       + +RN + 
Sbjct: 541 TRFLPTSLFQPVMALPYHLFILSTNVPGSSTNK-YGTALVLLMLVVTFYAVAILIRNHYA 599

Query: 423 KR 424
           K+
Sbjct: 600 KK 601



 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 56/219 (25%), Positives = 97/219 (44%), Gaps = 9/219 (4%)

Query: 192 NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINN 251
               +     GI   ++G+L + L  +  + PL +  AIY+ E +      + ++     
Sbjct: 23  WAPGAYVPSYGIAALIIGTLLVTLGAMVFAVPLSLGCAIYISELASPR-IKNILKPATEL 81

Query: 252 LASVPSIVYGILGSAVLINFFKM-----PRSTALVGGLILALMTLPSIIIATGVALRTVP 306
           LA +PS+VYG  G  VL NF ++        T L G ++L +M LP+II  +  A+ +VP
Sbjct: 82  LAGIPSVVYGFFGMIVLSNFIRVTFNISSGQTWLAGSILLGIMALPTIISVSEDAISSVP 141

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDY 366
              R  +L  GA++ QT+   ++P A+  I     + + RA+GET  ++ V   A +   
Sbjct: 142 REYREGSLATGATRWQTISKVIVPAALSGIAAAIILGIGRAIGETMAVIMVTGNAAIIPS 201

Query: 367 P-VGVTDIATAFPVQIYLWAADAERP--FVERTFGAILL 402
           P   V          + +   D           FG  ++
Sbjct: 202 PIWNVLSSVRTLTGTLGIEMGDVAIGSEHYHALFGVAVV 240


>gi|124009229|ref|ZP_01693910.1| phosphate ABC transporter, permease protein PstA [Microscilla
           marina ATCC 23134]
 gi|123985214|gb|EAY25148.1| phosphate ABC transporter, permease protein PstA [Microscilla
           marina ATCC 23134]
          Length = 285

 Score =  179 bits (453), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 129/243 (53%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++GFF     +     GI  A++G+L +++    ++FP+GI + I++ E++H+ +F  
Sbjct: 41  VLSWGFFTGVPENGMTEGGIFPAIMGTLILIVGSGLVAFPMGILAGIFMNEYAHQNWFKK 100

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           FV+   NNLA +PSIV+G+ G A  +N       + L G L L ++ LP II  T  +L+
Sbjct: 101 FVRLMTNNLAGIPSIVFGLFGMAFFVNGLGFGV-SILSGCLTLGVLILPIIIRTTEESLK 159

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P   R A+  LGASK QT++  +LP A+P ++TG  +++ R  GETA +LF     F+
Sbjct: 160 FIPDDYRLASYALGASKWQTIWRVILPAALPNVVTGVILAVGRVAGETAAILFTVAAYFL 219

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFG--AILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +         R +     L LLI +  +N    W R R 
Sbjct: 220 PKMPTSIYDETMALPYHLYVISTSGTDIEKARPYADGTALTLLILVFGLNLLANWYRKRL 279

Query: 422 KKR 424
            K+
Sbjct: 280 NKK 282


>gi|310657923|ref|YP_003935644.1| phosphate ABC transporter permease [Clostridium sticklandii DSM
           519]
 gi|308824701|emb|CBH20739.1| phosphate ABC transporter, permease protein [Clostridium
           sticklandii]
          Length = 316

 Score =  179 bits (453), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 158/243 (65%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  +  S  PE AGI  A++G+LY+M IVI +   LG+++AIYLEE+++KG   S
Sbjct: 74  WLDMDFLTSNLSIFPEKAGIKGAILGTLYLMSIVIPVVCILGVSTAIYLEEYANKGKIQS 133

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++ NI+NLASVPS+++G+LG AV    F +  S+ L GGL ++L+ LP +++A+  ALR
Sbjct: 134 FIKVNISNLASVPSVIFGLLGLAVFGRIFSL-GSSILAGGLTMSLLVLPVVVVASQEALR 192

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP  +R A+  +GASK  T +  VLP+A+P ILTG  +S++RA+GETAPL+ +G+   +
Sbjct: 193 AVPGYLREASYAMGASKWTTTWKVVLPVAVPGILTGVILSVSRAIGETAPLVVLGVPTLI 252

Query: 364 TDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D  TA P+QIY W  D    + +       I++LL+ L ++N   + +RN+F
Sbjct: 253 MKLPTSIMDDFTAMPIQIYYWTLDTVLTKEYANLAAATIVVLLLVLFIMNFTAILIRNKF 312

Query: 422 KKR 424
           +++
Sbjct: 313 QRK 315


>gi|308273631|emb|CBX30233.1| hypothetical protein N47_D30420 [uncultured Desulfobacterium sp.]
          Length = 307

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 136/245 (55%), Gaps = 3/245 (1%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           +   ++ F            GI   ++G+L + +  I ++ P+G+ASAIYL E++  G  
Sbjct: 62  YKAISWEFLTQPPIDSMTKGGILPCIIGTLCLGIGSIIVALPIGVASAIYLNEYASPGRI 121

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
              ++ +I+NLA VPS+V+G+ G A  + + KM   + L G L LA +TLP II +T  A
Sbjct: 122 LRLIRLSISNLAGVPSVVFGLFGFAFFVIYLKMGV-SILAGVLTLASLTLPVIIGSTEEA 180

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L++VP + R A+L LGA++ QT++  VLP A+P  LTG+ + L+RA GETAP++F   V 
Sbjct: 181 LKSVPDTYREASLALGATRWQTIYRVVLPAALPGTLTGAILGLSRAAGETAPVMFTAAVF 240

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           F    PV V D   A P  IY+ A             +G  LLL+  +  +N   +  R+
Sbjct: 241 FTPGLPVSVFDKIMAMPYHIYVLATAGTNIEATRPLQYGTSLLLIAMVLGMNLVAIVWRS 300

Query: 420 RFKKR 424
             +KR
Sbjct: 301 VLRKR 305


>gi|284166705|ref|YP_003404984.1| phosphate ABC transporter inner membrane protein [Haloterrigena
           turkmenica DSM 5511]
 gi|284016360|gb|ADB62311.1| phosphate ABC transporter, inner membrane subunit PstA
           [Haloterrigena turkmenica DSM 5511]
          Length = 587

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 92/247 (37%), Positives = 141/247 (57%), Gaps = 5/247 (2%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK--- 238
               +  F    ASS    AG    +VGS+ ++  V  +SF LG+ SA++LEE++     
Sbjct: 341 NSWLDPSFVTGSASSTARDAGFYPPIVGSVMIIAFVALVSFVLGVGSAVFLEEYASDSGI 400

Query: 239 -GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
            G  +  +Q NI NLA+VPS+VYG+LG  + IN   +     +   L L+L+ LP  II+
Sbjct: 401 TGAITRVIQINIANLAAVPSVVYGLLGLGLFINLLGLGMGAIVTAVLTLSLLILPITIIS 460

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
              A+R+VP  +R+ +  +GA++ QT  + VLP A P ILTG+ ++L RA+GETAPL+ +
Sbjct: 461 AQEAIRSVPDDLRNGSYAMGATRWQTTRNVVLPEAFPGILTGTILALGRAIGETAPLIII 520

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPF-VERTFGAILLLLIFLAVINTAMLW 416
           G+       P G+ D A+A P+QIY+W+  A   F        ++ LL  L  +N   + 
Sbjct: 521 GVPHLTYSPPNGIWDKASAMPLQIYVWSHSAIGEFRYGVLAAGVVTLLFVLIGMNATAII 580

Query: 417 LRNRFKK 423
           LRNRF++
Sbjct: 581 LRNRFER 587


>gi|292656504|ref|YP_003536401.1| putative phosphate ABC transporter permease [Haloferax volcanii
           DS2]
 gi|291372397|gb|ADE04624.1| ABC-type transport system permease protein (probable substrate
           phosphate) [Haloferax volcanii DS2]
          Length = 542

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 97/243 (39%), Positives = 153/243 (62%), Gaps = 2/243 (0%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
               ++ F  +  S   E AG+  A+ GS+ +M  V  LSFPLG+ +A+YLEE++    F
Sbjct: 297 QSWVDWQFLTSAHSGTAENAGLYPAIGGSILLMATVAALSFPLGVGAAVYLEEYAPDNAF 356

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F+  NI+NLA VPS+VYG+LG  V + +   P  T L+GG  LAL+ LP +II++  A
Sbjct: 357 TRFIDVNISNLAGVPSVVYGLLGLGVFVTYLGQPTGTVLIGGATLALLILPIVIISSREA 416

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R VPS +R A+ G+GA++ QTV + VLP A P ILTG+ ++L RA+GETAPL+ +G   
Sbjct: 417 IRAVPSDMRQASYGMGATRWQTVKNVVLPEAFPGILTGTILALGRAIGETAPLIMIGAPN 476

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAA--DAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
            + + P  +T   +A P+Q+Y W++   +E  + +     +++LL  L  +N+  + LRN
Sbjct: 477 VLFNLPTELTSKVSAMPLQVYAWSSLFASEDFYTKAVPAGVVVLLAVLLAMNSIAIVLRN 536

Query: 420 RFK 422
           +F+
Sbjct: 537 KFE 539


>gi|46580883|ref|YP_011691.1| phosphate ABC transporter permease [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450303|gb|AAS96951.1| phosphate ABC transporter, permease protein, putative
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|311234576|gb|ADP87430.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio vulgaris RCH1]
          Length = 309

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 82/244 (33%), Positives = 134/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   ++G++ +    + ++ P G+A+AIYL+E++  G   
Sbjct: 65  PAISWEFLTAFPRDSMTKGGILPCILGTIALSYGSMLIALPWGVATAIYLQEYARPGPLV 124

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G ++ +   KM   + L G   LA + LP II A+  AL
Sbjct: 125 HAIRLTINNLAGVPSVVFGLFGLSMFVTAMKMGV-SLLAGMFTLAALVLPLIIGASEEAL 183

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+V  + R A+LGLGA+K QT+   VLP A+P+ILTG+ +++ RA GETA ++F   + F
Sbjct: 184 RSVSQTYREASLGLGATKWQTISLVVLPAALPSILTGAILAVGRAAGETAAIMFTAAMFF 243

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNR 420
               P  + D   A P  IY+ A       + R   FG  L+L++ +  +N   + +R R
Sbjct: 244 SPRLPGSLFDSVMALPYHIYVLATAGTEIELTRPMQFGTSLVLIVLVLGMNLMAIIMRAR 303

Query: 421 FKKR 424
            ++R
Sbjct: 304 LQRR 307


>gi|82750979|ref|YP_416720.1| phosphate ABC transporter permease [Staphylococcus aureus RF122]
 gi|82656510|emb|CAI80932.1| probable phosphate ABC transporter permease [Staphylococcus aureus
           RF122]
          Length = 305

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 155/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I LS  LGI  AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGKAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+G+LG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASHGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|120601813|ref|YP_966213.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio vulgaris DP4]
 gi|120562042|gb|ABM27786.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Desulfovibrio vulgaris DP4]
          Length = 309

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 83/244 (34%), Positives = 134/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   ++G++ +    + ++ P G+A+AIYL+E++  G   
Sbjct: 65  PAISWEFLTAFPRDSMTKGGILPCILGTIALSYGSMLIALPWGVATAIYLQEYARPGPLV 124

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G ++ +   KM   + L G   LA + LP II A+  AL
Sbjct: 125 HAIRLTINNLAGVPSVVFGLFGLSMFVTAMKMGV-SLLAGMFTLAALVLPLIIGASEEAL 183

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+V  + R A+LGLGA+K QT+   VLP A+P+ILTG+ +++ RA GETA ++F   + F
Sbjct: 184 RSVSQTYREASLGLGATKWQTISLVVLPAALPSILTGAILAVGRAAGETAAIMFTAAMFF 243

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNR 420
               P  V D   A P  IY+ A       + R   FG  L+L++ +  +N   + +R R
Sbjct: 244 SPRLPDSVFDSVMALPYHIYVLATAGTEIELTRPMQFGTSLVLIVLVLGMNLMAIIMRAR 303

Query: 421 FKKR 424
            ++R
Sbjct: 304 LQRR 307


>gi|257467877|ref|ZP_05631973.1| phosphate ABC transporter, inner membrane subunit PstA
           [Fusobacterium ulcerans ATCC 49185]
 gi|317062166|ref|ZP_07926651.1| phosphate ABC transporter [Fusobacterium ulcerans ATCC 49185]
 gi|313687842|gb|EFS24677.1| phosphate ABC transporter [Fusobacterium ulcerans ATCC 49185]
          Length = 280

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 75/254 (29%), Positives = 127/254 (50%), Gaps = 1/254 (0%)

Query: 171 WFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAI 230
           +              ++ F      +     GI  A++G++Y+ +  I +S P GI + I
Sbjct: 28  FLIIGYIIYKGIPAISWEFLTEMPRNGMREGGIFPAIIGTIYLTIGTIVVSVPFGIFTGI 87

Query: 231 YLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMT 290
           YL E++     +  +   I NLA +PSI+YG+ G A+ + F      + + G L L +M 
Sbjct: 88  YLVEYAKDNLLTRIINLTIINLAGIPSIIYGLFGMALFVIFLGFGV-SIISGSLTLGIMC 146

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP II +T  +L  +P+ +R A+L LGA+K +T+   VLP A+P ILTG  +S++RA GE
Sbjct: 147 LPVIITSTRESLLAIPNHLREASLALGATKWETITKVVLPAALPGILTGVILSISRAAGE 206

Query: 351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
           TAP++F  +  ++   P    D   A P  +Y+ +       V    G + +L++     
Sbjct: 207 TAPIMFTAVAFYLPFLPETPWDQVMALPYHLYVISTQVPNMPVSYMNGTLFVLVVITISF 266

Query: 411 NTAMLWLRNRFKKR 424
           N     +R +F  +
Sbjct: 267 NLIGAVIRQKFNNK 280


>gi|307718242|ref|YP_003873774.1| transporter [Spirochaeta thermophila DSM 6192]
 gi|306531967|gb|ADN01501.1| transporter [Spirochaeta thermophila DSM 6192]
          Length = 300

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 96/242 (39%), Positives = 146/242 (60%), Gaps = 1/242 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  S  PE AG+G  + GS Y++++V  + FP G+ +AIYLEE++ +G  + 
Sbjct: 57  WLDWQFLTSPPSRFPEKAGVGPVLAGSFYLIVLVGVMVFPFGVGAAIYLEEYAREGRLTR 116

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI NLA VPSIVYG+LG  V +    +P    LV GL L L  LP +I++   A+R
Sbjct: 117 LIETNIANLAGVPSIVYGLLGLGVFVGVMHLPIGCLLVAGLTLMLRVLPIVIVSAQEAIR 176

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S R A+LG+G ++ Q +   VLP A P I+TG  ++LA A+GETAPL+ VG+   +
Sbjct: 177 AVPDSHRFASLGMGTTRWQMITSVVLPEAFPGIMTGIILALANAMGETAPLIMVGVAHSI 236

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFK 422
              P G+     A P+QI+ W+   +  F       AI++LL+ L ++N   ++LR+RF 
Sbjct: 237 FTPPRGLLSAFGALPLQIFAWSDYPKPEFQHGVVPAAIVVLLVTLMLLNGIAVYLRHRFS 296

Query: 423 KR 424
           KR
Sbjct: 297 KR 298


>gi|298528290|ref|ZP_07015694.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511942|gb|EFI35844.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 285

 Score =  177 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 132/243 (54%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F            GI   +VG++Y+ L  I ++FPLG+ +AIYL EFS  G ++ 
Sbjct: 43  AISWEFLTEHPRKSMTEGGIWPCIVGTVYISLGSILVAFPLGVGTAIYLNEFSGGGRWTR 102

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++  I NLA VPS+VYG+ G A  + +  M   + L G L L    LP II +   ALR
Sbjct: 103 IIRMGIINLAGVPSVVYGLFGLAFFVLYLNMGV-SLLAGSLTLGAFILPLIIGSAEEALR 161

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S R A+L LGA+K QTV+  VLP A+P++LTG  + ++RA GETAP++F   V + 
Sbjct: 162 NVPQSYREASLALGATKWQTVYRMVLPAALPSMLTGMILGVSRAAGETAPIMFTAAVFYT 221

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  IY+ A         R   +G  L L+  +  +N   + +RN+ 
Sbjct: 222 GKIPSSIFDEIMAMPYHIYVLATAGVNIDQTRPLQYGTALTLMFLVLGLNLVAILVRNKL 281

Query: 422 KKR 424
           ++R
Sbjct: 282 QRR 284


>gi|315186295|gb|EFU20056.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Spirochaeta thermophila DSM 6578]
          Length = 300

 Score =  177 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 95/242 (39%), Positives = 144/242 (59%), Gaps = 1/242 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  S  PE AG+G  + GS Y++++V  + FP G+ +AIYLEE++ +G    
Sbjct: 57  WLDWQFLTSPPSRFPEKAGVGPVLAGSFYLIVLVGLMVFPFGVGAAIYLEEYAKEGRLKR 116

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI NLA VPSIVYG+LG  V +    +P    LV  L L L  LP +I++   A+R
Sbjct: 117 LIETNIANLAGVPSIVYGLLGLGVFVGVMHLPIGCLLVASLTLMLRVLPIVIVSAQEAIR 176

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S R A+LG+G ++ Q +   VLP A P I+TG  ++LA A+GETAPL+ VG+   +
Sbjct: 177 AVPDSHRFASLGMGTTRWQMITSVVLPEAFPGIMTGIILALANAMGETAPLIMVGVAHSI 236

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFK 422
              P G+     A P+QI+ W+   +  F       AI++LL+ L ++N   ++LR+RF 
Sbjct: 237 FTPPRGLLSAFGALPLQIFAWSDYPKPEFQHGVVPAAIVVLLVTLMLLNGIAVYLRHRFS 296

Query: 423 KR 424
           KR
Sbjct: 297 KR 298


>gi|220932988|ref|YP_002509896.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halothermothrix orenii H 168]
 gi|219994298|gb|ACL70901.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halothermothrix orenii H 168]
          Length = 284

 Score =  177 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 89/237 (37%), Positives = 132/237 (55%), Gaps = 3/237 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F      +     GI  A+VG+ Y+ +I   +S PLG+ +AIYL E++ KG  + 
Sbjct: 39  AISWEFLTRMPENGMTEGGIFPAIVGTFYVTVITALVSVPLGMFAAIYLNEYARKGILTR 98

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++  I NL+ VPSIV+G+ G A+ +       ++ L  GL L LMTLP  I A+  AL+
Sbjct: 99  VIRMAIRNLSGVPSIVFGLFGVALFVQGMGF-GTSILSAGLTLGLMTLPITITASEEALK 157

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           TVP S R  AL LGA+K Q++  +VLP A+P +LTGS + LARA GETAP+LF G   F+
Sbjct: 158 TVPRSYREGALALGATKWQSIKTNVLPAAIPGMLTGSILGLARAAGETAPILFTGAAFFL 217

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPF--VERTFGAILLLLIFLAVINTAMLWLR 418
              P  +     A P  +Y+ A             +G  ++L+  + VIN A + +R
Sbjct: 218 PFLPDSLFSQFMALPYHLYILATQHHAIAKVRPLAYGTAMVLITLVLVINLAAIIIR 274


>gi|219667309|ref|YP_002457744.1| phosphate ABC transporter inner membrane subunit PstA
           [Desulfitobacterium hafniense DCB-2]
 gi|219537569|gb|ACL19308.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfitobacterium hafniense DCB-2]
          Length = 295

 Score =  177 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 95/243 (39%), Positives = 153/243 (62%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  +  S  PE AGI  A++G++ MMLIVI ++  LG+++AIYLEE++ KG    
Sbjct: 53  WLDGQFLTSNLSIFPEKAGIYGAIIGTILMMLIVIPVTIILGVSTAIYLEEYAQKGRLQY 112

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +  NI+NLASVPS+++G+LG  V      +  S+ L GGL ++L+ LP +++A   A+R
Sbjct: 113 LINVNISNLASVPSVIFGLLGLTVFGRLMNL-GSSILAGGLTMSLLVLPIVVVAAQEAIR 171

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP  +R A+  +GA K  TV   +LP+A+P ILTG+ ++++RA+GETAPL+ +G+   +
Sbjct: 172 AVPDFLREASYAMGADKWTTVRKVILPVAIPGILTGTILAMSRAIGETAPLVVLGIPTLI 231

Query: 364 TDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  V D  T  P+QIY W  DA  +  +       I++LL+ L ++N+  + +RN+F
Sbjct: 232 MRIPTSVMDDFTVLPIQIYYWTLDAVLKPEYANLAAATIVVLLVILFLMNSVAVIIRNKF 291

Query: 422 KKR 424
           ++R
Sbjct: 292 QQR 294


>gi|237718415|ref|ZP_04548896.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|293371418|ref|ZP_06617849.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           ovatus SD CMC 3f]
 gi|299149070|ref|ZP_07042132.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           3_1_23]
 gi|229452348|gb|EEO58139.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|292633615|gb|EFF52173.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           ovatus SD CMC 3f]
 gi|298513831|gb|EFI37718.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           3_1_23]
          Length = 291

 Score =  177 bits (449), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 136/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWDFITSAPTDGMTGGGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGRLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P G+ D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 225 PQLPTGILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIMIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|255693908|ref|ZP_05417583.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           finegoldii DSM 17565]
 gi|260620273|gb|EEX43144.1| phosphate ABC transporter, permease protein PstA [Bacteroides
           finegoldii DSM 17565]
          Length = 291

 Score =  177 bits (449), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 135/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWEFITSSPTDGMTGGGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 225 PHLPASILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIMIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|89896862|ref|YP_520349.1| hypothetical protein DSY4116 [Desulfitobacterium hafniense Y51]
 gi|89336310|dbj|BAE85905.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 303

 Score =  177 bits (449), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 95/243 (39%), Positives = 153/243 (62%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  +  S  P  AGI   ++G++ MMLIVI ++  LG+++AIYLEE++ KG    
Sbjct: 61  WLDLQFLTSNLSIFPHKAGIYGVILGTVMMMLIVIPVTTVLGVSTAIYLEEYAQKGKLQY 120

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +  NI+NLASVPS+++G+LG  V      +  S+ L GGL ++L+ LP +++A   A+R
Sbjct: 121 LINVNISNLASVPSVIFGLLGLTVFGRLMNL-GSSILAGGLTMSLLVLPIVVVAAQEAIR 179

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VPS +R A+  +GA K  TV   VLP+A+P ILTG+ ++++RA+GETAPL+ +G+   +
Sbjct: 180 AVPSFLREASYAMGADKWTTVRKVVLPVALPGILTGTILAMSRAIGETAPLVVLGIPTLI 239

Query: 364 TDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
             +P  V D  TA P+QIY W  D+  +  +       I++LL  L ++N+  + +RN+F
Sbjct: 240 MKFPTSVMDNFTALPIQIYYWTLDSVLKPEYANLAAATIVVLLAILFLMNSVAIIIRNKF 299

Query: 422 KKR 424
           ++R
Sbjct: 300 QQR 302


>gi|219850476|ref|YP_002464909.1| phosphate ABC transporter inner membrane subunit PstA [Chloroflexus
           aggregans DSM 9485]
 gi|219544735|gb|ACL26473.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chloroflexus aggregans DSM 9485]
          Length = 311

 Score =  177 bits (448), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 107/243 (44%), Positives = 157/243 (64%), Gaps = 1/243 (0%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
                + FF N  S  PE AG   A+VG+LY + + I  +FPLG+A+AIYLEE++   +F
Sbjct: 69  TNWLTWEFFNNFDSRFPERAGAKAAIVGTLYTISLTILFAFPLGVAAAIYLEEYARDNWF 128

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           S  V+ NI+NLA+VPSI+YG+LG  V   +  + R + + G L LAL+ +P II+A+  +
Sbjct: 129 SKLVEINISNLAAVPSIIYGLLGLQVFARWLFLGR-SIITGALTLALLVVPIIIVASRES 187

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R VP S+R A+  LGA++ QTV+H VLP ++  ILTGS ++++RA+GETAPL+ +G + 
Sbjct: 188 IRAVPLSLRQASYALGATRWQTVWHVVLPQSIGGILTGSILAVSRAIGETAPLITIGALT 247

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
           FV   P  V DI T  P+QI+ W +     F       IL+LL  L +IN   ++LRNR+
Sbjct: 248 FVPFLPRSVFDIFTVLPIQIFNWTSRPNDDFRALAAAGILVLLTILLLINALAIYLRNRY 307

Query: 422 KKR 424
           +KR
Sbjct: 308 QKR 310



 Score = 36.6 bits (83), Expect = 8.1,   Method: Composition-based stats.
 Identities = 8/43 (18%), Positives = 19/43 (44%)

Query: 10 NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALW 52
          NLK+R+    +       +++     L++L+  + +K  G   
Sbjct: 24 NLKWRHFKGTILTILGWFSIVFGLGILVVLIFDVTNKATGIFT 66


>gi|169829092|ref|YP_001699250.1| ABC transporter permease [Lysinibacillus sphaericus C3-41]
 gi|168993580|gb|ACA41120.1| Probable ABC transporter permease protein [Lysinibacillus
           sphaericus C3-41]
          Length = 292

 Score =  177 bits (448), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 98/242 (40%), Positives = 153/242 (63%), Gaps = 1/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N  F  N AS   + AG+  A++GSL++M +V  +S  LG+ +AIYLEE++ K   +
Sbjct: 51  DYLNIDFLTNFASRFADKAGVKAALIGSLWLMAVVAPVSIILGVGTAIYLEEYAKKNRIN 110

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ NI+NLA VPSIV+G+LG  + +    +   + L  GL ++L+ LP II+A   A+
Sbjct: 111 DFIRMNISNLAGVPSIVFGLLGLTIFVRMMGL-GKSVLAAGLTMSLLILPVIIVAAQEAI 169

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP+  R A+ G+GA+K QT+   VLP A+P ILTGS ++++RA+GETAPL+ +G+   
Sbjct: 170 RAVPNEQREASYGMGATKWQTILRVVLPAAIPGILTGSILAMSRAIGETAPLVVIGIPVI 229

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P G+    TA P+QIY WA   +  F       IL+L+  L ++N+  +++RN+F+
Sbjct: 230 LQFLPNGLLSQFTALPMQIYDWAKRPQEAFQYVAAAGILVLMTVLLLMNSIAIFIRNKFQ 289

Query: 423 KR 424
           KR
Sbjct: 290 KR 291


>gi|126652195|ref|ZP_01724374.1| ABC-type phosphate transport system permease component [Bacillus
           sp. B14905]
 gi|126590927|gb|EAZ85039.1| ABC-type phosphate transport system permease component [Bacillus
           sp. B14905]
          Length = 292

 Score =  177 bits (448), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 98/242 (40%), Positives = 154/242 (63%), Gaps = 1/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N  F +N AS   + AG+  A++GSL++M +V  +S  LG+ +AIYLEE++ K   +
Sbjct: 51  DYLNIDFLMNFASRFADKAGVKAALLGSLWLMAVVAPVSIILGVGTAIYLEEYAKKNRIN 110

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ NI+NLA VPSIV+G+LG  + +    +   + L  GL ++L+ LP II+A   A+
Sbjct: 111 DFIRMNISNLAGVPSIVFGLLGLTIFVRMMGL-GKSVLAAGLTMSLLILPVIIVAAQEAI 169

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP+  R A+ G+GA+K QT+   VLP A+P ILTGS ++++RA+GETAPL+ +G+   
Sbjct: 170 RAVPNEQREASYGMGATKWQTILRVVLPAAIPGILTGSILAMSRAIGETAPLVVIGIPVI 229

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P G+    TA P+QIY WA   +  F       IL+L+  L ++N+  +++RN+F+
Sbjct: 230 LQFLPNGLLSQFTALPMQIYDWAKRPQEAFQYVAAAGILVLMTVLLLMNSIAIFIRNKFQ 289

Query: 423 KR 424
           KR
Sbjct: 290 KR 291


>gi|300868509|ref|ZP_07113128.1| phosphate ABC transporter permease (modular protein) [Oscillatoria
           sp. PCC 6506]
 gi|300333498|emb|CBN58316.1| phosphate ABC transporter permease (modular protein) [Oscillatoria
           sp. PCC 6506]
          Length = 638

 Score =  177 bits (448), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 95/243 (39%), Positives = 149/243 (61%), Gaps = 6/243 (2%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           F   ++ F    +S +PE +GI  A++G+ +++ +    + P+G+ +AIYLEE+     F
Sbjct: 390 FFRLDWEFITTFSSRKPEDSGIYAALIGTFWLLGLTAIFATPIGVGAAIYLEEYIPDNIF 449

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKM--PRSTALVGGLILALMTLPSIIIATG 299
           S F++ NI NLA++PSI+YG+LG  V ++        S+ L   L L+++ LP +IIAT 
Sbjct: 450 SQFLEINIANLAAMPSIIYGLLGLGVFVHALGFFTGESSILSASLTLSVIILPLLIIATR 509

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            ALRTVP S+R A    G ++ Q +F+ VLP ++P ILTG+ +SL+ A+GETAPLL +G 
Sbjct: 510 SALRTVPYSLREAGYATGMTRWQVLFYIVLPSSLPGILTGTLLSLSGAIGETAPLLAIGA 569

Query: 360 VAFVTDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            AF+T  P     G+    T+ PVQI+ W +  +  F E    AI++L+  L ++N A +
Sbjct: 570 SAFITFTPPLSLEGLRSPFTSLPVQIFNWVSRPQADFQENAAAAIIVLIGILFLMNFAAI 629

Query: 416 WLR 418
            LR
Sbjct: 630 ILR 632



 Score =  126 bits (317), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 99/233 (42%), Gaps = 11/233 (4%)

Query: 198 PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPS 257
            +  GI V   G+L    I +  + P+G+ +AIYL E++ +      ++ ++  LA +P+
Sbjct: 80  NKTFGIMVLASGTLLTTAIAMTFAMPIGLLAAIYLSEYAPQT-VRYILKPSLETLAGIPT 138

Query: 258 IVYGILGSAVLINFFK-----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSA 312
           +VYG      +    +     +   + L  GL+  +M +P I   +  A+ +VP+  R  
Sbjct: 139 VVYGYFALLFVTPLLQKIIPNLAGFSPLSAGLVTGVMIVPIISSLSEDAINSVPNKFREG 198

Query: 313 ALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTD 372
           A  LG +K + +   VLP+A P I+   T++ +R+LGET              + +   +
Sbjct: 199 AYALGLTKREVITKIVLPIAFPGIIASFTLAASRSLGETLIASIAAGQT--PQFTLNPLE 256

Query: 373 IATAFPVQIYLWAAD---AERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             +     I   +              F   +++ +    +N    WL   ++
Sbjct: 257 PVSTMTAFIIQLSLGDVPFNSLEFHIIFTVGMVIFLLTLTLNILSYWLVRNYR 309


>gi|229086839|ref|ZP_04219001.1| ABC transporter permease protein [Bacillus cereus Rock3-44]
 gi|228696483|gb|EEL49306.1| ABC transporter permease protein [Bacillus cereus Rock3-44]
          Length = 288

 Score =  177 bits (448), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 88/252 (34%), Positives = 148/252 (58%), Gaps = 1/252 (0%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
                            +  FFIN AS  P+ AGI  A+ G++  M IV+ +SF  G+ +
Sbjct: 37  VLIVLLYQIVEKGVSYLSIDFFINFASRDPKQAGIAAALSGTVLFMSIVVPVSFVFGVGT 96

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           A+YLE ++ +  F+  V+ NI  LA VPS+V+G+LG  + +   ++   + +   L ++L
Sbjct: 97  ALYLEHYAKRSVFTRIVELNIQTLAGVPSVVFGLLGLTIFVYGLQL-GESIITAALTMSL 155

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP++++++  A+R VP ++  A+ G+GA+K QT++  VLP A+P +LTG  ++L+RA+
Sbjct: 156 LVLPTVVVSSQEAIRMVPGNLLEASYGVGATKWQTMYQIVLPTALPGVLTGCVLALSRAI 215

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++LL  L 
Sbjct: 216 GEAAPLLVIGALAFANYIPFDMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLL 275

Query: 409 VINTAMLWLRNR 420
           ++N  +LWLRNR
Sbjct: 276 IMNAIVLWLRNR 287


>gi|260173872|ref|ZP_05760284.1| putative ABC transporter permease protein [Bacteroides sp. D2]
 gi|315922135|ref|ZP_07918375.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313696010|gb|EFS32845.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 291

 Score =  176 bits (447), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 136/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWDFITSAPTDGMTGGGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGRLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P G+ D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 225 PQLPTGILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIMIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|298674022|ref|YP_003725772.1| phosphate ABC transporter inner membrane subunit PstA
           [Methanohalobium evestigatum Z-7303]
 gi|298287010|gb|ADI72976.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methanohalobium evestigatum Z-7303]
          Length = 283

 Score =  176 bits (447), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 103/241 (42%), Positives = 157/241 (65%), Gaps = 2/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
            F+  F  N  S  PE AGI  A++GS+Y+ML+V   SFPLG+ +AIYLEE++ +    +
Sbjct: 44  WFDLAFIFNSPSRFPEEAGIYPALIGSIYLMLLVAVFSFPLGVGTAIYLEEYAGQSRIKN 103

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI+NLA+VPSIVYG+LG A+ +    M R + + G L L L+ LP +I+++  A++
Sbjct: 104 IIELNISNLAAVPSIVYGLLGLALFVRALNMGR-SLIAGALTLTLLILPIVIVSSQEAIK 162

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S+R A+ G+GA+K QT+   V+P A+P I+TG+ +SL+RA+GETAPL+ +G    +
Sbjct: 163 AVPDSLRDASYGIGATKWQTIRKIVIPEALPGIMTGTILSLSRAIGETAPLIMIGAATSM 222

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFK 422
              P G+  + +A P+QIY W    +  F E      ILLLLI L  +N+  + +RNRF+
Sbjct: 223 YSAPDGIFSLFSAMPLQIYAWVGQPQYAFQEGVASAGILLLLIVLLTMNSVAILIRNRFQ 282

Query: 423 K 423
           +
Sbjct: 283 R 283


>gi|319651559|ref|ZP_08005686.1| phosphate ABC transporter [Bacillus sp. 2_A_57_CT2]
 gi|317396626|gb|EFV77337.1| phosphate ABC transporter [Bacillus sp. 2_A_57_CT2]
          Length = 294

 Score =  176 bits (447), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 106/243 (43%), Positives = 158/243 (65%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  F +N  S+ PE AGI  A+ G+L++ML+V  ++  LG+ +AIYLEE++ KG  SS
Sbjct: 52  WINMDFLMNRLSTDPERAGIWGAITGTLWLMLVVAPVTMILGVGTAIYLEEYAAKGRISS 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++ NI+NLA VPS+V+GILG  V      +  S  L GGL +AL+ LP +++A+  A+R
Sbjct: 112 FIKTNISNLAGVPSVVFGILGLTVFARALDL-GSVVLAGGLTMALLVLPVVVVASQEAIR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP  +R A+ G+GA+K QT+ + VLP A+P ILTG  ++L+RA+GETAPL+ +G+ A +
Sbjct: 171 AVPQFLREASYGMGATKWQTIKNVVLPAALPGILTGVILALSRAIGETAPLVVIGIPALL 230

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P G+ D  T  PVQIY W  D+     +       I++LLI L  +N+  + +RN+F
Sbjct: 231 IPVPDGIFDKFTILPVQIYYWTIDSALVAEYANLAAATIVILLIVLFAMNSIAILIRNKF 290

Query: 422 KKR 424
           +KR
Sbjct: 291 QKR 293


>gi|288553549|ref|YP_003425484.1| phosphate ABC transporter permease [Bacillus pseudofirmus OF4]
 gi|288544709|gb|ADC48592.1| phosphate ABC transporter (permease) [Bacillus pseudofirmus OF4]
          Length = 306

 Score =  176 bits (446), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 158/243 (65%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  F     S+ P+ AGI  A++G+L++M +V  ++  LG+ +AIYLE ++ KG   S
Sbjct: 64  WINVDFLTGRLSNNPDRAGIMGAILGTLWLMAVVAPVTMLLGVGTAIYLEAYAKKGKIHS 123

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F+QANI+NLA VPSIV+GILG  + +    +     L GGL ++L+ LP +++A+  A+R
Sbjct: 124 FIQANISNLAGVPSIVFGILGMTIFVRALDLGG-VVLAGGLTMSLLVLPIVVVASQEAIR 182

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP+ +  A+ G+GA+K QT+ + +LP A+P ILTG+ +SL+RA+GETAPL+ +G+ A +
Sbjct: 183 AVPNHLSEASYGMGATKWQTIKNVILPAALPGILTGAILSLSRAIGETAPLIVIGIPALL 242

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
             +P G+ D  T  PVQIY W  DA     +       I++LLI L ++N+  + +RN+F
Sbjct: 243 IPFPGGLMDRFTILPVQIYYWTIDASLVAEYANLAAATIIVLLIVLFILNSTAIIIRNKF 302

Query: 422 KKR 424
           ++R
Sbjct: 303 QQR 305


>gi|261408695|ref|YP_003244936.1| phosphate ABC transporter inner membrane subunit PstA
           [Paenibacillus sp. Y412MC10]
 gi|329929177|ref|ZP_08282963.1| phosphate ABC transporter, permease protein PstA [Paenibacillus sp.
           HGF5]
 gi|261285158|gb|ACX67129.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus sp. Y412MC10]
 gi|328936854|gb|EGG33289.1| phosphate ABC transporter, permease protein PstA [Paenibacillus sp.
           HGF5]
          Length = 291

 Score =  176 bits (445), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 98/241 (40%), Positives = 149/241 (61%), Gaps = 1/241 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              +   F N  S   + AG+   +VG++Y++L++  LSF LG+ +AI+LEE++ +  + 
Sbjct: 50  HRLSPELFTNFPSRIADKAGLKSPIVGTIYLLLLMAPLSFVLGVGAAIFLEEYAGRSRWV 109

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             +Q NI+ LA VPSI+YGILG A+ +    + R + L G L + L+ LP II+A   AL
Sbjct: 110 RLIQLNISTLAGVPSIIYGILGLAIFVRGMNLGR-SLLSGVLTMTLLVLPIIIVAAQEAL 168

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP + R A+  LGA+K QTV   VLP A+P I+TG  ++L+RA+GETAPL+ +G + +
Sbjct: 169 RAVPKNRRDASYALGATKWQTVSSAVLPSAIPGIMTGVILALSRAIGETAPLIMIGALTY 228

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           V   P  + D  T  P+QI+ W +     F E     I+LLLI L ++N A +W+RN++ 
Sbjct: 229 VAFLPENLLDSFTVMPIQIFNWVSRPSEAFHELAASGIILLLIMLFIMNIAAVWIRNKYS 288

Query: 423 K 423
           K
Sbjct: 289 K 289


>gi|326802092|ref|YP_004319911.1| phosphate ABC transporter inner membrane subunit PstA
           [Sphingobacterium sp. 21]
 gi|326552856|gb|ADZ81241.1| phosphate ABC transporter, inner membrane subunit PstA
           [Sphingobacterium sp. 21]
          Length = 281

 Score =  176 bits (445), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 136/243 (55%), Gaps = 3/243 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
               + F     +      GI  A++G++ + LI   ++ P GI  AIYL E++   +F+
Sbjct: 37  PVLTWDFVSTLPTDGMTNGGILPAIIGTVMLTLITAVVAAPFGIGCAIYLNEYAPNTWFT 96

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++A+I NLA VPSI+YG+ G A+ +    M  ++ L  G  L L++LP II  T  AL
Sbjct: 97  RLIRASIRNLAGVPSIIYGLFGLALFVQGLNM-GTSLLSAGFTLGLLSLPYIITTTEEAL 155

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P+S R  ALG+GA++ +++   VLP A+P ILTG  ++L+RA GETAP+LF G+  +
Sbjct: 156 RRIPASTREGALGVGATQFESIRDMVLPSALPGILTGMVLALSRAAGETAPILFTGVAFY 215

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           + +    +     A P  +Y+ +   +         +G  L+L++ + ++N+   ++R +
Sbjct: 216 INNPTGYLNQEFMALPYHLYMLSTQHQAIEEVRPLAYGTALILIMVVFILNSIAFYIRYK 275

Query: 421 FKK 423
             K
Sbjct: 276 HSK 278


>gi|300868506|ref|ZP_07113125.1| Phosphate ABC transporter, permease protein [Oscillatoria sp. PCC
           6506]
 gi|300333495|emb|CBN58313.1| Phosphate ABC transporter, permease protein [Oscillatoria sp. PCC
           6506]
          Length = 307

 Score =  176 bits (445), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 90/258 (34%), Positives = 141/258 (54%), Gaps = 16/258 (6%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ FF +  S R   AGI  A VGS  +M +    + PLGIAS IYLEE++ K + +
Sbjct: 51  PRLSWQFFTSFPSRRAGEAGILSAWVGSTLVMFVTGLAAVPLGIASGIYLEEYARKNWIA 110

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ N+ NLA VPSIVYG+L   + +    + +S    G  +  L+ LP +I+ T  A+
Sbjct: 111 DLIEINVTNLAGVPSIVYGLLALGLFVYKLNLGQSILTAGLTLALLI-LPVVIVTTREAI 169

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P+SIR AA  +GASK Q +++H+LP +  +I+TG  V L+RA+GETAPL+ +G + F
Sbjct: 170 RAIPNSIREAAYAVGASKWQMIWNHILPYSAGSIMTGVIVGLSRAIGETAPLITIGALTF 229

Query: 363 VTDYPVGVTD-------------IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                    T  P+Q++ W +  +  F      A L+L+     
Sbjct: 230 IAFLPDSPFQAEFPFFSFKWLMSPFTIMPIQMFNWVSRPQAEFQINAAAAGLVLMAMTLA 289

Query: 410 INTAMLWLRNRFKK--RW 425
           +N   ++LR RF+K  +W
Sbjct: 290 MNALAIYLRYRFRKNIKW 307


>gi|299537692|ref|ZP_07050981.1| phosphate ABC transporter, permease protein PstA [Lysinibacillus
           fusiformis ZC1]
 gi|298726671|gb|EFI67257.1| phosphate ABC transporter, permease protein PstA [Lysinibacillus
           fusiformis ZC1]
          Length = 292

 Score =  176 bits (445), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 99/242 (40%), Positives = 153/242 (63%), Gaps = 1/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N  F  N AS   + AGI  A++GSL++M +V  +S  LG+ +AIYLEE++ K   +
Sbjct: 51  DYLNIDFLTNFASRFADKAGIKAALIGSLWLMAVVAPVSIILGVGTAIYLEEYAKKNKIN 110

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ NI+NLA VPSIV+G+LG  + +   ++   + L  G  ++L+ LP II+A   A+
Sbjct: 111 DFIRMNISNLAGVPSIVFGLLGLTIFVRMMEL-GKSILAAGFTMSLLILPVIIVAAQEAI 169

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP+  R A+ G+GA+K QT+   VLP A+P ILTGS ++L+RA+GETAPL+ +G+   
Sbjct: 170 RAVPNEQREASYGMGATKWQTILRVVLPAAIPGILTGSILALSRAIGETAPLVVIGIPVI 229

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P G+    TA P+QIY WA   +  F       IL+L+  L ++N+  +++RN+F+
Sbjct: 230 LQFLPNGLLSQFTALPMQIYDWAKRPQEAFQYVAAAGILVLMTVLLLMNSIAIYIRNKFQ 289

Query: 423 KR 424
           KR
Sbjct: 290 KR 291


>gi|269122664|ref|YP_003310841.1| phosphate ABC transporter inner membrane subunit PstA [Sebaldella
           termitidis ATCC 33386]
 gi|268616542|gb|ACZ10910.1| phosphate ABC transporter, inner membrane subunit PstA [Sebaldella
           termitidis ATCC 33386]
          Length = 293

 Score =  176 bits (445), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 152/243 (62%), Gaps = 3/243 (1%)

Query: 183 LDFNYGFFINGASS-RPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS-HKGF 240
              ++ F  N  S  RP+ AG+  A++GSL+++ +V  ++ P+G+ +AIYLEE+S  K  
Sbjct: 48  RWMSFDFLTNFPSKIRPQRAGVYPALLGSLWLVGLVGLITIPVGVGAAIYLEEYSNKKSK 107

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
             +F++ NI+NLA VP+IVYG+LG A+        R + L G + L+LM LP +I+++  
Sbjct: 108 LYNFLEVNISNLAGVPAIVYGLLGLALFSRLKGF-RGSILAGAVTLSLMVLPVVIVSSRE 166

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           A++ VP  +R AA GLG ++ Q +   VLP A P I TG  +SL+RALGE APLL VG  
Sbjct: 167 AIKAVPGILREAAYGLGLTRWQMIKAVVLPYASPGIFTGIILSLSRALGEAAPLLVVGAA 226

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           ++VT  P G+    TA P+QIY W+   ++ F E     I++LL+ L   NT  + LRN+
Sbjct: 227 SYVTRIPNGIMSRYTALPIQIYQWSGMPKKEFQELAATGIIVLLVILLSANTLAIVLRNK 286

Query: 421 FKK 423
           ++K
Sbjct: 287 YQK 289



 Score = 39.7 bits (91), Expect = 0.88,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 10 NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGI 48
          NL+ R + + +F++     ++   VFL+LLL  I+ +GI
Sbjct: 9  NLRIRKLKDKIFKYLFFSCIIFCIVFLVLLLFGIIKQGI 47


>gi|27467986|ref|NP_764623.1| phosphate ABC transporter [Staphylococcus epidermidis ATCC 12228]
 gi|251810816|ref|ZP_04825289.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282876176|ref|ZP_06285043.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis SK135]
 gi|293366649|ref|ZP_06613326.1| phosphate ABC superfamily ATP binding cassette transporter,
           permease protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315531|gb|AAO04665.1|AE016747_162 phosphate ABC transporter [Staphylococcus epidermidis ATCC 12228]
 gi|251805651|gb|EES58308.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281295201|gb|EFA87728.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis SK135]
 gi|291319418|gb|EFE59787.1| phosphate ABC superfamily ATP binding cassette transporter,
           permease protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329729354|gb|EGG65760.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis VCU144]
 gi|329732923|gb|EGG69268.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis VCU028]
 gi|329736953|gb|EGG73211.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis VCU045]
          Length = 301

 Score =  176 bits (445), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 105/236 (44%), Positives = 155/236 (65%), Gaps = 1/236 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AGI  A+VGS++++L +I +S  LGI +AIYLEE++    F+  V+ +
Sbjct: 66  FFTNFSSSTPADAGIKGALVGSIWLILSIIPISIILGIGTAIYLEEYARDNIFTQIVKVS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPSIV+G+LG  + +    +  ++ L   L ++L+ LP II+A+  A+R VPSS
Sbjct: 126 ISNLAGVPSIVFGLLGYTLFVGAAGL-GNSVLAAALTMSLLILPVIIVASQEAIRAVPSS 184

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +   P 
Sbjct: 185 VREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVMIGIPTILLATPS 244

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           G+ D  +A P QIY WA   +  F       I++LL+ L ++NT  + LRN+F K+
Sbjct: 245 GLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLLMNTVAILLRNKFSKK 300


>gi|315648813|ref|ZP_07901908.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus vortex V453]
 gi|315275781|gb|EFU39133.1| phosphate ABC transporter, inner membrane subunit PstA
           [Paenibacillus vortex V453]
          Length = 291

 Score =  175 bits (444), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 98/241 (40%), Positives = 149/241 (61%), Gaps = 1/241 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              +   F N  S   + AG+   +VG++Y++L++  LSF LG+ +AI+LEE++ +  + 
Sbjct: 50  HRLSPELFTNFPSRIADKAGLKSPIVGTIYLLLLMAPLSFILGVGAAIFLEEYAGRSRWV 109

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             +Q NI+ LA VPSI+YGILG A+ +    + R + L G L + L+ LP II+A   AL
Sbjct: 110 RLIQLNISTLAGVPSIIYGILGLAIFVRGMNLGR-SLLSGVLTMTLLVLPIIIVAAQEAL 168

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP + R A+  LGA+K QTV   VLP A+P I+TG  ++L+RA+GETAPL+ +G + +
Sbjct: 169 RAVPKNRRDASYALGATKWQTVSSAVLPSAIPGIMTGVILALSRAIGETAPLIMIGALTY 228

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           V   P  + D  T  P+QI+ W +     F E     I+LLLI L ++N A +W+RN++ 
Sbjct: 229 VAFLPENLLDSFTVMPIQIFNWVSRPSEAFHELAASGIILLLIMLFIMNIAAVWIRNKYS 288

Query: 423 K 423
           K
Sbjct: 289 K 289


>gi|57866923|ref|YP_188536.1| phosphate ABC transporter permease [Staphylococcus epidermidis
           RP62A]
 gi|242242665|ref|ZP_04797110.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis W23144]
 gi|57637581|gb|AAW54369.1| phosphate ABC transporter, permease protein [Staphylococcus
           epidermidis RP62A]
 gi|242233801|gb|EES36113.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis W23144]
 gi|319401328|gb|EFV89539.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           epidermidis FRI909]
          Length = 301

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 104/236 (44%), Positives = 154/236 (65%), Gaps = 1/236 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AGI  A+VGS++++L +I +S  LGI +AIYLEE++    F+  V+ +
Sbjct: 66  FFTNFSSSTPADAGIKGALVGSIWLILSIIPISIILGIGTAIYLEEYARDNIFTQIVKVS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPSIV+G+LG  + +    +  ++ L   L ++L+ LP II+A+  A+R VPSS
Sbjct: 126 ISNLAGVPSIVFGLLGYTLFVGAAGL-GNSVLAAALTMSLLILPVIIVASQEAIRAVPSS 184

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +   P 
Sbjct: 185 VREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVMIGIPTILLATPS 244

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           G+ D  +A P QIY WA   +  F       I++LL+ L ++N   + LRN+F K+
Sbjct: 245 GLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLLMNAIAILLRNKFSKK 300


>gi|152976703|ref|YP_001376220.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           cereus subsp. cytotoxis NVH 391-98]
 gi|152025455|gb|ABS23225.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           cytotoxicus NVH 391-98]
          Length = 288

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 148/237 (62%), Gaps = 1/237 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F I+ AS  P   GI  A+ G++  M IV+ +SF LG+ +A+YLE ++ +  F+ 
Sbjct: 52  YLSIDFLIHFASRHPNQTGIAAALSGTILFMSIVVPVSFILGVGTALYLEHYAKQSIFTR 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +  NI  LA VPS+V+G+LG  + +  F++   + +   L ++L++LP++++++  A+R
Sbjct: 112 MIALNIQTLAGVPSVVFGLLGLTIFVYAFQL-GESIVAAALTMSLLSLPTVVVSSQEAIR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP  +  A+ G+GA+K QT++  VLP A+P ILTG  ++L+RA+GE APLL +G +AF 
Sbjct: 171 MVPDGLLEASYGVGATKWQTMYQVVLPTALPGILTGCILALSRAIGEAAPLLVIGALAFA 230

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
              P+G+ D  T  P+QI+ W +  +  F       +++LL  L ++N  +LWLRNR
Sbjct: 231 NYIPLGIFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLLIMNMVVLWLRNR 287


>gi|325983293|ref|YP_004295695.1| phosphate ABC transporter, inner membrane subunit PstA
           [Nitrosomonas sp. AL212]
 gi|325532812|gb|ADZ27533.1| phosphate ABC transporter, inner membrane subunit PstA
           [Nitrosomonas sp. AL212]
          Length = 308

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 94/258 (36%), Positives = 144/258 (55%), Gaps = 16/258 (6%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ FF +  S RPE AGI  A VG+  +ML+    + PLGI S IYLEE++ +   +
Sbjct: 52  PRLSWEFFTSFPSRRPESAGILSAWVGTTLVMLVTAVAAVPLGIGSGIYLEEYAPRNLLT 111

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ N+ NLA VPSI+YG+L   + +    + +S     GL LAL+ LP +I+AT  A+
Sbjct: 112 EIIEINVTNLAGVPSIIYGLLALGLFVYQLGIGQSIL-AAGLALALLILPVVIVATREAI 170

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R++P +IR  A  LGA+K QTV  H+LP +   ILTG  + LARA+GETAP++ +G + F
Sbjct: 171 RSIPITIREGAYALGATKWQTVSDHLLPYSAAGILTGIIIGLARAIGETAPIITIGALTF 230

Query: 363 VTDYPVG-------------VTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P               +T   T  P+Q++ W +  E  F      A L+L++    
Sbjct: 231 IAFLPPSPVKNEFPFVSFEWLTAPFTVMPIQMFNWVSRPEEAFQLNAAAAGLVLVVMTLA 290

Query: 410 INTAMLWLRNRFKK--RW 425
           +N   ++LR R +K  +W
Sbjct: 291 MNGLAIYLRYRMRKNIKW 308


>gi|255010350|ref|ZP_05282476.1| phosphate transport system permease protein [Bacteroides fragilis
           3_1_12]
 gi|313148150|ref|ZP_07810343.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313136917|gb|EFR54277.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 291

 Score =  175 bits (443), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 133/243 (54%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M      +FP+G+ S IY+ E++ KG    
Sbjct: 46  VISWDFLTSAPTDGMTGGGIWPAIVGTFYLMTGSALFAFPVGVMSGIYMNEYAPKGKLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMDF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +         +   +G  L+L+  + ++N     LR  F
Sbjct: 225 PQLPTSILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIAIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +K+
Sbjct: 285 EKK 287


>gi|42741696|gb|AAS45094.1| phosphate permease [Alcaligenes faecalis]
          Length = 319

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 86/254 (33%), Positives = 146/254 (57%), Gaps = 14/254 (5%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  S +PE AGI  A VG+  +M++   L+ PLG+ + +YLEE++ K +F++
Sbjct: 63  RISFDFLTSFPSRKPEAAGILSAWVGTTLVMIVTAFLAIPLGVLAGLYLEEYAPKNWFTT 122

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI+NLA VPSI+YG+L   + +  F + + T  V G +LAL+ LP II++T  A+R
Sbjct: 123 LIEVNISNLAGVPSIIYGLLALGLFVYMFDLGQ-TVFVAGAVLALLILPVIIVSTREAVR 181

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           ++P  I+  A G+GA K QT+  ++LP A P ILTG+ V L+RA+GETAP++ +G + ++
Sbjct: 182 SIPQVIKEGAYGMGADKWQTMTGYILPAARPGILTGAIVGLSRAIGETAPVITIGALTYI 241

Query: 364 TDYPVGVTD-------------IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
              P                    T  P+Q++ W +  +  F        L+L+    V+
Sbjct: 242 AFLPTFPFQGDFPYLNFDWLNSPFTVMPIQMFNWLSRPQTEFHVNAAATGLILIGMTVVM 301

Query: 411 NTAMLWLRNRFKKR 424
           N   + +R + ++R
Sbjct: 302 NLIAIVIRFKLRRR 315


>gi|310779967|ref|YP_003968299.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Ilyobacter polytropus DSM 2926]
 gi|309749290|gb|ADO83951.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Ilyobacter polytropus DSM 2926]
          Length = 281

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 81/241 (33%), Positives = 127/241 (52%), Gaps = 1/241 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
               + F   G  S     GI   +VGS+ + +  I  + P GI + IYL E+S+  +  
Sbjct: 40  PAITWSFITEGPKSGMREGGIFPVIVGSILLTIGTIIAAVPFGILTGIYLVEYSNDNWLR 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             +   I NLA +PSIVYG+ G A  +    M R + + G L L +M+LP II AT  +L
Sbjct: 100 RIINLTIVNLAGIPSIVYGLFGMAFFVMALGMGR-SLMAGSLTLGIMSLPVIITATRESL 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
             +P S+R A+L LGA++ +T +  VLP A+P ILTG  +S++RA GETAP++F     +
Sbjct: 159 LAIPKSMREASLALGATRWETTWKIVLPAALPGILTGIILSVSRAAGETAPIMFTAAAFY 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P  ++D   A P  +Y+ +            G + +L+      N    ++RN+F+
Sbjct: 219 LPFLPESLSDQVMALPYHLYVISTQVPNMPESNMMGTLFVLVFITVGFNLLGAYIRNKFR 278

Query: 423 K 423
           K
Sbjct: 279 K 279


>gi|253583355|ref|ZP_04860553.1| phosphate ABC transporter, inner membrane subunit PstA
           [Fusobacterium varium ATCC 27725]
 gi|251833927|gb|EES62490.1| phosphate ABC transporter, inner membrane subunit PstA
           [Fusobacterium varium ATCC 27725]
          Length = 280

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/242 (30%), Positives = 125/242 (51%), Gaps = 1/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F      +     GI  A++G++Y+ +  I +S P GI + IYL E++     +
Sbjct: 40  PAISWEFLTEMPKNGMREGGIFPAIIGTIYLTIGTIVVSVPFGIFTGIYLVEYAKDNLLT 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             +   I NLA +PSI+YG+ G A+ + F     S    G L L +M LP II +T  +L
Sbjct: 100 RIINLTIINLAGIPSIIYGLFGMALFVIFLGFDVSIV-SGSLTLGIMCLPVIITSTRESL 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
             +P+ +R A+L LGA+K +T+   VLP A+P ILTG  +S++RA GETAP++F  +  +
Sbjct: 159 LAIPNHLREASLALGATKWETITKVVLPAALPGILTGVILSISRAAGETAPIMFTAVAFY 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P    D   A P  +Y+ +       +    G + +L++     N     +R +F 
Sbjct: 219 LPFLPETPWDQVMALPYHLYVISTQVPNMPISYMNGTLFVLVVITISFNLIGAVIRQKFN 278

Query: 423 KR 424
            +
Sbjct: 279 NK 280


>gi|160882650|ref|ZP_02063653.1| hypothetical protein BACOVA_00603 [Bacteroides ovatus ATCC 8483]
 gi|156111965|gb|EDO13710.1| hypothetical protein BACOVA_00603 [Bacteroides ovatus ATCC 8483]
          Length = 291

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 136/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWDFITSAPTDGMTGGGIWPAIVGTFYLMVGSALFAFPIGVMSGIYMNEYAPKGRSVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P G+ D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 225 PQLPTGILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIMIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|159030674|emb|CAO88344.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 307

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 94/272 (34%), Positives = 148/272 (54%), Gaps = 16/272 (5%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
             +        A        FF +  S  PE AGI  A VG+L +ML+   ++ PLGIA+
Sbjct: 37  ILFILIAQMMMAGLPRITPQFFTSFPSRHPEEAGILSAWVGTLLVMLVTALIAIPLGIAA 96

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
            IYLEE+S K + S+ ++ N+ NLA VPSI+YG+L   + +  F + + + +  GL LAL
Sbjct: 97  GIYLEEYSKKNWLSAIIEINVTNLAGVPSIIYGLLALGLFVYQFNLGQ-SIIAAGLTLAL 155

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP +I+ T  A+R +P+S+R AA  +GAS+ Q V  H+LP +  +ILTG  + L+RA+
Sbjct: 156 LILPVVIVTTREAIRAIPNSLREAAYAVGASRWQVVADHILPYSFGSILTGVIIGLSRAI 215

Query: 349 GETAPLLFVGMVAFVTDYPVGVTD-------------IATAFPVQIYLWAADAERPFVER 395
           GETAP++ +G + F+   P                    T  P+Q++ W +  E  F   
Sbjct: 216 GETAPVITIGALTFIAFLPDAPLQANFPFINFNWLKAPFTVMPIQMFNWVSRPEPEFEVN 275

Query: 396 TFGAILLLLIFLAVINTAMLWLRNRFKK--RW 425
              A  +L++    +N   ++LR RF+K  +W
Sbjct: 276 AAAAGTVLIVMTLGMNAVAIYLRYRFRKGIKW 307


>gi|256423402|ref|YP_003124055.1| phosphate ABC transporter inner membrane protein [Chitinophaga
           pinensis DSM 2588]
 gi|256038310|gb|ACU61854.1| phosphate ABC transporter, inner membrane subunit PstA
           [Chitinophaga pinensis DSM 2588]
          Length = 280

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 138/240 (57%), Gaps = 3/240 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F     S+     GI  A+ G++ + L+   ++ PLGI+ AIYL E++   + +
Sbjct: 37  PALSWKFVTTLPSNGMTKGGILPAITGTVILTLLTAVVAVPLGISCAIYLNEYAPDHWVT 96

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++A+I NL+ VPSI+YG+ G A+ +    M  ++ +  GL L L++LP II  T  AL
Sbjct: 97  RLIRASIRNLSGVPSIIYGLFGLALFVKGLHM-GTSVIAAGLTLGLLSLPYIISTTEEAL 155

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P+S R AALG+GA++ +++   VLP A+P ILTG  ++L+RA GETAP+LF G+  +
Sbjct: 156 RRIPASTREAALGIGATQFESIRDVVLPSALPGILTGVVLTLSRAAGETAPILFTGVAFY 215

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAER--PFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           +T     +     A P  +Y+ +   +         +G  L+L+I + ++N    ++R +
Sbjct: 216 ITGSSGFLNQEFMALPYHLYMLSTQHQSIVEVRPLAYGTALVLIIVVFLLNLTAFYIRYK 275


>gi|71909176|ref|YP_286763.1| phosphate ABC transporter permease [Dechloromonas aromatica RCB]
 gi|71848797|gb|AAZ48293.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Dechloromonas aromatica RCB]
          Length = 312

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 90/262 (34%), Positives = 145/262 (55%), Gaps = 19/262 (7%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
                  FF N AS     AGI  A VGSL +ML+    + P+G+A+ +YLEE++ + + 
Sbjct: 52  SERLTLDFFTNFASRHAGQAGILSAWVGSLLVMLVTALAAVPIGVAAGVYLEEYAKRNWI 111

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ NI NLA+VPSIVYG+L   + +  F   + + L  GL LAL+ LP +I++T  A
Sbjct: 112 TEIIEINITNLAAVPSIVYGLLALGIFVYQFGFGQ-SILSAGLTLALLILPIVIVSTREA 170

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R +P+ IR  ++ +GA++ QT  +H++P AMP ILTG  + LARA+GETAP++ +G + 
Sbjct: 171 IRAIPAMIREGSMAVGATRWQTCRYHIIPYAMPGILTGVIIGLARAIGETAPIITIGALT 230

Query: 362 FVTDYPVGV----------------TDIATAFPVQIYLWAADAERPFVERTFGAILLLLI 405
           F+   P                       T  P+QI+ W +  +  F      A  +L++
Sbjct: 231 FIAFLPPVPYTTGADGVTAGLFDWVMSPFTVMPIQIFNWTSRPDPAFEVNAAAAGFVLMV 290

Query: 406 FLAVINTAMLWLRNRFKK--RW 425
            +  +N   +WLR + +K  +W
Sbjct: 291 MVLSMNGIAIWLRYKMRKNIKW 312



 Score = 37.0 bits (84), Expect = 5.7,   Method: Composition-based stats.
 Identities = 5/46 (10%), Positives = 23/46 (50%)

Query: 3  SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGI 48
          +    +  +    + + +F+   +  + +  + +++L+S +++KG 
Sbjct: 7  TTEQIRALIAKGKLKDSIFKAMGIACLALALLVIVMLVSDMIAKGS 52


>gi|257386426|ref|YP_003176199.1| phosphate ABC transporter inner membrane subunit PstA
           [Halomicrobium mukohataei DSM 12286]
 gi|257168733|gb|ACV46492.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halomicrobium mukohataei DSM 12286]
          Length = 540

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 84/242 (34%), Positives = 141/242 (58%), Gaps = 5/242 (2%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF----S 242
                +        AG+   +VGS+ ++  +  L+FP+GI++A+YLEE++ K  +    +
Sbjct: 297 TLLLESWHGRVASEAGVYPQLVGSIVVVGFMAILAFPVGISAAVYLEEYAPKSGWGSRFA 356

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           + ++ NI+NLA VPS+VYG+LG A+            +     L L+ LP ++++   A+
Sbjct: 357 TLLEVNISNLAGVPSVVYGLLGLALFRRTLGFGTGIVVSAAGTLGLLILPIVVVSAQEAI 416

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP S+R A+ G+GAS+ QT+ + V P A+P+ILTG+ ++LARA+GETAPL+ + +   
Sbjct: 417 RAVPDSLREASYGMGASRWQTLRNVVFPEAVPSILTGTILALARAIGETAPLVMIAVATT 476

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRF 421
               P G+   ATA P+QIY   + A   F       A ++LL  + V+N   + +RNR+
Sbjct: 477 TYTPPEGLFSSATALPLQIYAARSSALPEFRHGVVPAAAIVLLALMLVMNATAVIVRNRY 536

Query: 422 KK 423
           ++
Sbjct: 537 ER 538


>gi|332982527|ref|YP_004463968.1| phosphate ABC transporter membrane protein 2 [Mahella australiensis
           50-1 BON]
 gi|332700205|gb|AEE97146.1| phosphate ABC transporter membrane protein 2, PhoT family [Mahella
           australiensis 50-1 BON]
          Length = 295

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 71/254 (27%), Positives = 123/254 (48%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  + + +     GIG  +  S  M++I +  + PLG+   IYL E++  G  +
Sbjct: 38  HVISWDFITSPSKTLDAGGGIGPQIFNSFMMLIISMIFTIPLGLGGGIYLAEYARPGKLT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  +  LAS+PSIV G+ G  V +NF      T L G L L ++ LP +      A+
Sbjct: 98  DAIRLCVETLASLPSIVVGLFGLLVFVNFTGWGY-TLLGGALSLTVLNLPVMTRVCEDAI 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           RTV   ++ A+L LGA+K QT+   +LP+A+P ILTG  ++  R  GE A +++   ++ 
Sbjct: 157 RTVKDELKEASLALGATKWQTITKVILPIALPGILTGIILTSGRVFGEAAAIMYTAGMSS 216

Query: 363 -----------VTDYPVGVTDIATAFPVQIYLWAADA-ERPFVERTFGAILLLLIFLAVI 410
                          P+ +   A    V I+   +++      E   G+  +L+I + + 
Sbjct: 217 PNINFEVWDFTNPRSPLNIMRPAETLAVHIWKVNSESLLPDAREVADGSSAVLIIVVLLF 276

Query: 411 NTAMLWLRNRFKKR 424
           N    WL +R  +R
Sbjct: 277 NALARWLGSRLHRR 290


>gi|269791711|ref|YP_003316615.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099346|gb|ACZ18333.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 284

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 130/244 (53%), Gaps = 3/244 (1%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
                + F      S     GI   +VG++ +ML+ +  + P+G+A+A+YL E++ KG  
Sbjct: 38  SSAITWDFLTQMPRSGMTQGGIATPLVGTIQLMLLSMAFALPIGVATAVYLTEYAPKGPV 97

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +S V+  I +LA VPS+V+G+ G +    F  +  ++ L   L LA + LP ++ A   A
Sbjct: 98  ASAVRLAIRSLAGVPSVVFGLFGLSFFCIFLGL-GASMLSASLTLACLVLPVVVTAAETA 156

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L  VP  +R A+  +GA++ QT+   VLP AMP+I+TG+ + L R  GETAP++F G V 
Sbjct: 157 LLNVPKDLRDASFAMGATRWQTIRKVVLPTAMPSIMTGAILGLGRVAGETAPIMFTGAVF 216

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRN 419
           F  ++     +   A P  IY+ A             +G  L+L+  + +++   +  R+
Sbjct: 217 FTPNFAKSPFESVMALPYHIYVLATAGTNIDATRPIQYGTSLVLVGTVFLLSLTGIAWRS 276

Query: 420 RFKK 423
           R ++
Sbjct: 277 RLRR 280


>gi|268324465|emb|CBH38053.1| putative phosphate ABC transporter, permease protein [uncultured
           archaeon]
 gi|268324868|emb|CBH38456.1| putative phosphate transport system permease protein pstA
           [uncultured archaeon]
          Length = 281

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 79/227 (34%), Positives = 124/227 (54%), Gaps = 2/227 (0%)

Query: 199 EVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSI 258
           E  GI   ++GS+ ++ + +  + P+G+ASAIYL E++     +  V+  +  LA +PSI
Sbjct: 52  EYGGIFPQIIGSICLVAVCLIFAVPMGVASAIYLAEYASDNVITRTVRFFVECLAGIPSI 111

Query: 259 VYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGA 318
           V G+ G   L+ +  +     L GGL L  M LP  + A+  A++TVP + R A+L LG 
Sbjct: 112 VIGLFGLVFLVYYLDL-GICLLSGGLALGFMILPWTVRASEEAIKTVPPAYREASLALGV 170

Query: 319 SKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFP 378
           SK +T+   VL  A P I+TG  + + +A+GETA +L        +  P  + D   + P
Sbjct: 171 SKWRTIRSVVLKSAYPGIITGILLGMGKAIGETAVVLLTAGSGLESFLPKSIFDPVASLP 230

Query: 379 VQIYLWAADAE-RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           V IY+ A          RTFGA L+L++   +I+   L LRNR+ +R
Sbjct: 231 VYIYMMATQGHTSAAYSRTFGASLVLIMMFFLISIFALLLRNRYIRR 277


>gi|300710210|ref|YP_003736024.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halalkalicoccus jeotgali B3]
 gi|299123893|gb|ADJ14232.1| phosphate ABC transporter, inner membrane subunit PstA
           [Halalkalicoccus jeotgali B3]
          Length = 295

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 92/240 (38%), Positives = 151/240 (62%), Gaps = 1/240 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  +     PE AGI  A+VGS+ +M+++  ++FPLG+ +A+YLEE++  G  + 
Sbjct: 52  WLDLQFLTSPPHPLPEEAGIFPALVGSIVLMVLIALITFPLGVGAAVYLEEYASDGRLTQ 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F+Q NI NLA VPS+VYG+LG  + +        T LV G  ++L+ LP +II+   A+R
Sbjct: 112 FIQLNIANLAGVPSVVYGLLGLGLFVQLINFGYGTLLVAGFTVSLLILPIVIISAQEAIR 171

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP S+R A+ G+GA+K QT+ + VLP ++P I+TG+ ++L RA+GETAPL+ +G+   V
Sbjct: 172 SVPDSLREASYGMGATKRQTIRNVVLPRSLPGIMTGTILALGRAIGETAPLIMIGVPTTV 231

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFK 422
              P G+    +A P+QIY W++  +  F        ++ LL+ L  IN+  + +RN+++
Sbjct: 232 FGVPNGLFAKFSAMPMQIYTWSSYPDTAFQYGVVSAGVVTLLVVLLSINSIAILIRNKYQ 291


>gi|82702216|ref|YP_411782.1| phosphate ABC transporter permease [Nitrosospira multiformis ATCC
           25196]
 gi|82410281|gb|ABB74390.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Nitrosospira multiformis ATCC 25196]
          Length = 310

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 138/258 (53%), Gaps = 16/258 (6%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ FF +  S RPE AGI  A VG+  +M++    + PLG+ + IYLEE++ K   +
Sbjct: 54  PRLSWDFFTSFPSRRPESAGILSAWVGTTLVMIVTAAAAVPLGVGAGIYLEEYAPKNILT 113

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ N+ NLA VPSI+YG+L  ++ ++     +S    G  +  L+    +I+AT  A+
Sbjct: 114 EIIEINVTNLAGVPSIIYGLLALSLFVHQLGFGQSILSAGLALALLILP-IVIVATREAI 172

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P +IR  A  LGA+K QTV  H+LP +   ILTG  + LARA+GETAP++ +G + F
Sbjct: 173 RAIPVTIREGAYALGATKWQTVSDHLLPYSAAGILTGIIIGLARAIGETAPIITIGALTF 232

Query: 363 VTDYPVGVTD-------------IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                    T  P+Q++ W +  E  F      A L+L+I    
Sbjct: 233 IAFLPPSPFKEEFPYISFEWLMAPFTVMPIQMFNWVSRPEEAFQMNAAAAGLVLVIMTLT 292

Query: 410 INTAMLWLRNRFKK--RW 425
           +N   ++LR R +K  +W
Sbjct: 293 MNALAIYLRYRMRKNLKW 310


>gi|301059408|ref|ZP_07200330.1| phosphate ABC transporter, permease protein PstA [delta
           proteobacterium NaphS2]
 gi|300446489|gb|EFK10332.1| phosphate ABC transporter, permease protein PstA [delta
           proteobacterium NaphS2]
          Length = 292

 Score =  173 bits (439), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 91/244 (37%), Positives = 133/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F            GI   +VG+L + +  I ++ P+G+ASAIYL E++  G   
Sbjct: 49  RAINWTFLTQPPVDSMTKGGILPCIVGTLCLSVGAIVVALPIGVASAIYLNEYARPGRIV 108

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  INNLA VPS+V+G+ G A  + +  M   + L G L L  MTLP II +T  AL
Sbjct: 109 RIIRLGINNLAGVPSVVFGLFGLAFFVVYLDMGV-SILAGSLTLGAMTLPVIIGSTEEAL 167

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP + R A+LGLGA+K QT+   VLP A+P ILTG+ + L+RA GETAP++F   V F
Sbjct: 168 RGVPDTYREASLGLGATKWQTIRSVVLPAALPGILTGTILGLSRAAGETAPIMFTAAVFF 227

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  + D   A P  IY+ A             +G  L+L++ +  +N   +  R+R
Sbjct: 228 TPSLPTSIFDEIMALPYHIYVLATAGTEIEATRPLQYGTALVLIVLVLGLNLIAIIYRSR 287

Query: 421 FKKR 424
            +K+
Sbjct: 288 LRKK 291


>gi|73662672|ref|YP_301453.1| phosphate ABC transporter permease [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72495187|dbj|BAE18508.1| ABC-type phosphate transport system permease component
           [Staphylococcus saprophyticus subsp. saprophyticus ATCC
           15305]
          Length = 305

 Score =  173 bits (439), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 89/229 (38%), Positives = 148/229 (64%), Gaps = 4/229 (1%)

Query: 200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIV 259
           +AGI  A++G++++M+ +I +S  LG+ +AIYLEE++    F+SF++ +I+NLA VPS+V
Sbjct: 76  MAGIKGALIGTVWLMITIIPISIILGVGTAIYLEEYAKDNAFTSFIKVSISNLAGVPSVV 135

Query: 260 YGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALG 315
           +G+LG  + +    +      ++ L   L ++L+ LP II+A+  A+R VP+S+R A+ G
Sbjct: 136 FGLLGLTIFVRGMGIESLALGNSILAAALTMSLLILPVIIVASQEAIRAVPNSVREASYG 195

Query: 316 LGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIAT 375
           LG +K QT+   VLP A+P ILTG  ++L+RALGETAPL+ +G+   +   P  + D   
Sbjct: 196 LGGNKWQTIRRVVLPAAIPGILTGFILALSRALGETAPLILIGIPTVLLQLPSSIFDQFQ 255

Query: 376 AFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           A P+ IY WA   +  F       I++LL+ L ++N   ++LRN++ K+
Sbjct: 256 ALPMAIYNWAKLPQAEFQNVASAGIIVLLVILLLMNAIAIFLRNKYSKK 304


>gi|219851146|ref|YP_002465578.1| phosphate ABC transporter, inner membrane subunit PstC
           [Methanosphaerula palustris E1-9c]
 gi|219545405|gb|ACL15855.1| phosphate ABC transporter, inner membrane subunit PstC
           [Methanosphaerula palustris E1-9c]
          Length = 645

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 81/240 (33%), Positives = 132/240 (55%), Gaps = 2/240 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI  A+VG+LY++   I  + P G+ +AIYL E+  +G+ +
Sbjct: 403 PAISWEFLTTAPRDLGRAGGIFPAIVGTLYLVAGSILFALPFGVGAAIYLNEYRMEGYLT 462

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  I+ L   PSIV+G+ G   L+ +  +   + L G L L LM LP+II  T  AL
Sbjct: 463 QMIRTGIDLLNGTPSIVFGLFGFTFLVLYLDIGV-SMLAGQLTLGLMVLPTIIRTTEEAL 521

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           + VPSS+R  +L LGA++ QT+   VLP A+  I+TG+ +S+ RA GETAP+LF  +V  
Sbjct: 522 KNVPSSLREGSLALGATRWQTISRVVLPSAVAGIITGTILSIGRAAGETAPILFTAVVFS 581

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
               P  + D   A P  +++ + +       R +G  L+L++ +  I +  ++LRN F+
Sbjct: 582 QRYLPSSILDPVMALPYHLFILSTNVPDSSQNR-YGTALVLIMLVIGIYSIAIYLRNHFQ 640



 Score =  153 bits (386), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/257 (23%), Positives = 110/257 (42%), Gaps = 9/257 (3%)

Query: 173 QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL 232
                   + +            +     GI   +VG+L + L  + ++ PL I +A+Y+
Sbjct: 53  DSYLGFVQIGILPFLTGMTWNPVAAIPSYGIAPLIVGTLLVTLGSMVIAVPLSIGTAVYI 112

Query: 233 EEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKM-----PRSTALVGGLILA 287
            E +        ++  I  LA +PS+VYG  G  V+ N+ ++        + L G L+L 
Sbjct: 113 SELAPPR-VKLIIKPAIELLAGIPSVVYGFFGLMVMTNWLRVLFDQPSGESWLAGSLLLG 171

Query: 288 LMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARA 347
           +M LP+I      A+R+VP   R  +L +GA++ QT+   V+P A+  I     + + RA
Sbjct: 172 IMALPTITSVAEDAIRSVPQEYREGSLAVGATRWQTISKVVVPAALSGITAAIILGMGRA 231

Query: 348 LGETAPLLFVGMVAFVTDYP-VGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLL 404
           +GET  ++ V   + V   P   V          + +   +           FG  ++LL
Sbjct: 232 IGETMAVMMVTGNSAVIPSPIFNVLSPVRTLTGTLGIEMGEVASGSLHYHALFGVAVVLL 291

Query: 405 IFLAVINTAMLWLRNRF 421
           +   ++N   + +  R 
Sbjct: 292 LITLIVNLGAVLILKRL 308


>gi|257093344|ref|YP_003166985.1| phosphate ABC transporter inner membrane subunit PstA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257045868|gb|ACV35056.1| phosphate ABC transporter, inner membrane subunit PstA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 296

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 77/244 (31%), Positives = 133/244 (54%), Gaps = 3/244 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F +   +      G+  A++G+++++ + + LS P+GI +AIYL E++   +F+ 
Sbjct: 54  AISWEFLLTAPTDGMRTGGLFPALLGTIWLVTVALILSVPIGIFAAIYLSEYAGDNWFTR 113

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +   I NLA VPSIV+ + G    + FFK   ++ L   L LA+MT+P +I+AT  +L+
Sbjct: 114 TINLAIINLAGVPSIVHALFGLGAFVLFFKF-GTSILAASLTLAVMTMPVVIVATRESLQ 172

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP + R A   +GA++ QT+   VLP ++  ILTG  + ++R  GETAP++F G V F 
Sbjct: 173 AVPQAFREACWNMGATRWQTIRRVVLPNSITGILTGVILEVSRTAGETAPIMFTGAVFFT 232

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK- 422
              P  V D   A  + +++ A           FG  L+L+  +  +N+  +  R   + 
Sbjct: 233 PFLPQSVFDQTMALSLHLFVAATQVPEIAEHVPFGIALVLIGLVLTMNSVSIAFRMWLRG 292

Query: 423 -KRW 425
            K+W
Sbjct: 293 KKKW 296


>gi|237736375|ref|ZP_04566856.1| phosphate ABC transporter [Fusobacterium mortiferum ATCC 9817]
 gi|229421417|gb|EEO36464.1| phosphate ABC transporter [Fusobacterium mortiferum ATCC 9817]
          Length = 297

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 129/254 (50%), Gaps = 1/254 (0%)

Query: 171 WFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAI 230
           +              ++ F     +      GI  A+VG+L++ L  I ++ P GI + +
Sbjct: 43  FLIIGYIIYTGIPAISWEFLSEMPTDGMRAGGIFPAIVGTLWLTLGTIIVAVPFGIFTGV 102

Query: 231 YLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMT 290
           YL E++   F +  +   I NLA +PSI+YG+ G A+ + F      + L G L L +M 
Sbjct: 103 YLVEYAKDNFLTRIINLTIINLAGIPSIIYGLFGMALFVIFLGFDV-SILSGSLTLGIMC 161

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP II AT  +L  +P+ +R A+L LGA+K +T+   +LP AMP ILTG  +S++RA GE
Sbjct: 162 LPVIITATRESLLAIPNHLREASLALGATKWETITKVILPAAMPGILTGVILSISRAAGE 221

Query: 351 TAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
           TAP++F  +  ++   P+   D   A P  +Y+ +            G + +L++     
Sbjct: 222 TAPIMFTAVAFYLPFLPISYWDQVMALPYHLYVISTQVPNMPPSFINGTLFILVVITLSF 281

Query: 411 NTAMLWLRNRFKKR 424
           N    ++R RF  +
Sbjct: 282 NLFGAFIRQRFNSK 295


>gi|116748149|ref|YP_844836.1| phosphate ABC transporter inner membrane subunit PstA
           [Syntrophobacter fumaroxidans MPOB]
 gi|116697213|gb|ABK16401.1| phosphate ABC transporter, inner membrane subunit PstA
           [Syntrophobacter fumaroxidans MPOB]
          Length = 281

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 78/242 (32%), Positives = 125/242 (51%), Gaps = 1/242 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F         +  GI  A+VG+L + L     + P+G+  AIYL E++   +++
Sbjct: 38  QAISWEFITAIPRDGMKAGGIFPAIVGTLLLTLGTALAAIPVGVGGAIYLAEYARDTWWT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  I NLA +PSIVYG+ G  + +   KM  ++ L G L LA+MTLP II     AL
Sbjct: 98  RSIRLAIVNLAGIPSIVYGLFGLGLFVLMMKM-GTSILAGSLTLAIMTLPIIISTGEEAL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP+  R+ +  LG S+ Q + H +LP A+P ++TG  + L RA GETAP+LF     +
Sbjct: 157 RAVPTEFRTVSASLGGSRWQGIRHVILPQALPGMITGVILGLLRAAGETAPILFTVAAFY 216

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P    D   A P  +Y+ +            G  ++LL  +  +N     +R+ F+
Sbjct: 217 LPRLPQSPFDQTMALPYHLYVISTQVPGMPFSIQNGTAMVLLALVLSMNLGATIVRSYFR 276

Query: 423 KR 424
           +R
Sbjct: 277 RR 278


>gi|302390901|ref|YP_003826721.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Acetohalobium arabaticum DSM 5501]
 gi|302202978|gb|ADL11656.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Acetohalobium arabaticum DSM 5501]
          Length = 308

 Score =  172 bits (437), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 84/240 (35%), Positives = 126/240 (52%), Gaps = 3/240 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F      +     GI  A++GS Y+++  I  + PLG+ SAIY+ E++ +G    
Sbjct: 64  VISWTFISEMPKNGMTEGGIFPALLGSFYLIVGSISFATPLGVLSAIYMTEYAEEGKIIR 123

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++  +NNLA VPS+V+G+ G AV + FF     + L G L L ++ LP+II A+  +L 
Sbjct: 124 IIRIGVNNLAGVPSVVFGLFGLAVFVKFFNFGV-SVLSGALTLGIVILPTIIRASEESLM 182

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP   R A+L LGA++  TV + VLP A P ILTG  + + R  GETAP+LF     + 
Sbjct: 183 AVPDEYREASLALGATRWDTVKNVVLPAAAPGILTGCILGVGRVAGETAPILFTAATYYT 242

Query: 364 TDYPVGVTDIATAFPVQIYLW--AADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  V D   A P QIY    A  +        +G  ++LL  +  IN   + LR  +
Sbjct: 243 GQLPTSVFDEIMALPYQIYALVTAGTSPAQQTPLAYGTAVVLLFLVITINLVAIGLRFYY 302


>gi|253732022|ref|ZP_04866187.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253724263|gb|EES92992.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
          Length = 305

 Score =  172 bits (437), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 102/245 (41%), Positives = 155/245 (63%), Gaps = 4/245 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  FF N +SS P +AG+  A++GSL++ML +I L   LGI +AIYLEE++    F+ 
Sbjct: 60  HLNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLLIILGIGTAIYLEEYAKNNKFTQ 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATG 299
           FV+ +I+NLA VPS+V+GILG  + +    +      ++ L   L + L+ LP II+++ 
Sbjct: 120 FVKISISNLAGVPSVVFGILGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQ 179

Query: 300 VALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM 359
            A+R VP+S+R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+
Sbjct: 180 EAIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGI 239

Query: 360 VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
              +   P  + D  +A P+QI+ WA   +  F       I++LL+ L ++N   + LRN
Sbjct: 240 PTILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRN 299

Query: 420 RFKKR 424
           +F K+
Sbjct: 300 KFSKK 304


>gi|289582018|ref|YP_003480484.1| phosphate ABC transporter inner membrane subunit PstA [Natrialba
           magadii ATCC 43099]
 gi|289531571|gb|ADD05922.1| phosphate ABC transporter, inner membrane subunit PstA [Natrialba
           magadii ATCC 43099]
          Length = 306

 Score =  172 bits (436), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 96/235 (40%), Positives = 146/235 (62%), Gaps = 1/235 (0%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            +    +SSR E AG G +++ SL++M +   L+F + +  AIYL E++ +   +  ++A
Sbjct: 64  NYLTATSSSRAERAGFGASILASLWLMALTAVLAFFIAVGCAIYLVEYAPENRVTRLIEA 123

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           N+ NLA VPSIVYG+L  A+++N   +  S  L G + LAL+ +P II+A+  ++R VPS
Sbjct: 124 NLANLAGVPSIVYGLLVLALIVNDAGL-GSVILAGAIALALLIVPIIIVASIESIRAVPS 182

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           S+R  +  +GA+K QT+   VLP AMP ILTG+ ++LARA+GETAPL+ VG +   T YP
Sbjct: 183 SVRDGSYAMGATKWQTIRQVVLPKAMPGILTGTILALARAIGETAPLIMVGTMLHATRYP 242

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
            G     +A P QIY W   A+R F       I++LL+FL  +     +LR R++
Sbjct: 243 SGPLSSFSAMPTQIYNWTYQADRMFNGLAALGIVVLLLFLVAMYALAGYLRKRYE 297


>gi|56751673|ref|YP_172374.1| phosphate ABC transporter permease [Synechococcus elongatus PCC
           6301]
 gi|81301251|ref|YP_401459.1| phosphate ABC transporter permease [Synechococcus elongatus PCC
           7942]
 gi|56686632|dbj|BAD79854.1| ABC-type phosphate transport system permease protein [Synechococcus
           elongatus PCC 6301]
 gi|81170132|gb|ABB58472.1| Phosphate transport system permease protein 2 [Synechococcus
           elongatus PCC 7942]
          Length = 303

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 89/244 (36%), Positives = 142/244 (58%), Gaps = 2/244 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F  +  S RP  AGI  A VG++Y + +V  + FPLG+ + IYLEEF+   +F+
Sbjct: 59  PYLNWDFLTSFPSRRPSSAGILSAWVGTVYSIFLVGLIGFPLGVGAGIYLEEFAPDNWFT 118

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINF--FKMPRSTALVGGLILALMTLPSIIIATGV 300
             V+ N+NNLA VP+I+YG+LG  + +          + L G L LAL+ LP +I++T  
Sbjct: 119 RLVEINVNNLAGVPAIIYGLLGLELFVRIASPVTGGRSLLSGSLTLALLILPIVIVSTRE 178

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
           +LR VP S R A   LGA++ Q V   ++P A   ILTG+ + ++RA+GE APL+ +G +
Sbjct: 179 SLRAVPDSTRQAGFALGATRWQVVRTIIVPEAASGILTGTILGISRAIGEAAPLITIGAL 238

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
            F++  P  +    T  P+QI+ W +  +  F      AI++LL  L  +N+  + +RN+
Sbjct: 239 TFISFLPDNLQSPFTVLPIQIFNWVSRPQAEFQNLAAAAIIVLLAILLTMNSIAIVIRNK 298

Query: 421 FKKR 424
            + +
Sbjct: 299 LQVK 302


>gi|289580175|ref|YP_003478641.1| phosphate ABC transporter inner membrane subunit PstA [Natrialba
           magadii ATCC 43099]
 gi|289529728|gb|ADD04079.1| phosphate ABC transporter, inner membrane subunit PstA [Natrialba
           magadii ATCC 43099]
          Length = 337

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 92/257 (35%), Positives = 141/257 (54%), Gaps = 3/257 (1%)

Query: 170 KWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASA 229
            W                    N         G+   ++GS+Y++++    +  LG+ +A
Sbjct: 81  GWLTWEFLTYPPSQIAENYVPSNYGELATGPGGMYPMIIGSIYLIIMTAIFTLFLGVGAA 140

Query: 230 IYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALM 289
           IYLEE++     + F++ANI+NLA VPSIVYG+LG AV +   +   ++ + G L L L+
Sbjct: 141 IYLEEYAPDSNLTRFIEANISNLAGVPSIVYGLLGLAVFVRAMQ-TGASLIAGALTLTLL 199

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
            LP +I+ +  +LR VP S+R A+ G GA+K QT+ + VLP A+P I+TG  +SL+RA+G
Sbjct: 200 ILPIVIVQSQESLRAVPDSMRQASYGAGATKWQTIRNVVLPEAVPGIMTGIILSLSRAIG 259

Query: 350 ETAPLLFVGMVAFVTDYPV--GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFL 407
           ETAP+L VG    +   P     T    A P+QIY WA   E  F       I++LL  L
Sbjct: 260 ETAPILMVGAATTMFTPPDLTDPTGSFGAMPMQIYEWAKMPEAEFQHVAAAGIVVLLTIL 319

Query: 408 AVINTAMLWLRNRFKKR 424
            ++N   + +RN++ KR
Sbjct: 320 LLMNAVAILIRNKYDKR 336


>gi|218513935|ref|ZP_03510775.1| phosphate ABC transporter, permease protein [Rhizobium etli 8C-3]
          Length = 206

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 82/183 (44%), Positives = 115/183 (62%), Gaps = 2/183 (1%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
            +K RY +E  F+ Y + A+    VFL +LL +++ KG  A  QT I+LPIEFSE  +DP
Sbjct: 23  GIKRRYAAERRFQAYGIAAITFGLVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDP 82

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
             KR  DP++L+ A+Y +L+R A+ ++L+I+ S+   +R AS MLS +A   LR  ++ D
Sbjct: 83  SNKRATDPSVLIAANYPVLLRDAIVKQLNINASSKPDVRDASAMLSKSAPIQLRDMVVAD 142

Query: 130 PSLIGKTVEVSLLASANIDSALKGYLYS--PANVHRMSDYQWKWFQKLDSDGALFLDFNY 187
           PSLIGKTV VSLLA ANIDSA KG +         +++D Q  W  +L + GAL   FN 
Sbjct: 143 PSLIGKTVNVSLLADANIDSANKGQIDLSVDEKNRKVNDKQVTWMNQLKASGALQKQFNT 202

Query: 188 GFF 190
           G F
Sbjct: 203 GLF 205


>gi|159036000|ref|YP_001535253.1| phosphate ABC transporter, inner membrane subunit PstA [Salinispora
           arenicola CNS-205]
 gi|157914835|gb|ABV96262.1| phosphate ABC transporter, inner membrane subunit PstA [Salinispora
           arenicola CNS-205]
          Length = 307

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 101/240 (42%), Positives = 155/240 (64%), Gaps = 2/240 (0%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK-GFFSSFV 245
           +     G  SR + AG+  A+VG+L+++ +V  +  P+GI SAIYLEE++    +++  +
Sbjct: 69  WTEMPTGLVSRLDTAGVQSALVGTLWIISLVAVICLPIGILSAIYLEEYADNTRWYNRLL 128

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI NLA VPSI++GILG  ++     +   T +   ++L+L+ LP +IIAT  A+R V
Sbjct: 129 ELNIQNLAGVPSIIFGILGLGIIARALGL-GFTVITAAIVLSLLVLPVVIIATREAIRAV 187

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR A+  LGA+K QTV   VLP A+P I TGS ++L+RA+GE APL+ +G V F+T 
Sbjct: 188 PQSIRHASYALGATKWQTVSRQVLPSAVPGIATGSILALSRAIGEAAPLIVLGAVTFITF 247

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P G+    TA P+QIY +   ++  + E   GAI+LLL  +  +N+  +++RNRF+KRW
Sbjct: 248 NPDGLDSGYTALPIQIYTFITRSQSEYTELAAGAIVLLLAIVLAMNSIAIFVRNRFEKRW 307


>gi|309951512|gb|ADO95178.1| putative phosphate ABC transporter permease PstA inner membrane
           subunit [Sinorhizobium sp. M14]
          Length = 315

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 90/253 (35%), Positives = 142/253 (56%), Gaps = 14/253 (5%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +Y F     S RP  AGI  A VG+  +M +   L+ PLG+ + +YLEE++ K + + 
Sbjct: 60  RIDYAFLTEFPSRRPADAGILSAWVGTCLVMFVTALLAIPLGVGAGLYLEEYARKNWMTD 119

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ N+ NLA VPSI+YG+L     +    + R T LV G++LAL+ LP +I+AT  A+R
Sbjct: 120 VIEINVTNLAGVPSIIYGLLALGFFVYLADLGR-TVLVAGMVLALLILPIVIVATREAIR 178

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P +IR  A GLGA K QT++H++LP A P ILTG+ V L+RA+GETAP++ +G + F+
Sbjct: 179 AIPQTIREGAFGLGADKWQTMWHYILPAARPGILTGAIVGLSRAIGETAPIITIGALTFI 238

Query: 364 TDYPVGVTD-------------IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
              P    D               T  P+Q++ W +  +  F        ++L+     +
Sbjct: 239 AFLPPAPVDASFPFINFDWLNAPFTVMPIQMFNWISRPQAAFHINAAATGVVLMFMTLGM 298

Query: 411 NTAMLWLRNRFKK 423
           N   +W+R R ++
Sbjct: 299 NAVAIWIRFRLRR 311


>gi|307151019|ref|YP_003886403.1| phosphate ABC transporter inner membrane subunit PstA [Cyanothece
           sp. PCC 7822]
 gi|306981247|gb|ADN13128.1| phosphate ABC transporter, inner membrane subunit PstA [Cyanothece
           sp. PCC 7822]
          Length = 298

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 91/255 (35%), Positives = 145/255 (56%), Gaps = 2/255 (0%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
                       L      GF I   S  P+  GI  A+V S+ + ++VI ++ P+G+ +
Sbjct: 46  LALVLFDVLQDGLGRFLTPGFLIETPSRFPDQGGIRPAIVSSILLGIVVILVAVPIGVGA 105

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           A+YLEE++ +  +++ ++ NI+NLA VPSIVYG+LG  V            + G L L+L
Sbjct: 106 ALYLEEYAPRNGWTAIIEINISNLAGVPSIVYGLLGLGVFNYLLGF-GPVLISGALTLSL 164

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           ++LP II+    A+R VP S+R+A+ GLG +K QT+ +HV+P A+P ILTG  +S++RA+
Sbjct: 165 LSLPVIIVTAREAIRAVPDSLRNASYGLGITKWQTLSNHVIPYAIPGILTGVIISVSRAI 224

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           G+ A L+ VG V F+T  P G+     A P+QIY +    E  F       I+ L+  + 
Sbjct: 225 GDAASLIVVGAVGFLTFNP-GLFQRFMALPIQIYSYITRPEPGFANAAAATIIALIALVL 283

Query: 409 VINTAMLWLRNRFKK 423
            +N   +++R RF +
Sbjct: 284 ALNGVAIYIRQRFSR 298


>gi|254468475|ref|ZP_05081881.1| phosphate ABC transporter, permease protein PstA [beta
           proteobacterium KB13]
 gi|207087285|gb|EDZ64568.1| phosphate ABC transporter, permease protein PstA [beta
           proteobacterium KB13]
          Length = 312

 Score =  171 bits (434), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 89/256 (34%), Positives = 143/256 (55%), Gaps = 14/256 (5%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           +   N  FF N  S +PE AGI  A VGS  ++++   ++ P+G+AS IYLEE++ KG+F
Sbjct: 55  YPKMNLEFFSNFPSRKPEGAGILSAWVGSALVLIVTFFVAVPMGVASGIYLEEYAKKGWF 114

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ N+ NLA VPSI+YG+L   + +  F + + + L  GL L+L+ LP +I++T  A
Sbjct: 115 ADLIEINVANLAGVPSIIYGLLALGLFVYEFGLGQ-SILTAGLTLSLLMLPIVIVSTREA 173

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R +P  IR AA  +GA+K Q   HHVL  AM  +LTG  + +ARA+GETAP++ +G + 
Sbjct: 174 IRAIPVHIREAAYAVGATKWQVTLHHVLQYAMGGVLTGIIIGMARAIGETAPVITIGALT 233

Query: 362 FVTDYPVGVT-------------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           F+   P                    T  P+Q++ W +  E  F         +++I   
Sbjct: 234 FIAFLPPSPVTDVAPFFNFAWLEAGFTVLPIQMFNWISRPEHAFHINAAATGAVIIILTL 293

Query: 409 VINTAMLWLRNRFKKR 424
           ++N   + LR   +K+
Sbjct: 294 LMNGIAIKLRYSIRKK 309


>gi|227539737|ref|ZP_03969786.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227240379|gb|EEI90394.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 284

 Score =  171 bits (434), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/251 (30%), Positives = 129/251 (51%), Gaps = 3/251 (1%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
            +         ++ F            GI   ++G++ + LI    + P GI  AIYL E
Sbjct: 33  WEIASKGASVISWDFISTLPKEAMTKGGILSPIIGTVLLTLITALFAIPFGICCAIYLNE 92

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++     +  ++A I NL+ VPSI+YG+ G A+ +    M  ++ +  GL L L++LP I
Sbjct: 93  YAQDNMLTRLIRAAIRNLSGVPSIIYGLFGLALFVQALNM-GTSLMAAGLTLGLLSLPYI 151

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I  T  AL  +P S R  ALG+GA++ + +   VLP AMP ILTG  ++L+RA GETAP+
Sbjct: 152 ITTTEEALMRIPQSTREGALGVGATQFECIKDVVLPSAMPGILTGVVLTLSRAAGETAPI 211

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINT 412
           LF G   ++      +     A P  +Y+ +   +         +G  L+L++ + ++N 
Sbjct: 212 LFTGAAFYINGTNGYMNQEFMALPYHLYMLSTQHQAIEEVRPIAYGTALILVVVVFLMNL 271

Query: 413 AMLWLRNRFKK 423
              ++R +++K
Sbjct: 272 TAFYIRYKYRK 282


>gi|145592854|ref|YP_001157151.1| phosphate ABC transporter, inner membrane subunit PstA [Salinispora
           tropica CNB-440]
 gi|145302191|gb|ABP52773.1| phosphate ABC transporter, inner membrane subunit PstA [Salinispora
           tropica CNB-440]
          Length = 306

 Score =  171 bits (434), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 101/240 (42%), Positives = 155/240 (64%), Gaps = 2/240 (0%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK-GFFSSFV 245
           +     G  SR + AG+  A+VG+L+++ +V  +  P+GI SAIYLEE++    +++  +
Sbjct: 68  WTEMPTGLVSRLDSAGVQSALVGTLWIISLVAVICLPIGILSAIYLEEYADNTRWYNRLL 127

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI NLA VPSI++GILG  ++     +   T +   ++L+L+ LP +IIAT  A+R V
Sbjct: 128 ELNIQNLAGVPSIIFGILGLGIIARALGL-GFTVITAAIVLSLLVLPVVIIATREAIRAV 186

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P SIR A+  LGA+K QTV   VLP A+P I TGS ++L+RA+GE APL+ +G V F+T 
Sbjct: 187 PQSIRHASYALGATKWQTVSRQVLPSAVPGIATGSILALSRAIGEAAPLIVLGAVTFITF 246

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
            P G+    TA P+QIY +   ++  + E   GAI+LLL  +  +N+  +++RNRF+KRW
Sbjct: 247 NPDGLDSGYTALPIQIYTFITRSQSEYTELAAGAIVLLLAIVLAMNSIAIFVRNRFEKRW 306


>gi|269103305|ref|ZP_06156002.1| phosphate transport system permease protein PstA [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163203|gb|EEZ41699.1| phosphate transport system permease protein PstA [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 545

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 83/376 (22%), Positives = 157/376 (41%), Gaps = 41/376 (10%)

Query: 79  ILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVE 138
            +   ++ L   +   RK  +         Q  +          ++      SL  +  +
Sbjct: 175 EIANVNWQLEQLRIQHRKAELKGQAEPDKIQQYERQRRQLELEYKQMEGHLFSLQNQLAD 234

Query: 139 VSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYG-----FFING 193
             ++   +    +K  +            Q     + ++   +    ++G     F    
Sbjct: 235 SGIIVRNSQGQQVKLPMD-----------QVLDVWQPNNLTLIEKIAHWGHQVGKFLSEE 283

Query: 194 ASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLA 253
                   G+  A+ G+++M+L++  +  PLG+ +A+YL E++ K  F+  ++  + NLA
Sbjct: 284 PREANTEGGVFPAIFGTVFMVLLMSIIVTPLGVMAAVYLHEYAKKNAFTKVIRIAVINLA 343

Query: 254 SVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTLPSIIIA 297
            VPSIVYG+ G    +                          L   L LA++TLP +I++
Sbjct: 344 GVPSIVYGVFGLGFFVYMVGGTIDDLFFSAQLPTPTFGTPGVLWSALTLAILTLPVVIVS 403

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
           T   L  +P+S+R+ +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ V
Sbjct: 404 TEEGLARIPNSVRNGSLALGATQSETLWRIVLPMASPAIMTGLILAVARAAGEVAPLMLV 463

Query: 358 GMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLA 408
           G+V      PV +                 IY  A  +          +    LL+  + 
Sbjct: 464 GVVKMAPTLPVDLHFPYVHLDRKFMHLGYHIYDVAFQSPNVEAARPLVYATSFLLVTVII 523

Query: 409 VINTAMLWLRNRFKKR 424
            +N   + +RN  +++
Sbjct: 524 SLNLTAIGIRNYLREK 539


>gi|239945782|ref|ZP_04697719.1| phosphate ABC transporter, inner membrane subunit PstA
           [Streptomyces roseosporus NRRL 15998]
 gi|239992253|ref|ZP_04712917.1| phosphate ABC transporter, inner membrane subunit PstA
           [Streptomyces roseosporus NRRL 11379]
 gi|291449240|ref|ZP_06588630.1| phosphate ABC transporter [Streptomyces roseosporus NRRL 15998]
 gi|291352187|gb|EFE79091.1| phosphate ABC transporter [Streptomyces roseosporus NRRL 15998]
          Length = 302

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 143/237 (60%), Gaps = 2/237 (0%)

Query: 190 FINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS-HKGFFSSFVQAN 248
                   P   G   A++G+++++        P GI +AIYLEE++    +++  ++ N
Sbjct: 67  MNFPDYIDPTQGGAQSAIMGTVWVIGFTAVYCLPTGILTAIYLEEYADPDKWWNRAIEIN 126

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA+VPSIVYGILG  ++       + T L   L L+L+ LP +II++  A+R VP S
Sbjct: 127 IQNLAAVPSIVYGILGLGIISRGLGFGQ-TVLTASLTLSLLVLPVVIISSREAIRAVPQS 185

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR A+L LGA++ QT++  VLP A+P + TGS ++L+RA+GE APLL +G + F+T  P 
Sbjct: 186 IRQASLALGATQWQTIWRQVLPAAVPGMATGSILALSRAIGEAAPLLLLGGLTFITFNPS 245

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
           GV    T  P+QI+ W + +   FV     AI++LL  L  +N+  +WLRNR+ + W
Sbjct: 246 GVQSQFTVLPIQIFNWISQSRAEFVSLASAAIVILLAILLAMNSVAIWLRNRYSRTW 302


>gi|300773878|ref|ZP_07083747.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300760049|gb|EFK56876.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 284

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/251 (30%), Positives = 129/251 (51%), Gaps = 3/251 (1%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
            +         ++ F            GI   ++G++ + LI    + P GI  AIYL E
Sbjct: 33  WEIASKGASVVSWDFITTLPKEAMTKGGILSPIIGTVLLTLITALFAIPFGICCAIYLNE 92

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++     +  ++A I NL+ VPSI+YG+ G A+ +    M  ++ +  GL L L++LP I
Sbjct: 93  YAQDNMLTRLIRAAIRNLSGVPSIIYGLFGLALFVQALNM-GTSLMAAGLTLGLLSLPYI 151

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I  T  AL  +P S R  ALG+GA++ + +   VLP AMP ILTG  ++L+RA GETAP+
Sbjct: 152 ITTTEEALMRIPQSTREGALGVGATQFECIKDVVLPSAMPGILTGVVLTLSRAAGETAPI 211

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINT 412
           LF G   ++      +     A P  +Y+ +   +         +G  L+L++ + ++N 
Sbjct: 212 LFTGAAFYINGTNGYMNQEFMALPYHLYMLSTQHQAIEEVRPIAYGTALILVVVVFLMNL 271

Query: 413 AMLWLRNRFKK 423
              ++R +++K
Sbjct: 272 TAFYIRYKYRK 282


>gi|283780574|ref|YP_003371329.1| phosphate ABC transporter, inner membrane subunit PstA [Pirellula
           staleyi DSM 6068]
 gi|283439027|gb|ADB17469.1| phosphate ABC transporter, inner membrane subunit PstA [Pirellula
           staleyi DSM 6068]
          Length = 318

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 88/254 (34%), Positives = 149/254 (58%), Gaps = 14/254 (5%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  F  N  S + E AGI  A VGS  ++++ +  + PLGIA+A+YLEE++ K F ++
Sbjct: 63  SLNLDFLRNFPSRKAERAGILSASVGSFAIIVVTLVTAVPLGIAAAVYLEEYAPKNFITT 122

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI+NLA VPSI+YG++   +L+  F + R   LVGGL LA + LP +I++T  A+R
Sbjct: 123 LIEINISNLAGVPSIIYGLMALGILVYQFNLGR-CILVGGLTLATLVLPIVIVSTREAIR 181

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P++IR AA   GA+K Q + +H++P ++  I TG+ ++++RALGETAPL+ +G +++V
Sbjct: 182 AIPAAIREAAYAAGATKWQVIRYHLIPYSIGGIATGTIIAMSRALGETAPLITIGALSYV 241

Query: 364 TDYPVGV-------------TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
              P                    T  P+Q++ W +     F  R     L+L+ F   +
Sbjct: 242 AFIPPSPITSELPFISFKWLFSGFTVMPIQMFNWVSRPTADFHARAAATGLVLIFFTLSM 301

Query: 411 NTAMLWLRNRFKKR 424
           N   +++R + +++
Sbjct: 302 NAIAIYVRYQMRRK 315


>gi|42523160|ref|NP_968540.1| phosphate ABC transporter, permease protein [Bdellovibrio
           bacteriovorus HD100]
 gi|39575365|emb|CAE79533.1| phosphate ABC transporter, permease protein [Bdellovibrio
           bacteriovorus HD100]
          Length = 305

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 92/255 (36%), Positives = 144/255 (56%), Gaps = 14/255 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N  FF+N  S   E AGI  A VGS  +ML     + PLGIA+ +YLEE+S K + S
Sbjct: 49  PRINAEFFVNFPSRFAEKAGILSAWVGSFLIMLTTAFCAIPLGIAAGVYLEEYSKKNWVS 108

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NI NLA +PSI YG++   + +   K+ +S    G  +  L+ LP II+ T  A+
Sbjct: 109 QIIELNIINLAGIPSITYGLMALGLFVYKLKLGQSILTAGLTLGLLV-LPIIIVTTREAI 167

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R++P++IR A+  +GASK QT+ +H+LP +   ILTG  +SL+RA+GETAPL+ +G + F
Sbjct: 168 RSIPNTIREASYAMGASKWQTIRYHILPYSSGGILTGVIISLSRAIGETAPLITIGALTF 227

Query: 363 VTDYPVGV-------------TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                 D  T  P+Q++ W +  +  F        ++LL+   +
Sbjct: 228 IAFLPTPPIDGQFPYVNFTWLMDPFTVMPIQMFNWLSRPQPEFHVNAAATGVVLLVMTLI 287

Query: 410 INTAMLWLRNRFKKR 424
           +N   ++LR+RF+K+
Sbjct: 288 MNGGAIYLRSRFRKK 302


>gi|229163215|ref|ZP_04291170.1| ABC transporter permease protein [Bacillus cereus R309803]
 gi|228620278|gb|EEK77149.1| ABC transporter permease protein [Bacillus cereus R309803]
          Length = 288

 Score =  171 bits (432), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 91/252 (36%), Positives = 147/252 (58%), Gaps = 1/252 (0%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
             +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +
Sbjct: 37  ILFILLFQIFEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGT 96

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   L ++L
Sbjct: 97  ALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAALTMSL 155

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP A P I+TG T++++RA+
Sbjct: 156 LVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYRVVLPYAFPGIITGCTLAISRAI 215

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++LL  L 
Sbjct: 216 GEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLL 275

Query: 409 VINTAMLWLRNR 420
            IN  +LWLRNR
Sbjct: 276 FINIFVLWLRNR 287



 Score = 37.4 bits (85), Expect = 4.8,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 25/49 (51%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R++ + +++    +A+    V L +LL  I  KGI 
Sbjct: 3  MLNHKKIQENMASRFLKDRIYKLSFYIAIWFSIVILFILLFQIFEKGIS 51


>gi|312888611|ref|ZP_07748180.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
 gi|311298925|gb|EFQ76025.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
          Length = 281

 Score =  171 bits (432), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 137/251 (54%), Gaps = 3/251 (1%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
            D         ++ F  +         GI  A+ G++ + LI   ++ P GI  AIYL E
Sbjct: 30  WDLFSKGAPSLSWEFISSLPQQSMTKGGILPAITGTVLLTLITALVAAPFGICCAIYLNE 89

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++   + +  ++A+I NLA VPSI+YG+ G A+ +    M  ++ L  GL L L++LP I
Sbjct: 90  YAANTWLTRLIRASIRNLAGVPSIIYGLFGLALFVQGLSM-GTSLLPAGLTLGLLSLPYI 148

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           II T  ALR +P S+R AAL LGA+K +++   VLP A+P +LTG  ++L+RA GETAP+
Sbjct: 149 IITTEEALRRIPGSMREAALALGATKFESIRDVVLPSALPGMLTGLVLTLSRAAGETAPI 208

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFV--ERTFGAILLLLIFLAVINT 412
           LF G+  ++      +     A P  +Y+ A   +         +G  L+L+I + ++N 
Sbjct: 209 LFTGVAFYINKPAGYLNQEFMALPYHLYMLATQHQDIEQVRPLAYGTALVLIIVVFLLNL 268

Query: 413 AMLWLRNRFKK 423
           +  ++R +  K
Sbjct: 269 SAFYIRYKHSK 279


>gi|189347112|ref|YP_001943641.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           limicola DSM 245]
 gi|189341259|gb|ACD90662.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           limicola DSM 245]
          Length = 448

 Score =  171 bits (432), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 97/410 (23%), Positives = 173/410 (42%), Gaps = 27/410 (6%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDP 69
           NL  R I +  F      ++ V+ + L+++L  I++ GIG+++ T      +        
Sbjct: 2   NLGTRKILDRSFTAVGFGSIAVMGIALLIVLVPIITNGIGSVFFTGTLEHRKMLFNEFGR 61

Query: 70  QKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTD 129
                +         Y   +   L+   +  +   A  +Q         +  L+  +   
Sbjct: 62  GNTEELAKENAASEVYRQQIYGMLSAFDAELEIMDAEKKQDYLSKYGPVKTALQTLIGPL 121

Query: 130 P----------------SLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWF- 172
           P                    +      L     D +    +     V R ++++     
Sbjct: 122 PGEAEAILTRYKYGQTRWDKAEEKLHEFLYETKWDFSNPDAMSKEYFVSRATEFEGTSLV 181

Query: 173 -------QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
                  + L+          +GF  + +       GI   + G+ ++ +  +  +FPLG
Sbjct: 182 KLFPFVEEHLEDVLRPEFTVYWGFLTDSSVDSHIFGGIWPEIQGTFFLAVGAMLFAFPLG 241

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGL 284
           + +A+Y  E++ +GFF+S +++  + LA VPSIV+G+ G A  IN  K+  S + L G L
Sbjct: 242 VIAAVYFTEYAREGFFNSILRSANSTLAGVPSIVFGLFGLAFFINTLKVSESKSVLAGSL 301

Query: 285 ILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL 344
            LA+M LP+II A   A+ +VP + + A+L LG++K  T+   +LP A+P I+TG  +SL
Sbjct: 302 TLAIMILPTIIRAAEEAILSVPKTYKEASLSLGSTKWNTIMTVILPAALPGIITGGVISL 361

Query: 345 ARALGETAPLLFVGM--VAFVTDYPVGVTDIATAFPVQIYLWAADAERPF 392
            RA GETAP++F     V          +    A    IY  A++ E   
Sbjct: 362 GRAAGETAPIIFTAAVSVGSAIGLADVFSSPTPALSWNIYNLASEHEAAA 411


>gi|82617411|emb|CAI64322.1| phosphate ABC transporter, permease protein [uncultured archaeon]
          Length = 288

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 126/241 (52%), Gaps = 5/241 (2%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F ++         GI  A++G+L ++ + I  + P+G+ +A+YL E++     + 
Sbjct: 48  VIDISFLLDAPRLSGAEGGIFPAIIGTLCLVAVAILTAGPIGVGAAVYLIEYAPDNALTR 107

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +   +  LA +PSIV G+ G A L+ +      + L GG+ L  M LP  + A+  A++
Sbjct: 108 IITFGVECLAGIPSIVIGLFGYAFLVVYLGF-GFSILSGGVALMFMILPWTVRASEEAIK 166

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           TV   ++  +L LGA+K QT+   VLP A+P I TG  + + +A+GETA +++    + +
Sbjct: 167 TVSGGLKEGSLALGATKWQTIRQVVLPNALPGITTGVILGIGKAIGETAVIMYTAGSSLL 226

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  + +   A P  +Y+ A++      E  +G+  +LL  + +IN   + ++  ++ 
Sbjct: 227 --LPESIFEPVRALPYHLYILASEGISD--EMAYGSAAVLLGMVLLINFTAVAIQRYYQT 282

Query: 424 R 424
           R
Sbjct: 283 R 283


>gi|307353630|ref|YP_003894681.1| phosphate ABC transporter inner membrane subunit PstC
           [Methanoplanus petrolearius DSM 11571]
 gi|307156863|gb|ADN36243.1| phosphate ABC transporter, inner membrane subunit PstC
           [Methanoplanus petrolearius DSM 11571]
          Length = 658

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 80/242 (33%), Positives = 133/242 (54%), Gaps = 4/242 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F            GI  A++G+LY++   I  + P+G+ +AIYL E++ +   +S +
Sbjct: 419 SWEFLTGYPKDLGREGGIFPAIIGTLYLVGGAILFALPIGVCAAIYLVEYTKESRITSII 478

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           ++ ++ L   PSIV+G+ G A L+ F        L G + L LM LP+II  T  AL++V
Sbjct: 479 RSGVDLLNGTPSIVFGLFGFAFLVLFLDFGV-CLLAGMITLGLMVLPTIIRTTEEALKSV 537

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S+R  +L LGA+K QT+   VL  A P I+TG+ +S+ RA GETAP++F  +V     
Sbjct: 538 PDSLRHGSLALGATKWQTIRKVVLSPAAPGIITGTILSIGRAAGETAPIMFTAVVFTTRF 597

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK-- 423
            P  V D   A P  +++ + +       + +G  L+LL+ +  +    + +RN ++K  
Sbjct: 598 LPSSVFDPVMALPYHLFILSTNVPGATTNQ-YGTALVLLLLVMAVYCIAILVRNHYQKSL 656

Query: 424 RW 425
           RW
Sbjct: 657 RW 658



 Score =  132 bits (332), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 74/301 (24%), Positives = 130/301 (43%), Gaps = 12/301 (3%)

Query: 135 KTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGA 194
           K  +    +S   D  ++G L++ A    ++ +    F   D   A      Y F     
Sbjct: 13  KDEKFPYSSSNLSDQIVRGILFAAAAFGVLTVFFILLFLLKDGIPAFASIGLYDFLFGSV 72

Query: 195 SSR---PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINN 251
            +        G     V +L + L  + ++ PLGI SAIY+ E +      S ++  +  
Sbjct: 73  WNPGGANPTYGTLPLWVDTLLVTLGAMIIAAPLGIGSAIYISEIAS-SRIRSVIKPAVEL 131

Query: 252 LASVPSIVYGILGSAVLINFFKMP-----RSTALVGGLILALMTLPSIIIATGVALRTVP 306
           LA +PS+VYG  G  +L ++ ++          L G ++L +M LP+II  +  A+  VP
Sbjct: 132 LAGIPSVVYGFFGLVILTDWLRITFDLATGECWLAGSILLGIMALPTIISVSEDAINAVP 191

Query: 307 SSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV-AFVTD 365
            + R  +LGLGA+  QT+   ++P A+  I     + + RA+GET  ++ V    A + D
Sbjct: 192 DNFRRGSLGLGATYWQTISKVIVPAALSGITAAIILGMGRAIGETMAVMMVTGNSAIIPD 251

Query: 366 YPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
               +          + +   +           FG  LLLL+   V+N +   + NR + 
Sbjct: 252 PIYNIFSPVRTLTGTLGIEMGEVAVGSEHYHALFGVALLLLVITLVVNLSARHIINRIRL 311

Query: 424 R 424
           +
Sbjct: 312 K 312


>gi|222478939|ref|YP_002565176.1| phosphate ABC transporter, inner membrane subunit PstA [Halorubrum
           lacusprofundi ATCC 49239]
 gi|222451841|gb|ACM56106.1| phosphate ABC transporter, inner membrane subunit PstA [Halorubrum
           lacusprofundi ATCC 49239]
          Length = 588

 Score =  170 bits (431), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 89/247 (36%), Positives = 138/247 (55%), Gaps = 5/247 (2%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK--- 238
               + G+     SS    AG+  A+VGS+ ++ +V  LSF LG+ ++++LEE+      
Sbjct: 340 DPWLDAGYVTEAPSSTAIEAGLYPAIVGSVIIIALVAVLSFVLGVGTSVFLEEYMPGSGI 399

Query: 239 -GFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIA 297
            G  +  +Q NI NLA++PS+VYG+LG  +  N       TA+   L L+L+ LP  II+
Sbjct: 400 LGSLTRLLQVNIANLAAIPSVVYGLLGLGLFANLLGFGLGTAVTASLTLSLLILPITIIS 459

Query: 298 TGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFV 357
              A+R+VP  +R  +  +GA++ QT  + VLP A P ILTG+ ++L RA+GETAPL+ +
Sbjct: 460 AQEAIRSVPDDLRRGSDAMGATRWQTTKNVVLPEAFPGILTGTILALGRAIGETAPLIMI 519

Query: 358 GMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPF-VERTFGAILLLLIFLAVINTAMLW 416
           G    V   P  +    +A P+QIY WA   +  F        ++ LLI L  +N   + 
Sbjct: 520 GAATTVFSAPDSLFSRFSAMPMQIYAWANFPQAEFRYGVVAAGVITLLIILVGMNGTAIL 579

Query: 417 LRNRFKK 423
           LRNR ++
Sbjct: 580 LRNRAER 586


>gi|303327852|ref|ZP_07358292.1| phosphate ABC transporter, permease protein PstA [Desulfovibrio sp.
           3_1_syn3]
 gi|302862213|gb|EFL85147.1| phosphate ABC transporter, permease protein PstA [Desulfovibrio sp.
           3_1_syn3]
          Length = 292

 Score =  170 bits (431), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 81/244 (33%), Positives = 133/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   ++G+  + L  + L+FP+G+ASA+YL E++ +  F+
Sbjct: 49  PALSWEFLTEPPRKMMTEGGIWPCILGTAILSLGALLLAFPMGVASAVYLHEYAKRNAFA 108

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            +V+  +NNLA VPS+V+G+ G +  + F      + L G L LA++TLP II     AL
Sbjct: 109 RYVRLGVNNLAGVPSVVFGLFGLSFFVTFCGFGV-SILSGVLTLAVLTLPVIIGTAEEAL 167

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+VP + R A+L LGA+K QT+   VLP A+P +LTG+ + +ARA GETA ++F   V +
Sbjct: 168 RSVPDTYREASLALGATKSQTIARVVLPCALPGMLTGAILGVARAAGETAAIMFTAAVFY 227

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  +     A P  +Y+ A             +G  L+L++ +  +N   + LR+ 
Sbjct: 228 TPKTPDSIFSAVMALPYHMYVLATAGTEIEKTRPLQYGTGLVLILLVLGMNLLAVLLRDH 287

Query: 421 FKKR 424
            ++R
Sbjct: 288 LQRR 291


>gi|228476156|ref|ZP_04060864.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           hominis SK119]
 gi|314936467|ref|ZP_07843814.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           hominis subsp. hominis C80]
 gi|228269979|gb|EEK11459.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           hominis SK119]
 gi|313655086|gb|EFS18831.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           hominis subsp. hominis C80]
          Length = 306

 Score =  170 bits (431), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 93/229 (40%), Positives = 145/229 (63%), Gaps = 4/229 (1%)

Query: 200 VAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIV 259
            AGI  A+ G+L++M+ +I +S  LG+ +AIYLEE++    F+SFV+  I+NLA VPSIV
Sbjct: 77  QAGIKGALAGTLWLMITIIPISIILGVGTAIYLEEYARDNMFTSFVKICISNLAGVPSIV 136

Query: 260 YGILGSAVLINFFKMPRSTA----LVGGLILALMTLPSIIIATGVALRTVPSSIRSAALG 315
           +G+LG  + +    +   +     +   L ++L+ LP II+++  A+R VP+S+R A+ G
Sbjct: 137 FGLLGLTLFVRGAGIESLSLGNTVIAAALTMSLLILPIIIVSSQEAIRAVPNSVREASYG 196

Query: 316 LGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIAT 375
           LG +K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+       P G+  + T
Sbjct: 197 LGGNKWQTIRKVVLPAALPGILTGFILSLSRALGETAPLILIGIPTIFLAVPSGLFSMFT 256

Query: 376 AFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           A P QIY WA   +  F       I++LL+ L ++N   ++LRN+F ++
Sbjct: 257 ALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLLMNGLAIFLRNKFSRK 305


>gi|145219802|ref|YP_001130511.1| phosphate ABC transporter, inner membrane subunit PstA
           [Prosthecochloris vibrioformis DSM 265]
 gi|145205966|gb|ABP37009.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Chlorobium phaeovibrioides DSM 265]
          Length = 448

 Score =  170 bits (431), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 104/410 (25%), Positives = 174/410 (42%), Gaps = 27/410 (6%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGA-LWQTHI------------ 56
           NL  R I +  F    + +++V+ + L+++L+ IV  G+GA  +   I            
Sbjct: 2   NLGTRKILDNSFTAVGMGSIVVMALALLVVLTPIVYNGVGAVFFTGTIEHRTMLYKEYGR 61

Query: 57  --SLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQML 114
             S  IE      D  +           A+   +  +A     S      A +      L
Sbjct: 62  GDSKTIEAQSASADRYRGEAYRMLSGFEAEMEAMTPEASREYRSKYAPVRAAMSSLLGPL 121

Query: 115 STTARYHLRKTLMTDPSL-IGKTVEVSLLASANIDSALKG------YLYSPANVHRMSDY 167
               +  L +           +     +L     D +         Y+            
Sbjct: 122 PGDPQPMLTRFQYGQTRWEKAEEKLHDILYEKKWDYSDPTVMAKEFYVPRAEAFAGTKLA 181

Query: 168 QWKWF--QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
               +  + L         F +GFF + +       GI   + G+ ++ +  +  +FPLG
Sbjct: 182 PLFGYVDKHLADMMQPQFTFYWGFFTDRSLDAHIFGGIWPEIQGTFFLAIGAMLFAFPLG 241

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGGL 284
           + +A+Y  E++ +GFF+S +++  + LA VPSIV+G+ G A  IN  K+  S + L G L
Sbjct: 242 VIAAVYFTEYAKEGFFTSILRSANSTLAGVPSIVFGLFGLAFFINTMKVSESKSVLAGSL 301

Query: 285 ILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSL 344
            LA+M LP+II A   A+ +VP + + A+LGLG++K  T+   +LP A+P I+TG  +SL
Sbjct: 302 TLAIMILPTIIRAAEEAILSVPKTYKEASLGLGSTKWNTIATVILPAALPGIITGGIISL 361

Query: 345 ARALGETAPLLFVGM--VAFVTDYPVGVTDIATAFPVQIYLWAADAERPF 392
            RA GETAP++F     V          +    A    IY  A++ E   
Sbjct: 362 GRAAGETAPIIFTAAVSVGSAIGIADVFSSPTPALSWNIYNLASEHEMAS 411


>gi|229013489|ref|ZP_04170626.1| ABC transporter permease protein [Bacillus mycoides DSM 2048]
 gi|228747901|gb|EEL97767.1| ABC transporter permease protein [Bacillus mycoides DSM 2048]
          Length = 248

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 146/237 (61%), Gaps = 1/237 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  FF N AS  P  AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F  
Sbjct: 12  YLSIDFFTNFASRNPREAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKK 71

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ N   LA VPS+V+G+LG  + +    +   + +   L ++L+ LP++++A+  A+R
Sbjct: 72  LIELNNQTLAGVPSVVFGLLGLTIFVYALHL-GESIMAAALTMSLLVLPTVVVASQEAIR 130

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           TVPSS+  A+ GLGA+K QT++  VLP+A+P I+TG T++++RA+GE APLL +G +AF 
Sbjct: 131 TVPSSLLEASYGLGATKWQTMYRIVLPVALPGIVTGCTLAVSRAIGEAAPLLVIGALAFA 190

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
              P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 191 NYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 247


>gi|332886072|gb|EGK06316.1| phosphate ABC transporter, permease PstA [Dysgonomonas mossii DSM
           22836]
          Length = 284

 Score =  170 bits (430), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 84/243 (34%), Positives = 130/243 (53%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N+ F  +  +      GI  A+VG++Y+++  +  +FPLG+ SAIY  E++   +   
Sbjct: 39  VINWEFLTSAPTEGMTSGGIFPAIVGTMYLIIGSMIFAFPLGVMSAIYTNEYAGNSWIVK 98

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL S+PSIV+G+ G A+ +N       + + G L L L+ LP II  T  AL+
Sbjct: 99  FIRVMTNNLGSIPSIVFGLFGMALFVNTLGF-GDSIIAGSLTLGLLVLPLIIRTTEEALK 157

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            VP S R+ +L LGA+K+QT+   VLP A+P I TG  +S+ R  GETAP+LF     F+
Sbjct: 158 AVPDSYRTGSLALGATKLQTIRRVVLPAALPNITTGLILSIGRVSGETAPILFTVAAYFL 217

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ A             +G  L+L++ +  +N     LR  F
Sbjct: 218 PKLPESMYDQVMALPYHLYVIATSGTDIEASRPIAYGTALVLIVIVLFMNILATILRRYF 277

Query: 422 KKR 424
            K+
Sbjct: 278 GKK 280


>gi|51891900|ref|YP_074591.1| phosphate ABC transporter permease protein [Symbiobacterium
           thermophilum IAM 14863]
 gi|51855589|dbj|BAD39747.1| phosphate ABC transporter permease protein [Symbiobacterium
           thermophilum IAM 14863]
          Length = 283

 Score =  169 bits (429), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 98/249 (39%), Positives = 145/249 (58%), Gaps = 8/249 (3%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSH----- 237
              ++ F  + AS   +  GI   +VGS Y++++    + P+G+A+A++LE ++      
Sbjct: 33  PRLSWSFLTSHASRFADRTGILAPLVGSFYVIVLTAAFALPVGVATAVFLEFYAEGDRPS 92

Query: 238 --KGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSII 295
             +   + F++ NI+NLA VPSIVYG+ G A  + + +  RS      L LALM LP II
Sbjct: 93  PLRQSLTQFLKLNIDNLAGVPSIVYGLFGLAFFVRWMQFGRSIL-AAALTLALMVLPVII 151

Query: 296 IATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLL 355
           + T  A+R VP S+   A  LGASK Q +F  +LP A+  ILT + +S++RALGE+APLL
Sbjct: 152 VNTREAIRAVPPSLAHGAYALGASKTQVIFTVILPAALGGILTATILSVSRALGESAPLL 211

Query: 356 FVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
            VG   +VT  P    D  T  PVQIY WA   ++ F E     IL+LL  L  +N   +
Sbjct: 212 AVGAWVYVTSLPRTPLDSFTVLPVQIYYWAGMPQKAFQEVASAGILVLLALLLSLNGIAI 271

Query: 416 WLRNRFKKR 424
           WLRN+++K+
Sbjct: 272 WLRNKYQKK 280


>gi|229019491|ref|ZP_04176311.1| ABC transporter permease protein [Bacillus cereus AH1273]
 gi|229025734|ref|ZP_04182137.1| ABC transporter permease protein [Bacillus cereus AH1272]
 gi|228735564|gb|EEL86156.1| ABC transporter permease protein [Bacillus cereus AH1272]
 gi|228741802|gb|EEL91982.1| ABC transporter permease protein [Bacillus cereus AH1273]
          Length = 286

 Score =  169 bits (429), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 92/257 (35%), Positives = 149/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILFILLFQIFEKGMSYLSIDFFTNFASRNPKEAGIVAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE ++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEHYAKESVFKKLIELNNQTLAGVPSVVFGLLGLTIFVYALHL-GESIIAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP+A+P ILTG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYQIVLPVALPGILTGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 VSRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 269 LGLLLFINIFVLWLRNR 285



 Score = 38.9 bits (89), Expect = 1.4,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 26/49 (53%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R++ + +++    +A+L   V L +LL  I  KG+ 
Sbjct: 1  MLNHKKVQENMASRFLKDRIYKSLFYIAILFSIVILFILLFQIFEKGMS 49


>gi|163942029|ref|YP_001646913.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           weihenstephanensis KBAB4]
 gi|163864226|gb|ABY45285.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           weihenstephanensis KBAB4]
          Length = 288

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P  AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSVVILFILLFQIFEKGISYLSIDFFTNFASRNPREAGIVAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE ++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEHYAKESVFKKLIELNNQTLAGVPSVVFGLLGLTIFVYALHL-GESIIAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+RTVPS +  A+ GLGA+K QT++  VLP+A+P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRTVPSLLLEASYGLGATKWQTMYQIVLPVALPGIVTGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 VSRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 271 LGLLLFINIFVLWLRNR 287



 Score = 39.3 bits (90), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 26/49 (53%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R++ + +++    +A+L   V L +LL  I  KGI 
Sbjct: 3  MLNHKKIQENMASRFLKDRIYKCLFYIAILFSVVILFILLFQIFEKGIS 51


>gi|104784367|ref|YP_610865.1| phosphate ABC transporter permease [Pseudomonas entomophila L48]
 gi|95113354|emb|CAK18082.1| phosphate ABC transporter, permease protein [Pseudomonas
           entomophila L48]
          Length = 556

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 75/263 (28%), Positives = 129/263 (49%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++
Sbjct: 288 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYAKQGPVTRLIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                    +     L   L LAL+ 
Sbjct: 348 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSIDRLFFPESLPAPTLGTPGLLWASLTLALLA 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      PV        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPSLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +W+RN  +++
Sbjct: 528 LLVLVIATLNLSAVWIRNHLREK 550


>gi|253999567|ref|YP_003051630.1| phosphate ABC transporter inner membrane subunit PstA [Methylovorus
           sp. SIP3-4]
 gi|313201602|ref|YP_004040260.1| phosphate ABC transporter inner membrane subunit psta [Methylovorus
           sp. MP688]
 gi|253986246|gb|ACT51103.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methylovorus sp. SIP3-4]
 gi|312440918|gb|ADQ85024.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methylovorus sp. MP688]
          Length = 312

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 87/259 (33%), Positives = 139/259 (53%), Gaps = 16/259 (6%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           +  F + F     S R   AG+  A +GSL +M++    + P+G+A+ +YLEE++ K +F
Sbjct: 55  YPRFTFEFLSEYPSRRAAHAGLLSAWIGSLLVMIVTFLSAVPMGVAAGLYLEEYAPKNWF 114

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           S  ++ N+ NLA VPSIVYG+L   + +    + +S    G  +  L+ LP +I+AT  A
Sbjct: 115 SDLIEINVTNLAGVPSIVYGLLALGLFVYILDLGQSILTAGLTLGLLI-LPVVIVATREA 173

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R +P +IR AA  +GA+K Q V HHVL  +   ILTG  + +ARALGETAPL+ +G + 
Sbjct: 174 VRGIPVAIREAAYAVGATKWQVVLHHVLHYSFGGILTGVIIGMARALGETAPLITIGALT 233

Query: 362 FVTDYPVGVT-------------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           F+   P                    T  P+Q++ W +  +  F         L+++   
Sbjct: 234 FIAFLPPSPITDTPPFLNFEWLSSGFTVMPIQMFNWLSRPDHAFHMNAAATGALIIVVTL 293

Query: 409 VINTAMLWLRNRFKK--RW 425
           ++N   +WLR R +K  +W
Sbjct: 294 LMNGTAIWLRYRIRKNIKW 312



 Score = 36.6 bits (83), Expect = 7.2,   Method: Composition-based stats.
 Identities = 6/52 (11%), Positives = 23/52 (44%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALW 52
          + +    +  ++    ++++F    ++A+++  + L+ L   +V  G     
Sbjct: 8  LDNLEEVRAMIRRHKFNDYVFSIIGLIALMIGLLTLLTLFVDLVMDGYPRFT 59


>gi|229169016|ref|ZP_04296732.1| ABC transporter permease protein [Bacillus cereus AH621]
 gi|228614425|gb|EEK71534.1| ABC transporter permease protein [Bacillus cereus AH621]
          Length = 248

 Score =  169 bits (428), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 146/237 (61%), Gaps = 1/237 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  FF N AS  P  AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F  
Sbjct: 12  YLSIDFFTNFASRNPREAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKK 71

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ N   LA VPS+V+G+LG  + +    +   + +   L ++L+ LP++++A+  A+R
Sbjct: 72  LIELNNQTLAGVPSVVFGLLGLTIFVYALHL-GESIMAAALTMSLLVLPTVVVASQEAIR 130

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           TVPSS+  A+ GLGA+K QT++  VLP+A+P I+TG T++++RA+GE APLL +G +AF 
Sbjct: 131 TVPSSLLEASYGLGATKWQTMYQIVLPVALPGIVTGCTLAVSRAIGEAAPLLVIGALAFA 190

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
              P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 191 NYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 247


>gi|212704967|ref|ZP_03313095.1| hypothetical protein DESPIG_03034 [Desulfovibrio piger ATCC 29098]
 gi|212671631|gb|EEB32114.1| hypothetical protein DESPIG_03034 [Desulfovibrio piger ATCC 29098]
          Length = 291

 Score =  169 bits (428), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 83/244 (34%), Positives = 131/244 (53%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   +VG+  + L  + L+FPLG+A+A+YL E++    F+
Sbjct: 46  PALSWEFLSTPPREMMTAGGILPCIVGTAILALGSLLLAFPLGVATAVYLHEYAGNTPFA 105

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             V+  +NNLA VPS+V+G+ G +  + F  M   + L G L LA++TLP II     +L
Sbjct: 106 RMVRLGVNNLAGVPSVVFGLFGLSFFVTFCGMGV-SILSGILTLAVLTLPVIISTAEESL 164

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R+VP + R A+L LGA K QT+   VLP AMP +LTG+ + +ARA GETA ++F   V +
Sbjct: 165 RSVPDTYRQASLALGAGKAQTITRVVLPCAMPGMLTGAILGVARAAGETAAIMFTAAVFY 224

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  +     A P  +Y+ A             +G  L+L++ +  +N   + LR+ 
Sbjct: 225 TPKNPDSIFSSVMALPYHMYVLATAGTDIEKTRPLQYGTGLVLILLVLGMNLLAIILRDH 284

Query: 421 FKKR 424
            ++R
Sbjct: 285 LQRR 288


>gi|55980230|ref|YP_143527.1| phosphate ABC transporter permease [Thermus thermophilus HB8]
 gi|55771643|dbj|BAD70084.1| probable phosphate ABC transporter, permease protein [Thermus
           thermophilus HB8]
          Length = 291

 Score =  169 bits (428), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 98/259 (37%), Positives = 146/259 (56%), Gaps = 1/259 (0%)

Query: 167 YQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGI 226
            + K          L    +  F     S  P  AGIGVA+ G+++++ + + ++ P+GI
Sbjct: 34  EELKAGLGEGERLVLNPWLDQSFLTRTPSRSPLTAGIGVAIWGTIWVLSLALLIAIPVGI 93

Query: 227 ASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLIL 286
            +AI LEE+  +G  +  ++ N+ NLA VPSIVYG+LG A+ +    +   T L   L L
Sbjct: 94  GTAILLEEYLREGTLNRILEVNLRNLAGVPSIVYGLLGLAIFVREMGL-GPTILSAALTL 152

Query: 287 ALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR 346
            L+ +P I++    +LR VP S+R AA  LGA++ Q VF  V+P A+P ++TG  +S AR
Sbjct: 153 GLLGIPVIVVTARESLRAVPESLRQAAFALGATRRQVVFRVVVPAALPGMVTGVILSAAR 212

Query: 347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
            +GE APLL VG  A+V  YP G     T  PVQIYLW +     F       IL++L+ 
Sbjct: 213 LIGEAAPLLLVGAAAYVPFYPTGPLSEYTVIPVQIYLWVSMNIPEFARVAAAGILVMLLV 272

Query: 407 LAVINTAMLWLRNRFKKRW 425
           L+ +    L+LRNRF++ W
Sbjct: 273 LSGLYFLALYLRNRFRREW 291


>gi|269965141|ref|ZP_06179275.1| phosphate ABC transporter, permease protein [Vibrio alginolyticus
           40B]
 gi|269830127|gb|EEZ84354.1| phosphate ABC transporter, permease protein [Vibrio alginolyticus
           40B]
          Length = 557

 Score =  169 bits (427), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 82/364 (22%), Positives = 147/364 (40%), Gaps = 45/364 (12%)

Query: 86  NLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASA 145
           N  + ++  ++                +     R  L    +    + G  V +      
Sbjct: 207 NDTLTESFLKENQTKKEQIEKALATLDLQLDGLRLQLSDYALIVEDMTGSQVSI--PLED 264

Query: 146 NIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV 205
            +D      +  P       D    W +++           + F            G+  
Sbjct: 265 ILDYWYPNQMSLP-------DKVMHWGKQV-----------WKFLSEDPRESNSEGGVFP 306

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A+ G+++++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVYG+ G 
Sbjct: 307 AIFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVYGVFGL 366

Query: 266 AVLINFFK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSI 309
              +                          L   L LA++TLP +I+ T   L  +PSS+
Sbjct: 367 GFFVYTIGASIDNVFYAEKLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTRIPSSV 426

Query: 310 RSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG 369
           R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +  PV 
Sbjct: 427 RHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLASSLPVD 486

Query: 370 -------VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
                  +          IY   +            +    LL+  +  +N   + +RN 
Sbjct: 487 GQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSFLLVTVIVGLNLTAISIRNN 546

Query: 421 FKKR 424
            +++
Sbjct: 547 LREK 550


>gi|148550435|ref|YP_001270537.1| phosphate ABC transporter inner membrane subunit PstA [Pseudomonas
           putida F1]
 gi|148514493|gb|ABQ81353.1| phosphate ABC transporter, inner membrane subunit PstA [Pseudomonas
           putida F1]
          Length = 556

 Score =  169 bits (427), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 75/263 (28%), Positives = 129/263 (49%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++
Sbjct: 288 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYARQGPVTRLIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                    +     L   L LAL+ 
Sbjct: 348 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSIDRLFFPEALPAPTLGTPGLLWASLTLALLA 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      PV        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPSLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +W+RN  +++
Sbjct: 528 LLVLVIATLNLSAVWIRNHLREK 550


>gi|223043190|ref|ZP_03613237.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           capitis SK14]
 gi|314933565|ref|ZP_07840930.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           caprae C87]
 gi|222443401|gb|EEE49499.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           capitis SK14]
 gi|313653715|gb|EFS17472.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           caprae C87]
          Length = 301

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 103/236 (43%), Positives = 153/236 (64%), Gaps = 1/236 (0%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +SS P  AGI  A+VGS+++++ +I ++  LGI +AIYLEE++    F+S V+ +
Sbjct: 66  FFTNFSSSTPADAGIKGALVGSIWLIVTIIPITIILGIGTAIYLEEYAKDNIFTSIVKIS 125

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I+NLA VPSIV+G+LG  + +    M  ++ L   L ++L+ LP II+++  A+R VP S
Sbjct: 126 ISNLAGVPSIVFGLLGYTLFVGAAGM-GNSVLAAALAMSLLILPVIIVSSQEAIRAVPGS 184

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R A+ GLGA+K QT+   VLP A+P ILTG  +SL+RALGETAPL+ +G+   +   P 
Sbjct: 185 VREASFGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVVIGIPTILLATPS 244

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           G+ D  +A P QIY WA   +  F       I++LLI L  +N   + LRN+F K+
Sbjct: 245 GLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLIILLAMNAVAILLRNKFSKK 300


>gi|228941433|ref|ZP_04103984.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228974364|ref|ZP_04134933.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980957|ref|ZP_04141260.1| ABC transporter permease protein [Bacillus thuringiensis Bt407]
 gi|228778748|gb|EEM27012.1| ABC transporter permease protein [Bacillus thuringiensis Bt407]
 gi|228785414|gb|EEM33424.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818214|gb|EEM64288.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 286

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILFVLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F + V+ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEQYAKESLFKNIVEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS++   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPSALLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 269 LGLLLFINIFVLWLRNR 285



 Score = 40.8 bits (94), Expect = 0.44,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L +LL  IV KGI 
Sbjct: 1  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSIVILFVLLFQIVEKGIS 49


>gi|229174944|ref|ZP_04302464.1| ABC transporter permease protein [Bacillus cereus MM3]
 gi|228608612|gb|EEK65914.1| ABC transporter permease protein [Bacillus cereus MM3]
          Length = 286

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILLILLFQIFEKGISYLSLDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIIAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP A P I+TG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYQIVLPSAFPGIITGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 269 LGLLLFINIFVLWLRNR 285



 Score = 38.5 bits (88), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R++ + +++    +A+L   V L++LL  I  KGI 
Sbjct: 1  MLNHKKIQENMASRFLKDRVYKLLFYIAILFSIVILLILLFQIFEKGIS 49


>gi|30022350|ref|NP_833981.1| phosphate ABC transporter permease [Bacillus cereus ATCC 14579]
 gi|29897907|gb|AAP11182.1| Phosphate transport system permease protein pstA [Bacillus cereus
           ATCC 14579]
          Length = 285

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 29  LFSIVILFLLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 88

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 89  FGVGTALYLEQYAKESIFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 147

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 148 LTMSLLVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 207

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 208 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 267

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 268 LGLLLFINIFVLWLRNR 284



 Score = 38.9 bits (89), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 3  SFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          +    +KN+  R++ + +++    +A+L   V L LLL  IV KGI 
Sbjct: 2  NHKKIQKNMASRFLKDRIYKLLFYIAILFSIVILFLLLFQIVEKGIS 48


>gi|170719334|ref|YP_001747022.1| phosphate ABC transporter inner membrane subunit PstA [Pseudomonas
           putida W619]
 gi|169757337|gb|ACA70653.1| phosphate ABC transporter, inner membrane subunit PstA [Pseudomonas
           putida W619]
          Length = 556

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/263 (28%), Positives = 129/263 (49%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++
Sbjct: 288 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYAKQGPVTRLIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                    +     L   L LAL+ 
Sbjct: 348 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSIDRLFFPESLPAPTLGTPGLLWASLTLALLA 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      P+        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPSLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +W+RN  +++
Sbjct: 528 LLVMVIATLNLSAVWIRNHLREK 550


>gi|90409161|ref|ZP_01217278.1| phosphate ABC transporter, permease protein, putative [Psychromonas
           sp. CNPT3]
 gi|90309733|gb|EAS37901.1| phosphate ABC transporter, permease protein, putative [Psychromonas
           sp. CNPT3]
          Length = 548

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/346 (21%), Positives = 143/346 (41%), Gaps = 30/346 (8%)

Query: 109 QASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQ 168
           + ++ L+       +K        +G         +   D            V ++S   
Sbjct: 197 EIAKTLTAENILDFKKQSDALRKAVGVFETQLFDFNRQADRDHLFVKDMRGEVVQLSIAN 256

Query: 169 WKWFQKLDSDGALFLDFNYG-----FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
               Q+ +    L    ++      F            G+  A+ G+++M+L++  +  P
Sbjct: 257 LLKAQQPNKMNVLQKTMSWFHGIYEFVTTDPREANTEGGVFPAIFGTIFMVLLMAVIVTP 316

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
           LG+ +AIYL E++ K   +  ++ ++ NL+ VPSIVYG+ G    +        +     
Sbjct: 317 LGVIAAIYLHEYAPKNSITKMIRISVINLSGVPSIVYGVFGLGFFVYILGGSIDSLFYPE 376

Query: 284 LILALMT----------------LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHH 327
           +    M                 LP +I++T   L  +P S+R  +L LGA+K +T++  
Sbjct: 377 VAPGAMFGSPGVFWSALTLAILTLPVVIVSTEEGLSRIPMSLRQGSLALGATKFETLWRI 436

Query: 328 VLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQ 380
           V+P+A PAI+TG  +++ARA GE APL+ VG+V      P+ +                 
Sbjct: 437 VIPMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPSLPIDMNFPYVHLERKFMHLGFH 496

Query: 381 IYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           I+     +          +    LL+  +  +N A + +RN+ +++
Sbjct: 497 IFDVGFQSPNVEAARPLVYATSFLLITVIIGLNLAAIHVRNKLRRK 542


>gi|229135093|ref|ZP_04263896.1| ABC transporter permease protein [Bacillus cereus BDRD-ST196]
 gi|228648381|gb|EEL04413.1| ABC transporter permease protein [Bacillus cereus BDRD-ST196]
          Length = 248

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 145/237 (61%), Gaps = 1/237 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  FF   AS  P  AGI  A+ G++  M IVI +SF  G+ +A+YLE ++ +  F  
Sbjct: 12  YLSIDFFTKFASRNPREAGIVAALSGTILFMSIVIPVSFIFGVGTALYLEHYAKESVFKK 71

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ N   LA VPS+V+G+LG  + +    +   + +   L ++L+ LP++++A+  A+R
Sbjct: 72  LIELNNQTLAGVPSVVFGLLGLTIFVYALHL-GESIMAAALTMSLLVLPTVVVASQEAIR 130

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           TVPSS+  A+ GLGA+K QT++  VLP+A+P I+TG T++++RA+GE APLL +G +AF 
Sbjct: 131 TVPSSLLEASYGLGATKWQTMYQIVLPVALPGIVTGCTLAVSRAIGEAAPLLVIGALAFA 190

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
              P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 191 NYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 247


>gi|26992003|ref|NP_747428.1| phosphate ABC transporter inner membrane protein [Pseudomonas
           putida KT2440]
 gi|24987136|gb|AAN70892.1|AE016733_4 phosphate ABC transporter, permease protein [Pseudomonas putida
           KT2440]
 gi|313501300|gb|ADR62666.1| PstA [Pseudomonas putida BIRD-1]
          Length = 556

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/263 (28%), Positives = 129/263 (49%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++
Sbjct: 288 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYARQGPVTRLIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                    +     L   L LAL+ 
Sbjct: 348 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSIDRLFFPEALPAPTLGTPGLLWASLTLALLA 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      PV        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPSLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +W+RN  +++
Sbjct: 528 LLVLVIATLNLSAVWIRNHLREK 550


>gi|229061963|ref|ZP_04199290.1| ABC transporter permease protein [Bacillus cereus AH603]
 gi|228717347|gb|EEL69019.1| ABC transporter permease protein [Bacillus cereus AH603]
          Length = 288

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 94/257 (36%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P  AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSVVILFILLFQIFEKGISYLSIDFFTNFASRNPREAGIVAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE ++ +  F   ++ N   LA VPS+V+G+LG  + +    +  S   V  
Sbjct: 92  FGVGTALYLEHYAKESVFKKLIELNNQTLAGVPSVVFGLLGLTIFVYALHLGESIMAVA- 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+RTVPSS+  A+ GLGA+K QT++  VLP+A+P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRTVPSSLLEASYGLGATKWQTMYQIVLPVALPGIVTGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 VSRAIGEAAPLLVIGALAFANYVPFSMLDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 271 LGLLLFINIFVLWLRNR 287



 Score = 38.5 bits (88), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 26/49 (53%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R++ + +++    +A+L   V L +LL  I  KGI 
Sbjct: 3  MLNHKNIQENMASRFLKDRIYKCLFYIAILFSVVILFILLFQIFEKGIS 51


>gi|229111743|ref|ZP_04241291.1| ABC transporter permease protein [Bacillus cereus Rock1-15]
 gi|229152470|ref|ZP_04280662.1| ABC transporter permease protein [Bacillus cereus m1550]
 gi|229180547|ref|ZP_04307889.1| ABC transporter permease protein [Bacillus cereus 172560W]
 gi|228602971|gb|EEK60450.1| ABC transporter permease protein [Bacillus cereus 172560W]
 gi|228631078|gb|EEK87715.1| ABC transporter permease protein [Bacillus cereus m1550]
 gi|228671737|gb|EEL27033.1| ABC transporter permease protein [Bacillus cereus Rock1-15]
          Length = 286

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILFLLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEQYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 269 LGLLLFINIFVLWLRNR 285



 Score = 40.1 bits (92), Expect = 0.67,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L LLL  IV KGI 
Sbjct: 1  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSIVILFLLLFQIVEKGIS 49


>gi|326942052|gb|AEA17948.1| phosphate ABC transporter permease [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 288

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSIVILFVLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F + V+ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEQYAKESLFKNIVEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS++   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRSVPSALLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 271 LGLLLFINIFVLWLRNR 287



 Score = 40.8 bits (94), Expect = 0.44,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L +LL  IV KGI 
Sbjct: 3  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSIVILFVLLFQIVEKGIS 51


>gi|146284337|ref|YP_001174490.1| membrane protein component of ABC phosphate transporter
           [Pseudomonas stutzeri A1501]
 gi|145572542|gb|ABP81648.1| membrane protein component of ABC phosphate transporter
           [Pseudomonas stutzeri A1501]
          Length = 556

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/263 (28%), Positives = 129/263 (49%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         G+  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++
Sbjct: 288 WEFVSDEPREANTEGGVFPAIFGTVLMTLIMAVIVTPFGVIAAVYLREYAKQGLLTRIIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VPSIVYG+ G    +                          +   L LA++T
Sbjct: 348 IAVNNLAGVPSIVYGVFGLGFFVYVLGGSLDRLFYPEAAPAPVFGTPGLMWASLTLAILT 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+AT   L  +P  IR  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 LPVVIVATEEGLARIPRMIREGSLALGATKSETLWKVVLPMASPAMMTGLILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V    + P+        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPNLPLNGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +++RN  +++
Sbjct: 528 LLVLVIATLNFSAIYIRNHLREK 550


>gi|206971288|ref|ZP_03232239.1| phosphate ABC transporter, permease protein [Bacillus cereus
           AH1134]
 gi|218235298|ref|YP_002369077.1| phosphate ABC transporter, permease protein [Bacillus cereus B4264]
 gi|229047987|ref|ZP_04193563.1| ABC transporter permease protein [Bacillus cereus AH676]
 gi|206734060|gb|EDZ51231.1| phosphate ABC transporter, permease protein [Bacillus cereus
           AH1134]
 gi|218163255|gb|ACK63247.1| phosphate ABC transporter, permease protein [Bacillus cereus B4264]
 gi|228723444|gb|EEL74813.1| ABC transporter permease protein [Bacillus cereus AH676]
          Length = 288

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSIVILFLLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEQYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 271 LGLLLFINIFVLWLRNR 287



 Score = 40.1 bits (92), Expect = 0.66,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L LLL  IV KGI 
Sbjct: 3  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSIVILFLLLFQIVEKGIS 51


>gi|91225170|ref|ZP_01260392.1| phosphate ABC transporter, permease protein [Vibrio alginolyticus
           12G01]
 gi|91190113|gb|EAS76384.1| phosphate ABC transporter, permease protein [Vibrio alginolyticus
           12G01]
          Length = 557

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 83/364 (22%), Positives = 147/364 (40%), Gaps = 45/364 (12%)

Query: 86  NLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASA 145
           N  + ++  ++                +     R  L    +    + G  V +      
Sbjct: 207 NDTLTESFLKENQTKKEQIEKALATLDLQLDGLRLQLSDYALIAEDMTGSQVSI--PLED 264

Query: 146 NIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV 205
            +D      +  P       D    W +++           + F            G+  
Sbjct: 265 ILDYWYPNQMSLP-------DKVMHWGKQV-----------WKFLSEDPRESNSEGGVFP 306

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           AV G+++++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVYG+ G 
Sbjct: 307 AVFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVYGVFGL 366

Query: 266 AVLINFFK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSI 309
              +                          L   L LA++TLP +I+ T   L  +PSS+
Sbjct: 367 GFFVYTIGASIDNVFYAEKLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTRIPSSV 426

Query: 310 RSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG 369
           R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +  PV 
Sbjct: 427 RHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLASSLPVD 486

Query: 370 -------VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
                  +          IY   +            +    LL+  +  +N   + +RN 
Sbjct: 487 GQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSFLLVTVIVGLNLTAISIRNN 546

Query: 421 FKKR 424
            +++
Sbjct: 547 LREK 550


>gi|229031918|ref|ZP_04187905.1| ABC transporter permease protein [Bacillus cereus AH1271]
 gi|228729382|gb|EEL80372.1| ABC transporter permease protein [Bacillus cereus AH1271]
          Length = 286

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 92/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FFIN AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILLILLFQIFEKGISYLSLDFFINFASRNPKEAGIAAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIIAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP A P I+TG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYQIVLPYAFPGIITGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 269 LGLLLFINIFVLWLRNR 285



 Score = 39.3 bits (90), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPI 60
          M +    +KN+  R++ + +++    +A+L   V L++LL  I  KGI      ++SL  
Sbjct: 1  MLNHKKIQKNMAARFLKDRVYKLLFYIAILFSIVILLILLFQIFEKGIS-----YLSLDF 55

Query: 61 EFSETIVDPQKKR 73
            +    +P++  
Sbjct: 56 FINFASRNPKEAG 68


>gi|228954553|ref|ZP_04116578.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229081528|ref|ZP_04214027.1| ABC transporter permease protein [Bacillus cereus Rock4-2]
 gi|228701835|gb|EEL54322.1| ABC transporter permease protein [Bacillus cereus Rock4-2]
 gi|228805210|gb|EEM51804.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 286

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 89/252 (35%), Positives = 145/252 (57%), Gaps = 1/252 (0%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
             +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +
Sbjct: 35  ILFLLLFQIVEKGISYLSINFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGT 94

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   L ++L
Sbjct: 95  ALYLEQYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAALTMSL 153

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++++RA+
Sbjct: 154 LVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAI 213

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++LL  L 
Sbjct: 214 GEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLL 273

Query: 409 VINTAMLWLRNR 420
            IN  +LWLRNR
Sbjct: 274 FINIFVLWLRNR 285



 Score = 40.1 bits (92), Expect = 0.77,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L LLL  IV KGI 
Sbjct: 1  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSMVILFLLLFQIVEKGIS 49


>gi|300088410|ref|YP_003758932.1| phosphate ABC transporter inner membrane subunit PstA
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299528143|gb|ADJ26611.1| phosphate ABC transporter, inner membrane subunit PstA
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 288

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 122/241 (50%), Gaps = 1/241 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F     S   +  GI  A++G+ Y+M+  I  + P+G+ + IYL E++   + + 
Sbjct: 49  VIDWAFLTEAPSRAGKEGGILPAIIGTFYLMVGTIIFALPIGVMAGIYLSEYAGDSWLTR 108

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            +   I NLA VPSIV+G+ G +V +    +   + L   L LA   L   I  +  ++ 
Sbjct: 109 LINLAIINLAGVPSIVFGLFGLSVFVLTLDL-GMSLLAASLTLAAQALAMTITTSRESIS 167

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P   R  +L +G SK QT+ H VLP A P ILTG+ ++++RA GETAP+L VG    V
Sbjct: 168 AIPKEYREGSLAIGVSKWQTIRHAVLPEAFPGILTGAILAMSRAAGETAPILVVGAAFLV 227

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P    D   A P  +Y  +A       E  +G  L+L+  +   N  +  +R + +K
Sbjct: 228 PGLPGSPFDRFMALPYHLYTVSAHVPGMPKEVMWGVALVLVAMVLFFNILVTIVRIKTRK 287

Query: 424 R 424
           R
Sbjct: 288 R 288


>gi|229129548|ref|ZP_04258519.1| ABC transporter permease protein [Bacillus cereus BDRD-Cer4]
 gi|296504766|ref|YP_003666466.1| phosphate ABC transporter permease [Bacillus thuringiensis BMB171]
 gi|228654153|gb|EEL10020.1| ABC transporter permease protein [Bacillus cereus BDRD-Cer4]
 gi|296325818|gb|ADH08746.1| phosphate ABC transporter permease [Bacillus thuringiensis BMB171]
          Length = 288

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSIVILFLLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEQYAKESIFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 271 LGLLLFINIFVLWLRNR 287



 Score = 40.1 bits (92), Expect = 0.70,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L LLL  IV KGI 
Sbjct: 3  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSIVILFLLLFQIVEKGIS 51


>gi|228910103|ref|ZP_04073923.1| ABC transporter permease protein [Bacillus thuringiensis IBL 200]
 gi|228849620|gb|EEM94454.1| ABC transporter permease protein [Bacillus thuringiensis IBL 200]
          Length = 286

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 144/237 (60%), Gaps = 1/237 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F  
Sbjct: 50  YLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKK 109

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            V+ N   LA VPS+V+G+LG  + +    +   + +   L ++L+ LP++++A+  A+R
Sbjct: 110 IVEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAALTMSLLVLPTVVVASQEAIR 168

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VPS +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF 
Sbjct: 169 SVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFA 228

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
              P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 229 NYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 285



 Score = 39.3 bits (90), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 28/49 (57%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M + +  +KN+  R++ + +++    +++L   V L +LL  IV KGI 
Sbjct: 1  MLNHNKIQKNMASRFLKDRIYKLLFYISILFSIVILSVLLFQIVEKGIS 49


>gi|229098741|ref|ZP_04229681.1| ABC transporter permease protein [Bacillus cereus Rock3-29]
 gi|229117766|ref|ZP_04247135.1| ABC transporter permease protein [Bacillus cereus Rock1-3]
 gi|228665743|gb|EEL21216.1| ABC transporter permease protein [Bacillus cereus Rock1-3]
 gi|228684820|gb|EEL38758.1| ABC transporter permease protein [Bacillus cereus Rock3-29]
          Length = 286

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILLILLFQIFEKGLSYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP+A P I+TG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYQIVLPVAFPGIITGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 VSRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 269 LGLLLFINIFVLWLRNR 285



 Score = 39.7 bits (91), Expect = 0.88,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 26/49 (53%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R+  + +++    +A+L   V L++LL  I  KG+ 
Sbjct: 1  MLNHKKIQENMASRFFKDRIYKLLFYIAILFSIVILLILLFQIFEKGLS 49


>gi|327482721|gb|AEA86031.1| membrane protein component of ABC phosphate transporter
           [Pseudomonas stutzeri DSM 4166]
          Length = 556

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/263 (28%), Positives = 129/263 (49%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         G+  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++
Sbjct: 288 WEFVSDEPREANTEGGVFPAIFGTVLMTLIMAVIVTPFGVIAAVYLREYAKQGLLTRIIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VPSIVYG+ G    +                          +   L LA++T
Sbjct: 348 IAVNNLAGVPSIVYGVFGLGFFVYVLGGSLDRLFYPEAAPAPVFGTPGLMWASLTLAILT 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+AT   L  +P  IR  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 LPVVIVATEEGLARIPRMIREGSLALGATKSETLWKVVLPMASPAMMTGLILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V    + P+        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPNLPLNGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +++RN  +++
Sbjct: 528 LLVLVIATLNFSAIYIRNHLREK 550


>gi|167036360|ref|YP_001671591.1| phosphate ABC transporter inner membrane subunit PstA [Pseudomonas
           putida GB-1]
 gi|166862848|gb|ABZ01256.1| phosphate ABC transporter, inner membrane subunit PstA [Pseudomonas
           putida GB-1]
          Length = 556

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 75/263 (28%), Positives = 129/263 (49%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++
Sbjct: 288 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYARQGPVTRLIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                    +     L   L LAL+ 
Sbjct: 348 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSIDRLFFPEALPAPTLGTPGLLWASLTLALLA 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      PV        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPSLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +W+RN  +++
Sbjct: 528 LLVLVIATLNLSAVWIRNHLREK 550


>gi|229075974|ref|ZP_04208950.1| ABC transporter permease protein [Bacillus cereus Rock4-18]
 gi|228707289|gb|EEL59486.1| ABC transporter permease protein [Bacillus cereus Rock4-18]
          Length = 288

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSIVILLILLFQIFEKGLSYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP+A P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYQIVLPVAFPGIITGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 VSRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 271 LGLLLFINIFVLWLRNR 287



 Score = 39.7 bits (91), Expect = 0.89,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 26/49 (53%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R+  + +++    +A+L   V L++LL  I  KG+ 
Sbjct: 3  MLNHKKIQENMASRFFKDRIYKLLFYIAILFSIVILLILLFQIFEKGLS 51


>gi|260773408|ref|ZP_05882324.1| phosphate transport system permease protein PstA [Vibrio
           metschnikovii CIP 69.14]
 gi|260612547|gb|EEX37750.1| phosphate transport system permease protein PstA [Vibrio
           metschnikovii CIP 69.14]
          Length = 546

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 79/331 (23%), Positives = 141/331 (42%), Gaps = 45/331 (13%)

Query: 119 RYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSD 178
           R  L    +    + G T  + +  S  +D      +              +W + L   
Sbjct: 229 RATLDDQRLLLQDMAGDT--IRIPMSQVLDYWYPNEMTHAE-------KVIRWLKHL--- 276

Query: 179 GALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
                   + F  +         G+  A+ G++ ++LI+  +  PLG+ +A+YL E++  
Sbjct: 277 --------WNFLSDSPRDSNSEGGVFPAIFGTVLLVLIMSVIVMPLGVIAAVYLHEYAKD 328

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVG 282
             F+  ++  + NLA VPSIVYG+ G    +                          L  
Sbjct: 329 NAFTRLIRVAVINLAGVPSIVYGVFGLGFFVYTIGASIDSVFYADSLPAPTFGTPGLLWA 388

Query: 283 GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV 342
            L LA++TLP +I+ T   L  +P S+R  +L LGA++ +T++  VLP+A PA++TG  +
Sbjct: 389 ALTLAVLTLPVVIVTTEEGLTRIPPSVRYGSLALGATQFETIWRIVLPMASPAMITGLIL 448

Query: 343 SLARALGETAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFV 393
           ++ARA GE APL+ VG V   ++ PV        +          IY   +         
Sbjct: 449 AIARAAGEVAPLMLVGAVKLASNLPVDSEFPFVHLERKFMHLGFHIYDVGFQTTNIEAAR 508

Query: 394 ERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              +    LL+  + ++N   + +RN  +++
Sbjct: 509 PLVYATAFLLVTVVVMLNLTAIHIRNNLREK 539


>gi|75759759|ref|ZP_00739838.1| Phosphate transport system permease protein pstA [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218899436|ref|YP_002447847.1| phosphate ABC transporter, permease protein [Bacillus cereus G9842]
 gi|74492757|gb|EAO55894.1| Phosphate transport system permease protein pstA [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218543509|gb|ACK95903.1| phosphate ABC transporter, permease protein [Bacillus cereus G9842]
          Length = 288

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 144/237 (60%), Gaps = 1/237 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F  
Sbjct: 52  YLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKK 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            V+ N   LA VPS+V+G+LG  + +    +   + +   L ++L+ LP++++A+  A+R
Sbjct: 112 IVEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAALTMSLLVLPTVVVASQEAIR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VPS +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF 
Sbjct: 171 SVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFA 230

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
              P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 231 NYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 287



 Score = 40.1 bits (92), Expect = 0.75,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M + +  +KN+  R++ + +++    +A+L   V L +LL  IV KGI 
Sbjct: 3  MLNHNKIQKNMASRFLKDRIYKLLFYIAILFSIVILSVLLFQIVEKGIS 51


>gi|257464210|ref|ZP_05628590.1| phosphate ABC transporter, inner membrane subunit PstA
           [Fusobacterium sp. D12]
 gi|317061731|ref|ZP_07926216.1| phosphate ABC transporter permease [Fusobacterium sp. D12]
 gi|313687407|gb|EFS24242.1| phosphate ABC transporter permease [Fusobacterium sp. D12]
          Length = 279

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 135/241 (56%), Gaps = 1/241 (0%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  +         GI  A++G+LY+ L+ + +S P G+ +AIYL E++ +  F+
Sbjct: 40  QHISWDFLFSMPEDSMRGGGIFPAILGTLYLTLLTVIISVPFGVLTAIYLVEYAKENTFT 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  I NLA +PSI+YG+ G A+ +  F++   + + G L LA+M LP +I AT  AL
Sbjct: 100 RLIELMILNLAGIPSIIYGLFGMALFVISFQLGV-SMIAGSLTLAIMCLPVMITATKEAL 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P  +R A+L LGA++ QT+    LP A P ILTG  +S++RA+GETAP++F  +  +
Sbjct: 159 RAIPRELREASLALGATQWQTIQKITLPAAFPGILTGVILSISRAVGETAPIMFTAVAFY 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
           +   P  + +     P  +++ +        E   G + +L++     N    ++R+ ++
Sbjct: 219 LPFLPESIWEQVMTLPYHLFVISTQIPNMPREMMEGTVFVLVLIAVGFNLLGAFVRHCYQ 278

Query: 423 K 423
           K
Sbjct: 279 K 279


>gi|229104899|ref|ZP_04235558.1| ABC transporter permease protein [Bacillus cereus Rock3-28]
 gi|228678529|gb|EEL32747.1| ABC transporter permease protein [Bacillus cereus Rock3-28]
          Length = 288

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSIVILLILLFQIFEKGLSYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEQYAKESIFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP+A P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYQIVLPVAFPGIITGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 VSRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 271 LGLLLFINIFVLWLRNR 287



 Score = 40.4 bits (93), Expect = 0.48,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R+  + +++F   +A+L   V L++LL  I  KG+ 
Sbjct: 3  MLNHKKIQENMASRFFKDRIYKFLFYIAILFSIVILLILLFQIFEKGLS 51


>gi|153808290|ref|ZP_01960958.1| hypothetical protein BACCAC_02578 [Bacteroides caccae ATCC 43185]
 gi|149129193|gb|EDM20409.1| hypothetical protein BACCAC_02578 [Bacteroides caccae ATCC 43185]
          Length = 291

 Score =  167 bits (424), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 136/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWEFITSAPTDGMRGGGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P G+ D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 225 PQLPTGILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIVIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|119485720|ref|ZP_01619995.1| phosphate ABC transporter, permease protein [Lyngbya sp. PCC 8106]
 gi|119457045|gb|EAW38172.1| phosphate ABC transporter, permease protein [Lyngbya sp. PCC 8106]
          Length = 307

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 93/257 (36%), Positives = 144/257 (56%), Gaps = 16/257 (6%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
                FF +  S +PE AGI  A VG+  +ML+   +S PLG+AS IYLEE+S K + + 
Sbjct: 52  RITPDFFFSFPSRKPEQAGILSAWVGTTLVMLVTAIISVPLGVASGIYLEEYSRKNWIAD 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ NI NLA VPSIVYG+L   + +    +   + L  GL LAL+ LP +I+ T  ALR
Sbjct: 112 LIEINITNLAGVPSIVYGLLALGLFVYILNL-GESVLAAGLTLALLILPIVIVTTREALR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P+S+R AA  LGASK Q ++ H+LP +  +ILTG  + L+RA+G+TAP++ +G + F+
Sbjct: 171 AIPNSLREAAYALGASKWQMIWDHILPYSAGSILTGVIIGLSRAIGQTAPVITIGALTFI 230

Query: 364 TDYPVGVTD-------------IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVI 410
              P                    T  P+Q++ W +  E  F      A  +L++    +
Sbjct: 231 AFLPDAPFKGEFPFISFAWLKAPFTVMPIQMFNWVSRPEAEFTVNAAAAGTVLIMMTLTM 290

Query: 411 NTAMLWLRNRFKK--RW 425
           N   ++LR +F++  +W
Sbjct: 291 NALAVYLRYQFRRGIKW 307


>gi|330806794|ref|YP_004351256.1| phosphate ABC transporter permease [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327374902|gb|AEA66252.1| Putative phosphate ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 556

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 74/263 (28%), Positives = 128/263 (48%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +G  +  ++
Sbjct: 288 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYARQGPMTRLIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                          L   L LAL+ 
Sbjct: 348 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSVDRLFFPEALPAPTFGTPGLLWASLTLALLA 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      P+        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPSLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +W+RN  +++
Sbjct: 528 LLVLVIATLNLSAVWIRNHLREK 550


>gi|149195680|ref|ZP_01872737.1| Phosphate transport system permease protein 2 [Lentisphaera
           araneosa HTCC2155]
 gi|149141142|gb|EDM29538.1| Phosphate transport system permease protein 2 [Lentisphaera
           araneosa HTCC2155]
          Length = 551

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 82/299 (27%), Positives = 125/299 (41%), Gaps = 32/299 (10%)

Query: 154 YLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYM 213
            +     +      Q     +L        +    +            GI  A++G+L M
Sbjct: 251 EMPIGEVIRYNFPNQLGTMSRLSLFFENVYE----YVTAYPREANTEGGIFPAIIGTLVM 306

Query: 214 MLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK 273
            +++       G+ +AIYL E++     +  V+  INNLA VPSIV+G  G    I F  
Sbjct: 307 TIVMCIPVTFFGVITAIYLHEYAKDSLVTRAVRIAINNLAGVPSIVFGAFGLGFFIYFIG 366

Query: 274 -------------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAAL 314
                                    L   L LALMTLP +I++T  AL +VP  +R  A+
Sbjct: 367 SNIDDFFFKDWKLATGEPIFGTGGLLWASLTLALMTLPVVIVSTEEALSSVPHGLREGAM 426

Query: 315 GLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI- 373
           G GA+K Q+++  +LP A P I+TG  +++AR  GE APL+ VG+V      PV  T   
Sbjct: 427 GCGATKWQSIWTVILPSATPGIITGMILAMARGAGEVAPLMLVGVVKLAPSLPVNATYPF 486

Query: 374 ------ATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                        IY     +          +   L L++ +  +N A + +R R KKR
Sbjct: 487 VHIDQKFMHLGFHIYDLGFQSPDSEAAKPMVYATTLFLILTVTGLNLAGIIIRQRLKKR 545


>gi|254228688|ref|ZP_04922112.1| ABC-type phosphate transport system, auxiliary component [Vibrio
           sp. Ex25]
 gi|262395148|ref|YP_003287002.1| phosphate transport system permease PstA [Vibrio sp. Ex25]
 gi|151938867|gb|EDN57701.1| ABC-type phosphate transport system, auxiliary component [Vibrio
           sp. Ex25]
 gi|262338742|gb|ACY52537.1| phosphate transport system permease protein PstA [Vibrio sp. Ex25]
          Length = 557

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 82/364 (22%), Positives = 148/364 (40%), Gaps = 45/364 (12%)

Query: 86  NLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASA 145
           N ++ ++  ++                +     R  L    +    + G  V +      
Sbjct: 207 NDMLTESFLKENQTKKERIEKALATLDLQLDGLRLQLSGYALIVEDMTGSQVSI--PLED 264

Query: 146 NIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV 205
            +D      +  P       D    W +++           + F            G+  
Sbjct: 265 ILDYWYPNQMSLP-------DKVMHWGKQV-----------WKFLSEDPRESNSEGGVFP 306

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A+ G+++++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVYG+ G 
Sbjct: 307 AIFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVYGVFGL 366

Query: 266 AVLINFFK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSI 309
              +                          L   L LA++TLP +I+ T   L  +PSS+
Sbjct: 367 GFFVYTIGASIDNVFYAEKLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTRIPSSV 426

Query: 310 RSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG 369
           R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +  PV 
Sbjct: 427 RHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLASSLPVD 486

Query: 370 -------VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
                  +          IY   +            +    LL+  +  +N   + +RN 
Sbjct: 487 GQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSFLLVTVIVGLNLTAISIRNN 546

Query: 421 FKKR 424
            +++
Sbjct: 547 LREK 550


>gi|260892359|ref|YP_003238456.1| phosphate ABC transporter, inner membrane subunit PstA [Ammonifex
           degensii KC4]
 gi|260864500|gb|ACX51606.1| phosphate ABC transporter, inner membrane subunit PstA [Ammonifex
           degensii KC4]
          Length = 294

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 75/251 (29%), Positives = 123/251 (49%), Gaps = 13/251 (5%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           F   ++ F  +   +     GIG  +  S Y++ + + +  PLG+ + IYL E++ +   
Sbjct: 37  FKVIDWKFLTSEPETIKAGGGIGPNIFNSFYLLFLSLIIVVPLGVLAGIYLSEYAKENAL 96

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ +I  LAS+PSIV G+ G  + +    +   + L G L L ++ LP ++  T  A
Sbjct: 97  TRSIRLSIETLASLPSIVVGLFGLLLFVTALGLGY-SLLAGALALTIINLPLMVRITEEA 155

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LRTVP  +R A+L LGA+K QT++  VLP A+P +LTG  ++  R LGE A L+F   + 
Sbjct: 156 LRTVPQDLREASLSLGATKWQTIYKVVLPTALPGLLTGIILASGRILGEAAALIFTAGLT 215

Query: 362 -----------FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF-GAILLLLIFLAV 409
                           P           V I+   ++A  P V R   G+  +L+I + +
Sbjct: 216 TPRLNFSQWDITSPTCPWNPLRPGETLAVHIWKVNSEAIIPDVRRVADGSSAVLVIIVLL 275

Query: 410 INTAMLWLRNR 420
            N    WL  R
Sbjct: 276 FNFLARWLARR 286


>gi|229593410|ref|YP_002875529.1| putative phosphate ABC transporter membrane protein [Pseudomonas
           fluorescens SBW25]
 gi|229365276|emb|CAY53607.1| putative phosphate ABC transport system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 556

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 127/263 (48%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +   +  ++
Sbjct: 288 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYAKQNTLTRIIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                          L   L LAL+ 
Sbjct: 348 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSVDRLFFAEALPAPTFGTPGLLWASLTLALLA 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      P+        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPSLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +W+RN  +++
Sbjct: 528 LLVLVIATLNLSAVWIRNHLREK 550


>gi|332968102|gb|EGK07189.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Desmospora sp. 8437]
          Length = 294

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 118/254 (46%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F     SS     GI   +  S Y++L+ + ++ PLG+   IY+ E++    ++
Sbjct: 38  QVIDWSFLTTPPSSVMAGGGIAPQLFNSFYLLLLTLLITVPLGLGGGIYMAEYAKPNQWT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ +I  L+S+PSIV G+ G  + + +      +   G L L +  LP ++     A+
Sbjct: 98  RFIRLSIEVLSSLPSIVVGLFGLLIFVQYTGW-GFSLAAGALALTVFNLPLMVRVVEQAI 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
            +VP   + A+L LG +  QT+   +LP A+P ILTG+ ++  R  GE A L+F   ++ 
Sbjct: 157 TSVPPEQKEASLALGVTHWQTITQVILPAALPGILTGTILAAGRVFGEAAALMFTAGMSS 216

Query: 363 -----------VTDYPVGVTDIATAFPVQIYLWAADA-ERPFVERTFGAILLLLIFLAVI 410
                          P+     A+   V I+   ++       E   GA  +L+I + + 
Sbjct: 217 PPLDFSNWDPTSPASPLNPFRPASTLAVHIWKINSEGIIPDAREVAAGASAVLVIAVLLF 276

Query: 411 NTAMLWLRNRFKKR 424
           N +  WL     ++
Sbjct: 277 NLSARWLGRWIHRK 290


>gi|228923021|ref|ZP_04086314.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836654|gb|EEM82002.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 288

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 145/257 (56%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSIVILFLLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   +  N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEQYAKESLFKKIIVINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPKEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 271 LGLLLFINIFVLWLRNR 287



 Score = 40.1 bits (92), Expect = 0.74,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L LLL  IV KGI 
Sbjct: 3  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSIVILFLLLFQIVEKGIS 51


>gi|126180217|ref|YP_001048182.1| phosphate ABC transporter, inner membrane subunit PstC
           [Methanoculleus marisnigri JR1]
 gi|125863011|gb|ABN58200.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanoculleus marisnigri JR1]
          Length = 646

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 77/240 (32%), Positives = 130/240 (54%), Gaps = 2/240 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F            GI  A+VG+ Y++   + ++ PLGIA+A+YL E++ +   + 
Sbjct: 405 AISWEFLTGSPRDLGRAGGIFPAIVGTFYLVGGALAVALPLGIATAVYLIEYTAETPLTR 464

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++A ++ L   PSIV+G+ G A L+ F      + + G + L LM LP+II  T  ALR
Sbjct: 465 SIRAAVDLLNGTPSIVFGLFGFAFLVLFMGFGV-SLIAGQITLGLMILPTIIRTTEEALR 523

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           ++P S+R  +  LGA+K QT+   VLP A+P ILTG+ +S+ RA GETAP++F   +   
Sbjct: 524 SIPGSLREGSYALGATKWQTISRVVLPPALPGILTGAILSIGRAAGETAPIMFTAAIFSS 583

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
              P  +T+   A P  +++          +  +G   +LL+ +  I  A + +R R+ +
Sbjct: 584 RFLPSSLTEPVMALPYHLFVLTTTIPGAATQS-YGTAFVLLLLVLTIYLAAILVRRRYHR 642



 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/265 (24%), Positives = 111/265 (41%), Gaps = 12/265 (4%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASS---RPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
              F   D    +     + F      +        G+   +VG++ +  + + ++ PL 
Sbjct: 58  IIVFLLRDGYQIVLETGVWDFLTGPDWNPAGHDPAYGVFPLIVGTVLVTALAMVIAGPLS 117

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVL-----INFFKMPRSTAL 280
           I +AIY+ E +        ++  +  LA +PS+VYG  G  +L     I F +   S+ L
Sbjct: 118 ICTAIYIAEIAGPRT-REVIKPAVELLAGIPSVVYGFFGLILLTDWIRIAFDQPSGSSWL 176

Query: 281 VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGS 340
            G ++LA+M +P+I      A+ +VP   R  +L LGA+  QT+   V+P A+  I    
Sbjct: 177 AGSILLAIMAIPTITSVAEDAVSSVPREFREGSLALGATHWQTIRRVVVPGALSGISAAI 236

Query: 341 TVSLARALGETAPLLFVGMVAFVTDYP-VGVTDIATAFPVQIYLWAADAERP--FVERTF 397
            + + RA+GET  +L +   A V   P   V          + +   +           F
Sbjct: 237 ILGMGRAIGETMAVLMITGNAAVIPDPIYDVFSPVRTLTGTLGIEMGEVAFGSTHYHALF 296

Query: 398 GAILLLLIFLAVINTAMLWLRNRFK 422
           G   +LL     IN+A   +  R +
Sbjct: 297 GVAAVLLFITLAINSAARVIITRIQ 321


>gi|77461834|ref|YP_351341.1| phosphate ABC transporter permease [Pseudomonas fluorescens Pf0-1]
 gi|77385837|gb|ABA77350.1| phosphate ABC transport system, membrane protein [Pseudomonas
           fluorescens Pf0-1]
          Length = 556

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 127/263 (48%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +   +  ++
Sbjct: 288 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYAKQNTLTRVIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                          L   L LAL+ 
Sbjct: 348 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSLDRLFFPEALPAPTFGTPGLLWASLTLALLA 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 408 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      PV        +          IY     +          +   L
Sbjct: 468 VAPLMLVGVVKLAPSLPVDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +++RN  +++
Sbjct: 528 LLVLVIATLNLSAVYIRNHLREK 550


>gi|312887131|ref|ZP_07746735.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
 gi|311300443|gb|EFQ77508.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Mucilaginibacter paludis DSM 18603]
          Length = 281

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 137/246 (55%), Gaps = 3/246 (1%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
            D         ++ F     +      GI  A++G++ + LI   ++ P GI  AIYL E
Sbjct: 30  WDLISKGSSSLSWAFISTSPTDGMTKGGILPAIIGTVLLTLITALIAAPFGICCAIYLNE 89

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++   + +  ++A+I NLA VPSI+YG+ G A+ +   +M  ++ L  GL L L++LP I
Sbjct: 90  YATDSWLTRIIRASIRNLAGVPSIIYGLFGLALFVQGLQM-GTSLLAAGLTLGLLSLPYI 148

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           II T  ALR VP+S+R AAL +GA++ +++   VLP A+P +LTG  ++L+RA GETAP+
Sbjct: 149 IITTEEALRRVPNSMREAALAVGATQFESIRDVVLPSAVPGMLTGLVLTLSRAAGETAPI 208

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFV--ERTFGAILLLLIFLAVINT 412
           LF G+  ++      +     A P  +Y+ +   +         +G  L+L+I +  +N 
Sbjct: 209 LFTGVAFYINKPAGYLNQEFMALPYHLYMLSTQHQAIEQVRPLAYGTALVLIIVVFFLNL 268

Query: 413 AMLWLR 418
           +  ++R
Sbjct: 269 SAFYIR 274


>gi|303258015|ref|ZP_07344024.1| phosphate ABC transporter, permease protein PstA [Burkholderiales
           bacterium 1_1_47]
 gi|330999430|ref|ZP_08323144.1| phosphate ABC transporter, permease protein PstA [Parasutterella
           excrementihominis YIT 11859]
 gi|302859358|gb|EFL82440.1| phosphate ABC transporter, permease protein PstA [Burkholderiales
           bacterium 1_1_47]
 gi|329574856|gb|EGG56415.1| phosphate ABC transporter, permease protein PstA [Parasutterella
           excrementihominis YIT 11859]
          Length = 290

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 124/239 (51%), Gaps = 3/239 (1%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F         E  GI   ++G+  + +  + ++ PLGIA A++L E++ +G     +  
Sbjct: 51  SFLSTFPEKMMEEGGILPCIIGTAILSIGAMAVALPLGIACAVWLNEYAKEGPLKKLITL 110

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            + NLA VPSIV+G+ G A  +    +   +A+ G L LA++TLP +I      L  +P+
Sbjct: 111 AVANLAGVPSIVFGLFGLAFFVTVCGLGV-SAIAGILTLAVLTLPIVINTVRETLSQIPN 169

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           S R ++L LGASK QTV   VLP A+P ILTG+ + LARA GET+ ++F   V   T+ P
Sbjct: 170 SWRESSLALGASKTQTVLRTVLPAALPGILTGAILGLARAAGETSAIMFTAAVVSTTNLP 229

Query: 368 VGVTDIATAFPVQIYLWAADAERPF--VERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                   + P  IY+ A     P   V       L+LL+ +  +N    ++R +  KR
Sbjct: 230 NSPFAAVMSLPYHIYVLATTGMNPDKAVPIQCATALVLLMTVFALNLMAFYIRQKSSKR 288


>gi|309790670|ref|ZP_07685221.1| phosphate ABC transporter, inner membrane subunit PstA
           [Oscillochloris trichoides DG6]
 gi|308227264|gb|EFO80941.1| phosphate ABC transporter, inner membrane subunit PstA
           [Oscillochloris trichoides DG6]
          Length = 440

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 102/284 (35%), Positives = 160/284 (56%), Gaps = 32/284 (11%)

Query: 173 QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYL 232
           +   ++ +     +  F  +  SSRPE+AG+  AV+GSL+++LI +  +FPLGI +A+YL
Sbjct: 154 EHPRAELSFKSWLSSDFLTSPMSSRPELAGVRTAVMGSLWLLLITVLFAFPLGIGAALYL 213

Query: 233 EEFSHKGFF-----------------SSFVQANINNLASVPSIVYGILGSAVLINFFKMP 275
           EE++    F                 SS +Q NI NL+ VPSI+YG+LG A+ +   +  
Sbjct: 214 EEYATDKLFDERSPVGRRLNAILHRGSSIIQTNIYNLSGVPSIIYGMLGLAIFVRALESF 273

Query: 276 RSTAL---------------VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
            S +                  G+ +AL+ LP +II++  A+R VP+S+R A+ GLGA++
Sbjct: 274 TSGSFLGATTDATANGRTIMAAGMTMALLVLPVVIISSQEAIRAVPNSLRQASYGLGATR 333

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQ 380
            QT++  VLP A+P ILTG+ ++++RA+GETAPL+ VG   F+   P G     T  P+Q
Sbjct: 334 WQTIWKVVLPNALPGILTGTILAISRAIGETAPLIVVGASTFIVTDPSGPFSKFTVLPIQ 393

Query: 381 IYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY W +  +  F      AI++LLI L  +N   + LRN  + +
Sbjct: 394 IYNWTSRPQVEFRAIAAAAIIVLLIILLSMNALAIILRNYLRSK 437


>gi|126660070|ref|ZP_01731191.1| Phosphate permease component of ATP-dependent phosphate uptake
           system [Cyanothece sp. CCY0110]
 gi|126618667|gb|EAZ89415.1| Phosphate permease component of ATP-dependent phosphate uptake
           system [Cyanothece sp. CCY0110]
          Length = 317

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 92/271 (33%), Positives = 149/271 (54%), Gaps = 29/271 (10%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 FF++  S + E AGI  A VG+  +ML+    + P+GIAS IYLEE++ K + S
Sbjct: 48  PRLTPQFFVSFPSRKAEQAGILSAWVGTSLIMLVTACAAVPIGIASGIYLEEYARKNWLS 107

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           + ++ N+ NLA VPSIVYG+L   + +  F++ + + L  GL LAL+ LP +I+ T  A+
Sbjct: 108 AIIEINVTNLAGVPSIVYGLLALGLFVYQFQLGQ-SVLTAGLTLALLILPVVIVTTREAI 166

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P S+R A+  +GA+K QT++ H+LP ++ +ILTG  + LARA+GETAP++ +G + F
Sbjct: 167 RAIPISLREASYAVGATKWQTIWDHILPYSLGSILTGIIIGLARAIGETAPVITIGALTF 226

Query: 363 VTDYPVGVTD--------------------------IATAFPVQIYLWAADAERPFVERT 396
           +   P    +                            T  P+Q++ W +  E+ F    
Sbjct: 227 IAFLPESPFNNEFPFFPLEMTFPFFNFQQFFAWLNAPFTVLPIQMFTWVSRPEQDFQVNA 286

Query: 397 FGAILLLLIFLAVINTAMLWLRNRFKK--RW 425
             A  +LL+    IN   ++LR R ++  +W
Sbjct: 287 AAAGTVLLMMTLGINGIAIYLRYRLRQGIKW 317


>gi|145298516|ref|YP_001141357.1| ABC-type phosphate transporter, permease component [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142851288|gb|ABO89609.1| ABC-type phosphate transporter, permease component [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 549

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 83/380 (21%), Positives = 152/380 (40%), Gaps = 29/380 (7%)

Query: 72  KRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPS 131
               + A  L+  Y   +   L R            +   Q+ +  A    R+ L     
Sbjct: 166 NDLSEQADDLQKGYIGSINYQLERLRLKERKAELDDKLTDQLKAQLAEE--RQALNDRYQ 223

Query: 132 LIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFN--YGF 189
           ++ K +      +      +K        +         W   +     +   F+    F
Sbjct: 224 VLEKDLFSLRAQADRDSITVKDMRGELVTMPMSKVLDVVWPNDMSLPAKVGHWFHQIGKF 283

Query: 190 FINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANI 249
             +         G+  A+ G+++M+ ++  +  PLG+ +A+YL E++ K   +  ++  +
Sbjct: 284 VSDDPREANTEGGVFPAIFGTVFMVFLMAIIVTPLGVVAAVYLHEYAGKNSLTKIIRIAV 343

Query: 250 NNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTLPS 293
            NLA VPSIVYG+ G    +                          +   L LA++TLP 
Sbjct: 344 INLAGVPSIVYGVFGLGFFVYTLGGSLDQLFYPEALPSPTFGSPGVIWSALTLAILTLPV 403

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +I++T   L  +PS+IR  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE AP
Sbjct: 404 VIVSTEEGLARIPSTIRQGSLALGATQAETLWRIVLPMASPAIMTGLILAIARAAGEVAP 463

Query: 354 LLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFVERTFGAILLLL 404
           L+ VG+V      P+                   IY     +          +    LL+
Sbjct: 464 LMLVGVVKLAPTLPMDGNFPYLHVERKFMHLGFHIYDVGFQSPNVEAARPLVYATSFLLV 523

Query: 405 IFLAVINTAMLWLRNRFKKR 424
             +  +N   + +RN  +++
Sbjct: 524 TVIVGLNLTAIGIRNHLREK 543


>gi|225386877|ref|ZP_03756641.1| hypothetical protein CLOSTASPAR_00625 [Clostridium asparagiforme
           DSM 15981]
 gi|225046889|gb|EEG57135.1| hypothetical protein CLOSTASPAR_00625 [Clostridium asparagiforme
           DSM 15981]
          Length = 301

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 124/241 (51%), Gaps = 6/241 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
            + ++ F     S+     GI   +V +LY+++I + ++ P+GI +AIYL E++  G   
Sbjct: 59  PNISWRFLTTVTSATKGTFGILGNIVNTLYIVVITLLIATPIGIGAAIYLNEYARPGRLV 118

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     L+ +PSI++G+ G     N   +   + L G L L LM LP I   T  AL
Sbjct: 119 KAIEFTTETLSGIPSIIFGLFGMVFFGNTLGLKY-SILTGALTLTLMILPLITRTTQEAL 177

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S RS ALG+GA+K   +   +LP AMP ILTG  +++ R +GE+A LLF     +
Sbjct: 178 KTVPDSYRSGALGIGATKWYMIRTILLPSAMPGILTGVILAIGRIVGESAALLFTAGSGY 237

Query: 363 VT--DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
               ++   V +      +Q+YL+     +      FG  ++LL  +  IN    +L  +
Sbjct: 238 YMPKNWLGKVMEPGGTLTIQLYLFMQ---KAKYNEAFGVAVVLLAIVLAINGLARYLSRK 294

Query: 421 F 421
           F
Sbjct: 295 F 295


>gi|197334565|ref|YP_002156815.1| phosphate transport system permease protein PstA [Vibrio fischeri
           MJ11]
 gi|197316055|gb|ACH65502.1| phosphate transport system permease protein PstA [Vibrio fischeri
           MJ11]
          Length = 485

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 82/342 (23%), Positives = 144/342 (42%), Gaps = 37/342 (10%)

Query: 120 YHLRKTLMTDPSLIGKTVEVSLLASANIDSALK--GYLYSPANVHRMSDYQWKW-----F 172
           Y L   L +      + +      +  +D+  K   + Y      + S YQ         
Sbjct: 138 YRLLDALPSSALSKNEIITQEKALNNEVDAISKQLSHSYLVLEDSQGSRYQLSSDNVLDI 197

Query: 173 QKLDSDGALFLDFNY-----GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIA 227
              ++       +++      F            G+  A+ G++ ++L++  +  PLG+ 
Sbjct: 198 WFPNAMTIKEKVYHWLESVYEFVSEPPREANSEGGVFPAIFGTILLVLLMSVIVMPLGVI 257

Query: 228 SAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK-------------- 273
           +AIYL E++     +  ++  + NLA VPSIVYG+ G    +                  
Sbjct: 258 AAIYLHEYAKPNVLTRLIRIAVINLAGVPSIVYGVFGLGFFVYVVGGTLDQLFYSNELPT 317

Query: 274 --MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPL 331
                   L   L LA++TLP +I+AT   L  +P+S+R  +L LGA++ +T++  VLP+
Sbjct: 318 PTFGTPGLLWSALTLAILTLPVVIVATEEGLSRIPNSVRHGSLALGATQFETLWKIVLPM 377

Query: 332 AMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLW 384
           A PAI+TG  +++ARA GE APL+ VG+V      PV                   IY  
Sbjct: 378 ASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPSLPVDSVAPYLHLDRKFMHLGYHIYDV 437

Query: 385 AADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              +          +    LL+  +  +N A + +RN  +++
Sbjct: 438 GFQSPNVEAARPIVYATAFLLVTVIIGLNLAAIAIRNNLREK 479


>gi|70733400|ref|YP_263175.1| phosphate ABC transporter permease [Pseudomonas fluorescens Pf-5]
 gi|68347699|gb|AAY95305.1| phosphate ABC transporter, permease protein [Pseudomonas
           fluorescens Pf-5]
          Length = 533

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 127/263 (48%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M LI+  +  P G+ +A+YL E++ +   +  ++
Sbjct: 265 WEFLSDDPREANTEGGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYAKQNTLTRVIR 324

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VP+IVYG+ G    +                          L   L LAL+ 
Sbjct: 325 IAVNNLAGVPAIVYGVFGLGFFVYVLGGSVDRLFFPEALPAPTFGTPGLLWASLTLALLA 384

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 385 VPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGE 444

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      P+        +          IY     +          +   L
Sbjct: 445 VAPLMLVGVVKLAPSLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATAL 504

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL++ +A +N + +W+RN  +++
Sbjct: 505 LLVLVIATLNLSAVWIRNHLREK 527


>gi|229146855|ref|ZP_04275220.1| ABC transporter permease protein [Bacillus cereus BDRD-ST24]
 gi|228636683|gb|EEK93148.1| ABC transporter permease protein [Bacillus cereus BDRD-ST24]
          Length = 276

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 147/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 20  LFSIVILFLLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 79

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 80  FGVGTALYLEQYAKESIFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 138

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 139 LTMSLLVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 198

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AFV   P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 199 ISRAIGEAAPLLVIGALAFVNYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 258

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 259 LGLLLFINIFVLWLRNR 275


>gi|149910867|ref|ZP_01899500.1| putative phosphate transport system permease protein [Moritella sp.
           PE36]
 gi|149806108|gb|EDM66089.1| putative phosphate transport system permease protein [Moritella sp.
           PE36]
          Length = 535

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 83/395 (21%), Positives = 162/395 (41%), Gaps = 35/395 (8%)

Query: 57  SLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLST 116
            L +     +    K + +    +   +Y L   +   R   + D   + +    Q ++ 
Sbjct: 143 QLDVLIERAVELNDKSQGLQKGEISSVNYELERIRLKLRSYELKDELTSEIETKYQKIAD 202

Query: 117 TARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLD 176
           T R   +       S   +    +++        ++G        + +   +  +   + 
Sbjct: 203 TLRAKYQIYEAQLFSYRDQANRDAVIVRD-----MRGVEVRIPLSNVL---EVTYPNDMG 254

Query: 177 SDGALFLDFNY--GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
               +   F     F  +         G+  A+ G+++M++++  +  PLG+ +AIYL E
Sbjct: 255 IVSKITHWFGNIGSFISSDPREANTEGGVFPAIFGTIFMVMLMAVIVTPLGVVAAIYLHE 314

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----------------MPRST 278
           ++ K   +  ++  + NLA VPSIVYG+ G    +                         
Sbjct: 315 YAPKNGLTKMIRIAVINLAGVPSIVYGVFGLGFFVYMLGGSIDDLFYPESSPSPVFGSPG 374

Query: 279 ALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILT 338
            L   L LA++TLP +I++T   L  +P+S+R  +L LGA+K +T++  ++P+A PAI+T
Sbjct: 375 VLWSALTLAILTLPVVIVSTEEGLSRIPTSLRQGSLALGATKFETLWRIIIPMASPAIMT 434

Query: 339 GSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE-- 389
           G  +++ARA GE APL+ VG+V      PV +                 IY     +   
Sbjct: 435 GLILAVARAAGEVAPLMLVGVVKLAPTLPVDMNFPYIHVERKFMHLGFHIYDVGFQSPNV 494

Query: 390 RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                  +    LL+  +  +N   + +RN  +++
Sbjct: 495 EAARPLVYATSFLLVTVIIGLNLTAIAVRNHLREK 529


>gi|229192479|ref|ZP_04319442.1| ABC transporter permease protein [Bacillus cereus ATCC 10876]
 gi|228591056|gb|EEK48912.1| ABC transporter permease protein [Bacillus cereus ATCC 10876]
          Length = 286

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 88/252 (34%), Positives = 145/252 (57%), Gaps = 1/252 (0%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
             +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +
Sbjct: 35  ILFLLLFQIVEKGISYLSINFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGT 94

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   L ++L
Sbjct: 95  ALYLEQYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAALTMSL 153

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T+++++A+
Sbjct: 154 LVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISKAI 213

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++LL  L 
Sbjct: 214 GEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLL 273

Query: 409 VINTAMLWLRNR 420
            IN  +LWLRNR
Sbjct: 274 FINIFVLWLRNR 285



 Score = 40.1 bits (92), Expect = 0.75,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L LLL  IV KGI 
Sbjct: 1  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSMVILFLLLFQIVEKGIS 49


>gi|229071772|ref|ZP_04204987.1| ABC transporter permease protein [Bacillus cereus F65185]
 gi|228711367|gb|EEL63327.1| ABC transporter permease protein [Bacillus cereus F65185]
          Length = 286

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 88/257 (34%), Positives = 145/257 (56%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILFLLLFQIVEKGISYLSINFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEQYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A   I+TG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFSGIITGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 269 LGLLLFINIFVLWLRNR 285



 Score = 40.1 bits (92), Expect = 0.74,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    +KN+  R++ + +++    +A+L   V L LLL  IV KGI 
Sbjct: 1  MLNHKKIQKNMASRFLKDRIYKLLFYIAILFSIVILFLLLFQIVEKGIS 49


>gi|330830277|ref|YP_004393229.1| phosphate ABC transporter permease [Aeromonas veronii B565]
 gi|328805413|gb|AEB50612.1| ABC-type phosphate transporter, permease component [Aeromonas
           veronii B565]
          Length = 549

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 76/351 (21%), Positives = 139/351 (39%), Gaps = 30/351 (8%)

Query: 104 HALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDS---ALKGYLYSPAN 160
                +    L+   +  L               +      +  D     +K        
Sbjct: 193 KERKAELDDKLTDQLKAELASERQALNDRYQVLEKELFSLRSQADRDAITVKDMRGELVT 252

Query: 161 VHRMSDYQWKWFQKLDSDGALFLDFN--YGFFINGASSRPEVAGIGVAVVGSLYMMLIVI 218
           +         W   +     +   F+    F  +         G+  A+ G+++M+ ++ 
Sbjct: 253 MPMSKVLDVVWPNDMSLLAKVGHWFHQIGKFVSDDPREANTEGGVFPAIFGTVFMVFLMA 312

Query: 219 GLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----- 273
            +  PLG+ +A+YL E++ K   +  ++  + NLA VPSIVYG+ G    +         
Sbjct: 313 IIVTPLGVVAAVYLHEYAGKNSLTKIIRIAVINLAGVPSIVYGVFGLGFFVYTLGGSLDQ 372

Query: 274 -----------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQ 322
                            +   L LA++TLP +I++T   L  +PS+IR  +L LGA++ +
Sbjct: 373 LFYPEALPSPTFGSPGVIWSALTLAILTLPVVIVSTEEGLARIPSTIRQGSLALGATQAE 432

Query: 323 TVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------AT 375
           T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V      P+              
Sbjct: 433 TLWRIVLPMASPAIMTGLILAIARAAGEVAPLMLVGVVKLAPTLPMDGNFPYLHVERKFM 492

Query: 376 AFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                IY     +          +    LL+  +  +N   + +RN  +++
Sbjct: 493 HLGFHIYDVGFQSPNVEAARPLVYATSFLLVTVIVGLNLTAIGIRNHLREK 543


>gi|317049112|ref|YP_004116760.1| phosphate ABC transporter inner membrane subunit PstA [Pantoea sp.
           At-9b]
 gi|316950729|gb|ADU70204.1| phosphate ABC transporter, inner membrane subunit PstA [Pantoea sp.
           At-9b]
          Length = 532

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 134/263 (50%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  N  ++    +G   A+ G++ M+L++  +  PLG+ +A++L E++ +   +  V+
Sbjct: 264 WQFVSNNPAAGESESGALPAIFGTVLMVLLMSVIVMPLGVVAALWLHEYAGRNALTRLVR 323

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             + NLA VPSIVYG+ G    +                          L   L LAL+T
Sbjct: 324 IAVVNLAGVPSIVYGVFGLGFFVWLIGGTIDQLFYSRALPNPTFGTPGLLWASLTLALLT 383

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+AT   L  +P S+R  +L LGA++ +T++  VLPLA+PA+LTG  +++ARA GE
Sbjct: 384 LPVVIVATEEGLSRIPDSLRQGSLALGATQAETLWRVVLPLAVPAMLTGLILAVARAAGE 443

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
           TAPL+ VG+V  V + PV        +         QIY  A  +          +   L
Sbjct: 444 TAPLMLVGVVKMVPELPVDAVFPYLHLDRKFMHLGFQIYDLAFQSPNIDADRPLVYATAL 503

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + LR+R ++R
Sbjct: 504 LLVAIILSLNLLAMALRHRLRER 526


>gi|297583766|ref|YP_003699546.1| phosphate ABC transporter inner membrane subunit PstA [Bacillus
           selenitireducens MLS10]
 gi|297142223|gb|ADH98980.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           selenitireducens MLS10]
          Length = 285

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 86/243 (35%), Positives = 140/243 (57%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F            GI  A+VG+ Y+  + + +S P+GI +AIYL E++ +G F  
Sbjct: 40  VISWSFITEPPRRNMTEGGIWPALVGTFYVASLTVLISVPVGIGAAIYLNEYARQGKFVR 99

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +I NLA VPSIVYG+ G A+  +F ++     +   + LA+M LP +I A+  AL+
Sbjct: 100 LIRLSIRNLAGVPSIVYGLFGLAIFASFLRIGV-GLITAAITLAIMVLPWVITASEEALK 158

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP+S R   L LGA+K QT+   VLP A+P ++TGS + LARA GETAP++  G   + 
Sbjct: 159 SVPASFREGGLALGATKWQTIRQLVLPSAVPGMMTGSILGLARAAGETAPIILTGAAYYS 218

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPF--VERTFGAILLLLIFLAVINTAMLWLRNRF 421
            + P  +TD   A P  +Y+ A    +        +G  L+L++ + ++N + + +RNRF
Sbjct: 219 RNLPTELTDSFMALPYHLYILATQHAQASAVRPIAYGTALVLIMLVILLNLSAILIRNRF 278

Query: 422 KKR 424
           + R
Sbjct: 279 RNR 281


>gi|153834642|ref|ZP_01987309.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio harveyi HY01]
 gi|148868954|gb|EDL68008.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio harveyi HY01]
          Length = 557

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 80/364 (21%), Positives = 140/364 (38%), Gaps = 45/364 (12%)

Query: 86  NLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASA 145
           N  + +      S   +          M     R       +    + G  V +      
Sbjct: 207 NDTITEEFLANNSQRKAEIEAELAKLDMQLDGLRLGFSDYALIVEDMTGTQVSI--PLED 264

Query: 146 NIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV 205
            +D      +  P                            + F            G+  
Sbjct: 265 ILDYWYPNQMSLPEK-----------VAHWGKQV-------WKFLSEDPRESNSEGGVFP 306

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A+ G++++++I+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVYG+ G 
Sbjct: 307 AIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVYGVFGL 366

Query: 266 AVLINFFK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSI 309
              +                          L   L LA++TLP +I+ T   L  +PSS+
Sbjct: 367 GFFVYTIGASIDNLFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTRIPSSV 426

Query: 310 RSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG 369
           R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +  PV 
Sbjct: 427 RHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLASSLPVD 486

Query: 370 -------VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
                  +          IY   +            +    LL+  +  +N   + +RN 
Sbjct: 487 GQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSFLLVTVIVGLNLTAISIRNN 546

Query: 421 FKKR 424
            +++
Sbjct: 547 LREK 550


>gi|253572871|ref|ZP_04850269.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251837503|gb|EES65596.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 291

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 135/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWDFITSAPTDGMTGGGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+++QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATRLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 225 PQLPTSILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIVIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|228960535|ref|ZP_04122184.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228799135|gb|EEM46103.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 276

 Score =  166 bits (421), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 146/257 (56%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +      +              +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 20  LFSIVILFLLLFQIVEKGISYLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 79

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 80  FGVGTALYLEQYAKESLFKKIIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAA 138

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPS +   + GLGA+K QT++  VLP A P I+TG T++
Sbjct: 139 LTMSLLVLPTVVVASQEAIRSVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLA 198

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 199 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 258

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L  IN  +LWLRNR
Sbjct: 259 LGLLLFINIFVLWLRNR 275


>gi|257058930|ref|YP_003136818.1| phosphate ABC transporter inner membrane subunit PstA [Cyanothece
           sp. PCC 8802]
 gi|256589096|gb|ACU99982.1| phosphate ABC transporter, inner membrane subunit PstA [Cyanothece
           sp. PCC 8802]
          Length = 311

 Score =  166 bits (420), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 96/258 (37%), Positives = 143/258 (55%), Gaps = 16/258 (6%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 FF++  S + E AGI  A VGS  +ML+ +  + PLG+AS IYLEE+S K + S
Sbjct: 55  PRITPNFFLSFPSRKAEEAGILSAWVGSGLIMLVTMIAAIPLGVASGIYLEEYSKKNWLS 114

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NI NLA VPSI+YG+L   + +  F + R + L  GL LAL+ LP II+ T  AL
Sbjct: 115 DIIEINITNLAGVPSIIYGLLALGLFVYQFNLGR-SMLSAGLTLALLILPVIIVTTREAL 173

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R++P S+R AA  +GASK Q V  H+LP ++ +ILTG  + ++RA+GETAPL+ +G + F
Sbjct: 174 RSIPRSLREAAYAVGASKWQVVSQHILPYSLGSILTGIIIGISRAIGETAPLITIGALTF 233

Query: 363 VTDYPVGV-------------TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                    T  P+Q++ W +     F      A  +L+     
Sbjct: 234 IAFLPDPPIKGEFPFISFAWLFTEYTVMPIQMFNWVSRPNAEFHINAAAAGTVLIAMTVF 293

Query: 410 INTAMLWLRNRFKK--RW 425
           +N   ++LR R +K  +W
Sbjct: 294 MNALAIYLRYRLRKGVKW 311


>gi|269962443|ref|ZP_06176793.1| phosphate ABC transporter, permease protein [Vibrio harveyi 1DA3]
 gi|269832939|gb|EEZ87048.1| phosphate ABC transporter, permease protein [Vibrio harveyi 1DA3]
          Length = 557

 Score =  166 bits (420), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 80/364 (21%), Positives = 140/364 (38%), Gaps = 45/364 (12%)

Query: 86  NLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASA 145
           N  + +      S   +          M     R       +    + G  V +      
Sbjct: 207 NDTITEDFLANNSKRKAEIEAELAKLDMQLDGLRLGFSDYALIVEDMTGTQVSI--PLED 264

Query: 146 NIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV 205
            +D      +  P                            + F            G+  
Sbjct: 265 ILDYWYPNQMSLPEK-----------VAHWGKQV-------WKFLSEDPRESNSEGGVFP 306

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A+ G++++++I+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVYG+ G 
Sbjct: 307 AIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVYGVFGL 366

Query: 266 AVLINFFK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSI 309
              +                          L   L LA++TLP +I+ T   L  +PSS+
Sbjct: 367 GFFVYTIGASIDNLFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTRIPSSV 426

Query: 310 RSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG 369
           R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +  PV 
Sbjct: 427 RHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLASSLPVD 486

Query: 370 -------VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
                  +          IY   +            +    LL+  +  +N   + +RN 
Sbjct: 487 GQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSFLLVTVIVGLNLTAISIRNN 546

Query: 421 FKKR 424
            +++
Sbjct: 547 LREK 550


>gi|298386615|ref|ZP_06996171.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           1_1_14]
 gi|298260992|gb|EFI03860.1| phosphate ABC transporter, permease protein PstA [Bacteroides sp.
           1_1_14]
          Length = 291

 Score =  166 bits (420), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 135/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +  +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  AISWEFITSAPTDGMTGGGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+++QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATRLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 225 PQLPTSILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIVIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +KR
Sbjct: 285 EKR 287


>gi|253997059|ref|YP_003049123.1| phosphate ABC transporter inner membrane subunit PstA
           [Methylotenera mobilis JLW8]
 gi|253983738|gb|ACT48596.1| phosphate ABC transporter, inner membrane subunit PstA
           [Methylotenera mobilis JLW8]
          Length = 315

 Score =  166 bits (419), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 81/253 (32%), Positives = 142/253 (56%), Gaps = 16/253 (6%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F+ +  S R   AG+  A+VGS  +ML+    + P+G+ +AIYLEE++ K +FS  ++ 
Sbjct: 64  SFYTDFPSRRASSAGLLSALVGSSLVMLVTFLSAVPVGVMAAIYLEEYAPKNWFSDLIEI 123

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
           N++NLA+VPSI+YG+L   + +    + +S    G L L L+ LP +I+AT  ++R++P 
Sbjct: 124 NVSNLAAVPSIIYGLLALGLFVYILDLGQSIVTAG-LTLGLLILPVVIVATRESIRSIPI 182

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           +IR AA  +GA+K Q V+ HV+  +   ILTG  + +ARA+GETAP++ +G + F+   P
Sbjct: 183 AIREAAYAVGATKWQVVYDHVIKYSFGGILTGVIIGMARAIGETAPIITIGALTFIAFLP 242

Query: 368 VGVT-------------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
                               T  P+Q++ W +     F      A +++++   ++N   
Sbjct: 243 PSPVTTTAPFLNFEWLSSGFTVLPIQMFSWLSRPSEAFHVNAAAAGVIIILVTLIMNGFA 302

Query: 415 LWLRNRFKK--RW 425
           + +R + +K  +W
Sbjct: 303 IRMRYKMRKNIKW 315


>gi|226310064|ref|YP_002769958.1| phosphate ABC transporter permease protein [Brevibacillus brevis
           NBRC 100599]
 gi|226093012|dbj|BAH41454.1| probable phosphate ABC transporter permease protein [Brevibacillus
           brevis NBRC 100599]
          Length = 296

 Score =  166 bits (419), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 74/254 (29%), Positives = 121/254 (47%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N  F  +         GIG  +  SLY++++ + ++ PLGI + IY+ E++     +
Sbjct: 38  HKLNLDFLTSPPDIVNAGGGIGPQLFNSLYLLVLTMLIALPLGIGAGIYMAEYAPDNKIT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            F++ +I  L+S+PSIV G+ G  V +N       T   G L L +  LP ++  T  AL
Sbjct: 98  QFIRMSIEVLSSLPSIVVGLFGLLVFVNMTGWGY-TLFGGALALTVFNLPLLVRVTEDAL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA- 361
           R VP S + A+L LG +K +T+   +LP A+P ILTG+ ++  R  GE A LLF   ++ 
Sbjct: 157 RNVPRSQKEASLALGITKWRTIVSVILPAALPGILTGAILASGRVFGEAAALLFTAGMSS 216

Query: 362 ----------FVTDYPVGVTDIATAFPVQIYLWAADA-ERPFVERTFGAILLLLIFLAVI 410
                       T  P+     A    V I+   ++       +   GA  +L+I + + 
Sbjct: 217 PNLDFTDFSMNSTTSPLNPFRPAETLAVHIWKVNSEGLTPDARDVADGAAAVLIIAVLLF 276

Query: 411 NTAMLWLRNRFKKR 424
           N +  W  N   K+
Sbjct: 277 NLSARWFGNWVYKK 290


>gi|228902784|ref|ZP_04066930.1| ABC transporter permease protein [Bacillus thuringiensis IBL 4222]
 gi|228856858|gb|EEN01372.1| ABC transporter permease protein [Bacillus thuringiensis IBL 4222]
          Length = 276

 Score =  166 bits (419), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 144/237 (60%), Gaps = 1/237 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  FF N AS  P+ AGI  A+ G++  M IVI +SF  G+ +A+YLE+++ +  F  
Sbjct: 40  YLSIDFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFIFGVGTALYLEQYAKESLFKK 99

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            V+ N   LA VPS+V+G+LG  + +    +   + +   L ++L+ LP++++A+  A+R
Sbjct: 100 IVEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIVAAALTMSLLVLPTVVVASQEAIR 158

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VPS +   + GLGA+K QT++  VLP A P I+TG T++++RA+GE APLL +G +AF 
Sbjct: 159 SVPSVLLEGSYGLGATKWQTMYQIVLPYAFPGIITGCTLAISRAIGEAAPLLVIGALAFA 218

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
              P  + D  T  P+QI+ W +  +  F       +++LL  L  IN  +LWLRNR
Sbjct: 219 NYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVLLGLLLFINIFVLWLRNR 275


>gi|156973345|ref|YP_001444252.1| hypothetical protein VIBHAR_01032 [Vibrio harveyi ATCC BAA-1116]
 gi|156524939|gb|ABU70025.1| hypothetical protein VIBHAR_01032 [Vibrio harveyi ATCC BAA-1116]
          Length = 557

 Score =  166 bits (419), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 80/364 (21%), Positives = 140/364 (38%), Gaps = 45/364 (12%)

Query: 86  NLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASA 145
           N  + +      S   +          M     R       +    + G  V +      
Sbjct: 207 NGTITEEFLANNSQRKAEIEAELAKLDMQLDGLRLGFSDYALIVEDMTGTQVSI--PLED 264

Query: 146 NIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGV 205
            +D      +  P                            + F            G+  
Sbjct: 265 ILDYWYPNQMSLPEK-----------VAHWGKQV-------WKFLSEDPRESNSEGGVFP 306

Query: 206 AVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGS 265
           A+ G++++++I+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVYG+ G 
Sbjct: 307 AIFGTVFLVIIMSIIVMPLGVVAAIYLHEYAKNNALTRVIRIAVINLAGVPSIVYGVFGL 366

Query: 266 AVLINFFK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSI 309
              +                          L   L LA++TLP +I+ T   L  +PSS+
Sbjct: 367 GFFVYTIGASIDNLFYAERLPAPTFGTPGLLWSALTLAVLTLPVVIVTTEEGLTRIPSSV 426

Query: 310 RSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG 369
           R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +  PV 
Sbjct: 427 RHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGEVAPLMLVGVVKLASSLPVD 486

Query: 370 -------VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
                  +          IY   +            +    LL+  +  +N   + +RN 
Sbjct: 487 GQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSFLLVTVIVGLNLTAISIRNN 546

Query: 421 FKKR 424
            +++
Sbjct: 547 LREK 550


>gi|23100589|ref|NP_694056.1| phosphate ABC transporter permease [Oceanobacillus iheyensis
           HTE831]
 gi|22778822|dbj|BAC15090.1| phosphate ABC transporter permease [Oceanobacillus iheyensis
           HTE831]
          Length = 296

 Score =  166 bits (419), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 104/244 (42%), Positives = 157/244 (64%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F     S+ PE AGI  A++G+ ++MLIVI ++  +G+ +AIYLE ++ KG F 
Sbjct: 53  TYINWDFLTGHLSTAPERAGIMGAILGTAWLMLIVIPVTMLIGVGTAIYLELYAKKGKFQ 112

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           SF+  NI+NLA VPSIVYG+LG  + +   +   +  L GGL L+L+ LP +I+A   A+
Sbjct: 113 SFIATNISNLAGVPSIVYGLLGLTLFVRTLEF-GNVILAGGLTLSLLVLPIVIVAAQEAI 171

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP  +  A+ G+GA+K QTV   VLP A+P ILTGS ++L+RA+GETAPL  +G+ A 
Sbjct: 172 RAVPGHLSEASYGMGATKWQTVKKIVLPAALPGILTGSILALSRAIGETAPLTVLGIPAL 231

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
           +  +P GV D  TA P+QIY W  D+     +       I++LL+ L ++N+  + +RN+
Sbjct: 232 LIPFPGGVFDTFTALPMQIYYWTLDSSLVAEYAYLAAATIIVLLVLLFLLNSIAIIIRNK 291

Query: 421 FKKR 424
           F++R
Sbjct: 292 FQQR 295


>gi|15615554|ref|NP_243858.1| phosphate ABC transporter (permease) [Bacillus halodurans C-125]
 gi|10175614|dbj|BAB06711.1| phosphate ABC transporter (permease) [Bacillus halodurans C-125]
          Length = 294

 Score =  166 bits (419), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 103/243 (42%), Positives = 159/243 (65%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             N  F     SS PE AGI  A++G+L++ML+V  ++  LG+ +AIYLE ++ KG   S
Sbjct: 52  WINLDFLTGRHSSDPEKAGIMGALLGTLWLMLVVTPVTMFLGVGTAIYLECYAKKGRLQS 111

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++ NI+NLA VPSIV+GILG  V +    +  S  L GGL ++L+ LP +++A+  A+R
Sbjct: 112 FIETNISNLAGVPSIVFGILGLTVFVRTMDL-GSVVLAGGLTMSLLVLPIVVVASQEAIR 170

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +PS +  A+ GLGA+K QT+ + +LP A+P ILTG+ +SL+RA+GETAPL+ +G+ A +
Sbjct: 171 AIPSHLSEASFGLGATKWQTIKNIILPAALPGILTGAILSLSRAIGETAPLIVLGIPALL 230

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
             +P G+ D  T  PVQIY W  D+     +       I++LL+ L ++N+  + +RN+F
Sbjct: 231 IPFPGGLMDRFTILPVQIYYWTIDSALVAEYANLAAATIIILLLVLFLLNSTAIIIRNKF 290

Query: 422 KKR 424
           +KR
Sbjct: 291 QKR 293


>gi|302872009|ref|YP_003840645.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574868|gb|ADL42659.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 280

 Score =  166 bits (419), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 127/241 (52%), Gaps = 5/241 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              +  F +       +  GI   +VG+LY+ L+ + ++ P+G+ +AIYL E++ KG   
Sbjct: 40  KGISLSFILQYPEEMGKSGGIFPVIVGTLYVTLLAVIIATPVGVLAAIYLTEYAKKGKVV 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     LA +PSI+YG+ G A  +      R + L G L L++M LP+II  +  A+
Sbjct: 100 ELIKFGTETLAGIPSIIYGLFGFAFFVIALGF-RWSILSGALTLSIMILPTIIRTSEEAI 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S R  +L LGA+K QT+   V+P AMP ILTG  + + RA+GETA +L     + 
Sbjct: 159 KTVPISFREGSLALGATKWQTIAKVVVPPAMPGILTGIILGVGRAIGETAAVLLTAGSSL 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             ++P  +        V +Y+    +E      ++    LL++ + VINT    +  R+ 
Sbjct: 219 --NFPTSIFSPTRTMSVHLYIL--SSEGLSKLNSYATATLLIVIVFVINTFANMIIRRYN 274

Query: 423 K 423
           +
Sbjct: 275 R 275


>gi|296133807|ref|YP_003641054.1| phosphate ABC transporter, inner membrane subunit PstA [Thermincola
           sp. JR]
 gi|296032385|gb|ADG83153.1| phosphate ABC transporter, inner membrane subunit PstA [Thermincola
           potens JR]
          Length = 292

 Score =  166 bits (419), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 118/254 (46%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  +  ++     GIG  +  S Y++++ + ++ P+G+ + IY+ E++  G   
Sbjct: 38  KVIDWHFLTSPPTNIAAGGGIGPQIFNSFYLLVLSMLITVPIGLLAGIYMAEYAKNGPLV 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++  I  LAS+PSIV G+ G  + +N       + L G   L+++ LP I+  T  ++
Sbjct: 98  KIIRTCIETLASLPSIVVGLFGLIIFVNMTGWGY-SILAGAFALSVINLPFIVRVTEESI 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
             V    +  +L LGA+K QT+   +LP A P ++TG  +S  R  GE A LL+   ++ 
Sbjct: 157 TGVQKEYKEGSLALGATKWQTIVKVLLPTAFPGLITGFVISAGRIFGEAAALLYTAGMSS 216

Query: 363 -----------VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF-GAILLLLIFLAVI 410
                          P           V I+   +++  P V     G+  +L+I + + 
Sbjct: 217 PNLNFSRWLPTYPTSPFNPFRPGETLAVHIWKVNSESLIPDVRAVADGSAAVLIIVVLLF 276

Query: 411 NTAMLWLRNRFKKR 424
           N    W+  R +KR
Sbjct: 277 NILARWIGRRMQKR 290


>gi|117619252|ref|YP_857317.1| transmembrane component of the phosphate specific transport complex
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560659|gb|ABK37607.1| transmembrane component of the phosphate specific transport complex
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 549

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 77/351 (21%), Positives = 139/351 (39%), Gaps = 30/351 (8%)

Query: 104 HALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDS---ALKGYLYSPAN 160
                +    L+   +  L               +      A  D     +K        
Sbjct: 193 KERKAELDDKLTDQLKAELASERQALNDRYQVLEKELFSLRAQADRDSITVKDMRGELVT 252

Query: 161 VHRMSDYQWKWFQKLDSDGALFLDFN--YGFFINGASSRPEVAGIGVAVVGSLYMMLIVI 218
           +         W   +     +   F+    F  +         G+  A+ G+++M+ ++ 
Sbjct: 253 MPMSKVLDVVWPNDMSLPAKVGYWFHQIGKFVSDDPREANTEGGVFPAIFGTVFMVFLMA 312

Query: 219 GLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----- 273
            +  PLG+ +A+YL E++ K   +  ++  + NLA VPSIVYG+ G    +         
Sbjct: 313 IIVTPLGVVAAVYLHEYAGKNSLTKIIRIAVINLAGVPSIVYGVFGLGFFVYTLGGSLDQ 372

Query: 274 -----------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQ 322
                            +   L LA++TLP +I++T   L  +PS+IR  +L LGA++ +
Sbjct: 373 LFYPEALPSPTFGSPGVIWSALTLAILTLPVVIVSTEEGLARIPSTIRQGSLALGATQAE 432

Query: 323 TVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------AT 375
           T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V      P+              
Sbjct: 433 TLWRIVLPMASPAIMTGLILAIARAAGEVAPLMLVGVVKLAPTLPMDGNFPYLHVERKFM 492

Query: 376 AFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                IY     +          +    LL+  +  +N   + +RN  +++
Sbjct: 493 HLGFHIYDVGFQSPNVEAARPLVYATSFLLVTVIVGLNLTAIGIRNHLREK 543


>gi|312135004|ref|YP_004002342.1| phosphate ABC transporter inner membrane subunit PstA
           [Caldicellulosiruptor owensensis OL]
 gi|311775055|gb|ADQ04542.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor owensensis OL]
          Length = 280

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 77/241 (31%), Positives = 127/241 (52%), Gaps = 5/241 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N  F +       +  GI   +VG+LY+ L+ + ++ P+GI +AIYL E++ KG   
Sbjct: 40  RGINLSFILQYPEEMGKSGGIFPVIVGTLYVTLLAVIIAAPVGILAAIYLTEYAKKGKVV 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     LA +PSI+YG+ G A  +      R + L G L L++M LP+II  +  ++
Sbjct: 100 ELIRFGTETLAGIPSIIYGLFGFAFFVIALGF-RWSILSGALTLSIMILPTIIRTSEESI 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S R  +L LGA+K QT+   V+P AMP ILTG  + + RA+GETA +L     + 
Sbjct: 159 KTVPMSFREGSLALGATKWQTIAKVVIPPAMPGILTGVILGVGRAIGETAAVLLTAGSSL 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             ++P  +        V +Y+    +E      ++    LL++ + VINT    +  R+ 
Sbjct: 219 --NFPTSIFSPTRTMSVHLYIL--SSEGLSKLNSYATATLLIVIVFVINTFANMIIRRYN 274

Query: 423 K 423
           +
Sbjct: 275 R 275


>gi|218245882|ref|YP_002371253.1| phosphate ABC transporter inner membrane subunit PstA [Cyanothece
           sp. PCC 8801]
 gi|218166360|gb|ACK65097.1| phosphate ABC transporter, inner membrane subunit PstA [Cyanothece
           sp. PCC 8801]
          Length = 311

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 95/258 (36%), Positives = 142/258 (55%), Gaps = 16/258 (6%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 FF++  S + E AGI  A VGS  +ML+ +  + PLG+AS IYLEE+S K + S
Sbjct: 55  PRITPNFFLSFPSRKAEEAGILSAWVGSGLIMLVTMIAAIPLGVASGIYLEEYSKKNWLS 114

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ NI NLA VPSI+YG+L   + +    + R + L  GL LAL+ LP II+ T  AL
Sbjct: 115 DIIEINITNLAGVPSIIYGLLALGLFVYQLNLGR-SMLSAGLTLALLILPVIIVTTREAL 173

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R++P S+R AA  +GASK Q V  H+LP ++ +ILTG  + ++RA+GETAPL+ +G + F
Sbjct: 174 RSIPRSLREAAYAVGASKWQVVSQHILPYSLGSILTGIIIGISRAIGETAPLITIGALTF 233

Query: 363 VTDYPVGV-------------TDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                    T  P+Q++ W +     F      A  +L+     
Sbjct: 234 IAFLPDPPIKGEFPFISFAWLFTEYTVMPIQMFNWVSRPNAEFHINAAAAGTVLIAMTVF 293

Query: 410 INTAMLWLRNRFKK--RW 425
           +N   ++LR R +K  +W
Sbjct: 294 MNALAIYLRYRLRKGVKW 311


>gi|118594573|ref|ZP_01551920.1| phosphate ABC transporter, permease protein [Methylophilales
           bacterium HTCC2181]
 gi|118440351|gb|EAV46978.1| phosphate ABC transporter, permease protein [Methylophilales
           bacterium HTCC2181]
          Length = 314

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 87/256 (33%), Positives = 138/256 (53%), Gaps = 14/256 (5%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           +  F   FF N  S R   AGI  A VGS  ++L+   ++ PLGIA+ IYLEE++ K + 
Sbjct: 57  YPKFTLDFFTNFPSRRAARAGILSAWVGSSLVLLVTFFVAVPLGIAAGIYLEEYAKKNWI 116

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           S  ++ N++NLA VPSI+YG+L   + +  F + +S    G  +  LM LP +I++T  A
Sbjct: 117 SDIIEINVSNLAGVPSIIYGLLALGLFVYSFGLGQSILTAGLTLALLM-LPIVIVSTREA 175

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R +P  IR AA  +GA+K Q V HHV+  +   ILTG  + +ARA+GETAP++ +G + 
Sbjct: 176 IRAIPIHIREAAYAVGATKWQVVLHHVVQYSYGGILTGVIIGMARAIGETAPVITIGALT 235

Query: 362 FVTDYPVGVTD-------------IATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           F+   P                    T  P+Q++ W +  +  F         +++I  A
Sbjct: 236 FIAFLPPSPVSIDPPFLNFAWLNAGFTVLPIQMFNWISRPQHAFHINAAATGAVIIILTA 295

Query: 409 VINTAMLWLRNRFKKR 424
           ++N   + LR   +K+
Sbjct: 296 MMNGFAIKLRYNVRKK 311


>gi|73748093|ref|YP_307332.1| phosphate ABC transporter, permease protein [Dehalococcoides sp.
           CBDB1]
 gi|147668879|ref|YP_001213697.1| phosphate ABC transporter, inner membrane subunit PstA
           [Dehalococcoides sp. BAV1]
 gi|289432119|ref|YP_003461992.1| phosphate ABC transporter inner membrane protein [Dehalococcoides
           sp. GT]
 gi|73659809|emb|CAI82416.1| phosphate ABC transporter, permease protein [Dehalococcoides sp.
           CBDB1]
 gi|146269827|gb|ABQ16819.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Dehalococcoides sp. BAV1]
 gi|288945839|gb|ADC73536.1| phosphate ABC transporter, inner membrane subunit PstA
           [Dehalococcoides sp. GT]
          Length = 283

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 126/243 (51%), Gaps = 6/243 (2%)

Query: 183 LDFNYGFFINGASSR-PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
             F++ F     +       GI   +V +LY++ + + +  P+GI +AIYL E++     
Sbjct: 41  PGFSWDFLFTPPAGGLAGDGGISSTIVTTLYLVGLTLLILVPVGIGAAIYLVEYAPDNRL 100

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F++  +  LA VPSI++G+ G A+ +      R + L G L LA + LP +I AT  A
Sbjct: 101 TRFIRYGVQTLAGVPSILFGLFGFALFVTVLHF-RFSILSGALTLACLLLPVLITATEEA 159

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+TVP S R+ A+ LGA+K Q++ H +LP A+P I TG  +   RALGETA L      +
Sbjct: 160 LKTVPRSYRAGAMALGATKWQSITHVILPAALPGIATGVILCAGRALGETACLYVTMGGS 219

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
                P  +     +  + ++  A   E   +++      +L++ +  +N    ++  RF
Sbjct: 220 --AAMPDSLLSGGRSLALHVFYLAT--ETNAIDKAMATAAVLIVIIVGLNALTNFISRRF 275

Query: 422 KKR 424
           +KR
Sbjct: 276 QKR 278


>gi|28897349|ref|NP_796954.1| phosphate ABC transporter permease [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838054|ref|ZP_01990721.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio parahaemolyticus AQ3810]
 gi|260364505|ref|ZP_05777126.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus K5030]
 gi|260876311|ref|ZP_05888666.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260898582|ref|ZP_05907078.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus Peru-466]
 gi|28805561|dbj|BAC58838.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149748521|gb|EDM59380.1| A transmembrane component of the phosphate specific transport
           complex [Vibrio parahaemolyticus AQ3810]
 gi|308086896|gb|EFO36591.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus Peru-466]
 gi|308092877|gb|EFO42572.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308114713|gb|EFO52253.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus K5030]
          Length = 557

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 124/263 (47%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G+++++LI+  +  PLG+ +AIYL E++     +  ++
Sbjct: 288 WKFLSEDPRESNSEGGVFPAIFGTVFLVLIMSIIVMPLGVVAAIYLHEYAKNNALTRIIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             + NLA VPSIVYG+ G    +                          L   L LA++T
Sbjct: 348 IAVINLAGVPSIVYGVFGLGFFVYTIGASIDNVFYAERLPAPTFGTPGLLWSALTLAVLT 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 408 LPVVIVTTEEGLTRIPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +    
Sbjct: 468 VAPLMLVGVVKLASSLPVDGQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSF 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 528 LLVTVIVGLNLTAISIRNNLREK 550


>gi|330836406|ref|YP_004411047.1| phosphate ABC transporter, inner membrane subunit PstA [Spirochaeta
           coccoides DSM 17374]
 gi|329748309|gb|AEC01665.1| phosphate ABC transporter, inner membrane subunit PstA [Spirochaeta
           coccoides DSM 17374]
          Length = 525

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 136/243 (55%), Gaps = 5/243 (2%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
             +  + + +          GIG  ++ +  M+ +   ++ PLGIA+A+YL E++ KG  
Sbjct: 283 SPNLTFRYLVLPTQESGRFGGIGSIIINTFLMVFLTTLIAAPLGIAAAVYLVEYAKKGRL 342

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +S +++ I+ LAS+PSI++G+ G  V +        + + G L +ALM LP+II  +  A
Sbjct: 343 TSIIRSGIDVLASIPSIIFGLFGLLVFVQLLGWS-FSLISGTLTVALMILPTIIRTSEEA 401

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           +R+V   +R A++G+GA+K++T++  VLP A+  I TG  +++ RA+GETA LL+    +
Sbjct: 402 IRSVEQRLREASIGMGATKMETIWRVVLPSALNGITTGIILAMGRAIGETAALLYTIGSS 461

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
             T    G++  +    + I L   + +    ++ F +  +L++ + +INT   W+ NR 
Sbjct: 462 --TAVATGLSSGSRVLALHIMLTINEGQ--SFDKAFASAFVLIVVVLIINTTARWMMNRA 517

Query: 422 KKR 424
             +
Sbjct: 518 SVK 520


>gi|260903262|ref|ZP_05911657.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus AQ4037]
 gi|308107937|gb|EFO45477.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus AQ4037]
          Length = 557

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 124/263 (47%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G+++++LI+  +  PLG+ +AIYL E++     +  ++
Sbjct: 288 WKFLSEDPRESNSEGGVFPAIFGTVFLVLIMSIIVMPLGVVAAIYLHEYAKNNALTRIIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             + NLA VPSIVYG+ G    +                          L   L LA++T
Sbjct: 348 IAVINLAGVPSIVYGVFGLGFFVYTIGASIDNVFYAERLPAPTFGTPGLLWSALTLAVLT 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 408 LPVVIVTTEEGLTRIPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +    
Sbjct: 468 VAPLMLVGVVKLASSLPVDGQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSF 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 528 LLVTVIVGLNLTAISIRNNLREK 550


>gi|172036080|ref|YP_001802581.1| phosphate ABC transporter permease [Cyanothece sp. ATCC 51142]
 gi|171697534|gb|ACB50515.1| phosphate ABC transporter, permease protein [Cyanothece sp. ATCC
           51142]
          Length = 317

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 93/271 (34%), Positives = 148/271 (54%), Gaps = 29/271 (10%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 FF++  S + E AGI  A VG+  +M +   ++ PLGIAS +YLEE++ K + S
Sbjct: 48  PRLTPQFFVSFPSRKAEQAGILSAWVGTSLVMFVTACVAIPLGIASGVYLEEYARKNWLS 107

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           + ++ N+ NLA VPSIVYG+L   + +  F++ + + L  GL LAL+ LP +I+ T  A+
Sbjct: 108 AIIEINVTNLAGVPSIVYGLLALGLFVYQFQLGQ-SVLTAGLTLALLILPVVIVTTREAI 166

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R +P S+R A+  +GA+K QTV+ H+LP +  +ILTG  + LARA+G+TAPL+ +G + F
Sbjct: 167 RAIPISLREASYAVGATKWQTVWDHILPYSSGSILTGIIIGLARAIGQTAPLITIGALTF 226

Query: 363 VTDYPVGVTD--------------------------IATAFPVQIYLWAADAERPFVERT 396
           +   P    +                            T  P+Q++ W +  E+ F    
Sbjct: 227 IAFLPESPLNNEFPFLPLEMTFPFFNFQQFFAWLNAPFTVLPIQMFTWVSRPEQEFQVNA 286

Query: 397 FGAILLLLIFLAVINTAMLWLRNRFKK--RW 425
             A  +LLI    IN   ++LR R ++  +W
Sbjct: 287 AAAGTVLLIMTLGINGIAIYLRYRLRQGIKW 317


>gi|29346732|ref|NP_810235.1| putative ABC transporter permease [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338629|gb|AAO76429.1| putative ABC transporter permease protein [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 291

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 79/241 (32%), Positives = 134/241 (55%), Gaps = 3/241 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F  +  +      GI  A+VG+ Y+M      +FP+G+ S IY+ E++ KG    F+
Sbjct: 48  SWEFITSAPTDGMTGGGIWPAIVGTFYLMAGSALFAFPVGVMSGIYMNEYAPKGKLVRFI 107

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+ +
Sbjct: 108 RVMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALKAI 166

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S+R  +  LGA+++QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+  
Sbjct: 167 PDSMREGSRALGATRLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFLPQ 226

Query: 366 YPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P  + D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F+K
Sbjct: 227 LPASILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIVIILLVNLLANALRKYFEK 286

Query: 424 R 424
           R
Sbjct: 287 R 287


>gi|90579396|ref|ZP_01235206.1| putative phosphate ABC transporter, permease protein [Vibrio
           angustum S14]
 gi|90440229|gb|EAS65410.1| putative phosphate ABC transporter, permease protein [Vibrio
           angustum S14]
          Length = 545

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 85/346 (24%), Positives = 149/346 (43%), Gaps = 30/346 (8%)

Query: 109 QASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQ 168
                L+   +  + +  +   ++            + +DSA      S      +S  Q
Sbjct: 194 ALKDKLTPDEKARIEREELNYKTIYKNIENRLFSLQSQLDSASLLLRDSQGKTITLSMSQ 253

Query: 169 WKWFQKLDSDGALFLDFNYG-----FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
                  ++   +    ++G     F            G+  A+ G+++M+L++  +  P
Sbjct: 254 VLDMWYPNNLTFIEKFQHWGKQVYKFLTEAPREANTEGGVFPAIFGTVFMVLLMSVMVTP 313

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK---------- 273
           LG+ +AIYL E++    F+  ++  + NLA VPSIVYG+ G    +              
Sbjct: 314 LGVLAAIYLHEYAGNNNFTKVIRIAVINLAGVPSIVYGVFGLGFFVYMVGGTIDDVFFSA 373

Query: 274 ------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHH 327
                       L   L LA+MTLP +I++T   L  +PSS+R+ +L LGA++ +T++  
Sbjct: 374 QLPTPTFGTPGILWSALTLAIMTLPVVIVSTEEGLSRIPSSVRNGSLALGATQAETLWRI 433

Query: 328 VLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQ 380
           VLP+A PAI+TG  +++ARA GE APL+ VG+V      PV V                 
Sbjct: 434 VLPMASPAIMTGLILAVARAAGEVAPLMLVGVVKMAPTLPVDVHFPFVHLDRKFMHLGYH 493

Query: 381 IYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           IY  A  +          +    LL+  +  +N   + +RN  +++
Sbjct: 494 IYDVAFQSPNVEAARPLVYATSFLLVTVIVSLNLTAIGIRNHLREK 539


>gi|323491602|ref|ZP_08096781.1| ABC transporter transmembrane protein [Vibrio brasiliensis LMG
           20546]
 gi|323314178|gb|EGA67263.1| ABC transporter transmembrane protein [Vibrio brasiliensis LMG
           20546]
          Length = 548

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 92/413 (22%), Positives = 171/413 (41%), Gaps = 51/413 (12%)

Query: 40  LSSIVSKGIGALWQT---HISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARK 96
           LSS ++ G+ A  ++    I   IE    +++ Q +R          +    + +     
Sbjct: 152 LSSEITTGL-AFAKSLRDEIERLIERDVRVINAQAERLRLEKRKRSLN--GTLDEEFLTL 208

Query: 97  LSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLY 156
               +  +     A+++     R  L    +    + G+ V +    S  +D      + 
Sbjct: 209 YQKQNQGYVEALNATELKLDNLRSQLANQGVIVEDMTGQQVTI--PLSQMLDIWYPNQMN 266

Query: 157 SPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLI 216
           +   +        +W ++            + F            G+  A+ G++ ++LI
Sbjct: 267 TFEKLA-------RWAKQ-----------AWKFLSEDPRDSNSEGGVFPAMFGTVLLVLI 308

Query: 217 VIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK--- 273
           +  +  PLG+ +AIYL E++    F+  ++  + NLA VPSIVYG+ G    +       
Sbjct: 309 MSVIVMPLGVIAAIYLHEYAKNNAFTRLIRVAVINLAGVPSIVYGVFGLGFFVYTLGGSI 368

Query: 274 -------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASK 320
                              L   L LA++TLP +I+AT   L  +P+S+R  +L LGA++
Sbjct: 369 DNLFYQERLPAPTFGTPGLLWSALTLAVLTLPVVIVATEEGLTRIPNSVRHGSLALGATQ 428

Query: 321 VQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG-------VTDI 373
            +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +  PV        +   
Sbjct: 429 FETMWRIVLPMASPAIITGLILAIARAAGEVAPLMLVGVVKLASSLPVDSQFPFLHLDRK 488

Query: 374 ATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                  IY   +            +    LL+  +  +N   + +RN  +++
Sbjct: 489 FMHLGFHIYDVGFQTTNIESARPLVYATSFLLVTVIVGLNLTAISIRNNLREK 541


>gi|189500178|ref|YP_001959648.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides BS1]
 gi|189495619|gb|ACE04167.1| phosphate ABC transporter, inner membrane subunit PstA [Chlorobium
           phaeobacteroides BS1]
          Length = 448

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 113/445 (25%), Positives = 202/445 (45%), Gaps = 31/445 (6%)

Query: 10  NLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGA-LWQTHISLPIEFSETIVD 68
           N+  R I +  F    + ++L++ + L++++  IVS GIGA  ++  I    +      D
Sbjct: 2   NIGTRKILDRSFTAVGLTSILLMALALLVVVVPIVSGGIGAIFFKGTIE-HRKLQLREFD 60

Query: 69  PQKKRFMDPAILLRADYNLLVRKALARKLSI-SDSNHALLRQASQMLSTTARYH------ 121
              +  +D  I     Y   V + L    +          R+ S  +S+           
Sbjct: 61  NGNREVLDRQIAESEPYRQEVFRMLDAFAAELETFEPTRKREYSSKVSSVKDIVSHLLGP 120

Query: 122 ---------LRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWF 172
                    LR    T      +     L+     D++    +     V R+ ++     
Sbjct: 121 VPGEPEPILLRFQYGTTRWEKAEESLHDLMFVTKWDTSNPEEMGKQYFVPRVDEFAGTSL 180

Query: 173 --------QKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPL 224
                   + L+        F +GF    +       G+   + G+L++ +  +  +FP+
Sbjct: 181 AALFPYIEENLEKMLLPEQTFYWGFLTERSLDAHIFGGVWAEIQGTLFLAIGAMLFAFPM 240

Query: 225 GIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRS-TALVGG 283
           G+ +AIY  E++ +  F+S +++  + LA VPSIV+G+ G A  IN  K+  S + L G 
Sbjct: 241 GVIAAIYFTEYARENVFTSILRSANSTLAGVPSIVFGLFGLAFFINTIKVSDSKSVLAGS 300

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L LA+M LP+II A   A+ +VP + + A++GLG++K +T+   +LP A+P I+TG  +S
Sbjct: 301 LTLAIMILPTIIRAAEEAILSVPKTYKEASIGLGSTKWRTIVTVILPAALPGIITGGIIS 360

Query: 344 LARALGETAPLLFVGMVAFVTDYPVG--VTDIATAFPVQIYLWAADAERPF--VERTFGA 399
           L RA GETAP++F   V+      +G  +T    A    IY  A++ E         +G 
Sbjct: 361 LGRAAGETAPIIFTAAVSVGATIGLGDVLTSPTPALSWNIYNLASEHEAANEIRHVQYGM 420

Query: 400 ILLLLIFLAVINTAMLWLRNRFKKR 424
           +L L+  + ++N + + LR R  K+
Sbjct: 421 VLALISIVLLLNLSAILLRARISKK 445


>gi|328472626|gb|EGF43489.1| phosphate ABC transporter permease [Vibrio parahaemolyticus 10329]
          Length = 557

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 74/263 (28%), Positives = 125/263 (47%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G+++++LI+  +  PLG+ +AIYL E++    F+  ++
Sbjct: 288 WKFLSEDPRESNSEGGVFPAIFGTVFLVLIMSIIVMPLGVVAAIYLHEYAKNNAFTRIIR 347

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             + NLA VPSIVYG+ G    +                          L   L LA++T
Sbjct: 348 IAVINLAGVPSIVYGVFGLGFFVYTIGASIDNVFYAERLPAPTFGTPGLLWSALTLAVLT 407

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 408 LPVVIVTTEEGLTRIPSSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGE 467

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +    
Sbjct: 468 VAPLMLVGVVKLASSLPVDGQFPYVHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSF 527

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 528 LLVTVIVGLNLTAISIRNNLREK 550


>gi|257051994|ref|YP_003129827.1| phosphate ABC transporter, inner membrane subunit PstA [Halorhabdus
           utahensis DSM 12940]
 gi|256690757|gb|ACV11094.1| phosphate ABC transporter, inner membrane subunit PstA [Halorhabdus
           utahensis DSM 12940]
          Length = 818

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 122/263 (46%), Gaps = 23/263 (8%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F +N +       G+  A+VG+++++   + ++ PL + +A+YL E++     + 
Sbjct: 554 ALDWPFIMNPSQGLGIQPGVMPAIVGTVWLVAGAVVMAVPLALGAAVYLTEYAEGTVVTR 613

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            V+   N L S PSIV+G+ G A LI  F     +   G L+L  M LP ++I +  AL+
Sbjct: 614 IVEIATNGLWSTPSIVFGLFGLAFLIPRFG-NSKSIFAGQLVLGFMLLPLVLITSREALK 672

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP   R A+  LG SK +T+   V+P AMP ++TG  + + R  GETAPLL V   A  
Sbjct: 673 SVPDEYRDASAALGVSKWETIRSVVIPAAMPGVITGVILGIGRIAGETAPLLLVTGGANF 732

Query: 364 TDYPVG----------------------VTDIATAFPVQIYLWAADAERPFVERTFGAIL 401
                                       + D A+A P Q+Y          +   +G  L
Sbjct: 733 PGSSPDVLGSFEVSTGLTPPFVSVQNPALLDAASALPYQLYAIITAGVGEDLLFGYGTAL 792

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           +LL  +       +  R  F+++
Sbjct: 793 VLLAVVLSFYAVGIASRRYFRRK 815


>gi|111075042|gb|ABH04888.1| ABC-type phosphate transporter permease component pstA
           [Heliobacillus mobilis]
          Length = 265

 Score =  165 bits (417), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 134/249 (53%), Gaps = 1/249 (0%)

Query: 175 LDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEE 234
            D     F    + F            GI  A+VG+ Y+++  +  + P+G+ +A+YL E
Sbjct: 14  WDLFSKGFPALTWEFITENPKKGMTAGGIFPAIVGTFYLIVGTVLFALPVGVMTAVYLVE 73

Query: 235 FSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSI 294
           ++ + + +  ++  + NLA VPS+V+G+ G    + F     ++ L G L LALM LP I
Sbjct: 74  YARESWVTRVIRLAVVNLAGVPSVVFGLFGLGFFVLFLNF-GASILAGSLTLALMVLPVI 132

Query: 295 IIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPL 354
           I  +  ALR VP+  R A+L LGA+K+QT+   VLP A+P I+TGS + LARA GETAP+
Sbjct: 133 ITTSEEALRAVPNGFREASLALGATKLQTILFIVLPNALPGIMTGSILGLARAAGETAPI 192

Query: 355 LFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAM 414
           L      F+   P  + D   A P  +Y+ A        +  +G   +L++ +  +N A 
Sbjct: 193 LLTAAAFFLPRLPNSIFDQVMALPYHLYVIATQVPNADEKIPYGTATVLMLLVLGLNLAA 252

Query: 415 LWLRNRFKK 423
           + LR+ F++
Sbjct: 253 VLLRSYFRR 261


>gi|91772769|ref|YP_565461.1| ABC phosphate transporter, inner membrane subunit [Methanococcoides
           burtonii DSM 6242]
 gi|91711784|gb|ABE51711.1| Phosphate import ABC transporter permease protein [Methanococcoides
           burtonii DSM 6242]
          Length = 286

 Score =  165 bits (417), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 125/239 (52%), Gaps = 3/239 (1%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F       R    GI  A++GSL ++ + +  + PLGI SAIYL E+S  G  S  ++ 
Sbjct: 46  DFITQMPMKRMTQGGIYPAIMGSLMLIGLSMAFAIPLGILSAIYLNEYSTPGRASWAIEM 105

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            INNLA  PS+V+G+ G A+ + +F    S       +  L+ +P II A+  AL TVP 
Sbjct: 106 AINNLAGTPSVVFGLFGLALFVKYFGFGASLLSASLTLALLI-VPVIIRASKEALMTVPQ 164

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
             R A+L LG +K QT    +LP A+P ++TG  +S+ R  GETAP+L  G   F+   P
Sbjct: 165 EYREASLALGVTKWQTTRKVILPAAIPGMMTGIILSVGRVAGETAPILLTGAAYFLPRIP 224

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             V     A P  +++ A         R   +G  L+LL+ + ++N+  + +R  ++ +
Sbjct: 225 DSVFSQFMALPYHLFVLATSGTSITQTRPIQYGTALILLLIVVMMNSIAVVIRRHYRNK 283


>gi|158319319|ref|YP_001511826.1| phosphate ABC transporter, inner membrane subunit PstC
           [Alkaliphilus oremlandii OhILAs]
 gi|158139518|gb|ABW17830.1| phosphate ABC transporter, inner membrane subunit PstC
           [Alkaliphilus oremlandii OhILAs]
          Length = 311

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/224 (30%), Positives = 119/224 (53%), Gaps = 7/224 (3%)

Query: 201 AGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVY 260
            GI   ++GS+Y  L  I +  P+G+ +A++L E +  G+    V+  +  LA +PS+VY
Sbjct: 88  FGIFPMIIGSIYATLGAIVMGVPIGVLTAVFLAEVAP-GWLVKIVKPAVELLAGIPSVVY 146

Query: 261 GILGSAVLINF----FKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGL 316
           G  G  V++      F  P ++ L   ++L +M LP+I+  +  A+R+VP   + A+L L
Sbjct: 147 GFFGLVVIVPLISKHFGGPGNSLLAVNVMLGIMILPTIVNISENAIRSVPKEYKEASLAL 206

Query: 317 GASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATA 376
           GAS++QT+F  +LP A   ILT   + + RA+GET  ++ V         P  +T+    
Sbjct: 207 GASQIQTIFKVILPAARSGILTSVVLGIGRAIGETMAVILVAGNT--PAIPKALTEPMRT 264

Query: 377 FPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
               I +  + A+    E  FG  ++L IF+ ++N A+    N+
Sbjct: 265 LTANIAMEMSYAQGLHQEALFGTGVILFIFIMILNIALNIFTNK 308


>gi|323702460|ref|ZP_08114124.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532599|gb|EGB22474.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfotomaculum nigrificans DSM 574]
          Length = 294

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/253 (26%), Positives = 123/253 (48%), Gaps = 13/253 (5%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  +   +     G+G  +  S Y++ + + ++ P+G+ + IYL EF+  G  + 
Sbjct: 39  SIDWSFITSPPQNLSPGGGVGPQIFNSFYLLFLTMLITVPVGLLAGIYLAEFAKPGKVTE 98

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
            ++ +I  L S+PSIV G+ G  + +N       + + G L L ++ LP ++  +  A+R
Sbjct: 99  SIRLSIETLTSLPSIVVGLFGLLIFVNLTGWGY-SLMSGALALTVINLPLMVRISEEAIR 157

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA-- 361
            VP  +R  +L LGA++ QTV+  V+P A  +ILTG+ ++  R  GE A LLF   ++  
Sbjct: 158 NVPVELREGSLALGATRWQTVWKVVIPSAFLSILTGTIITAGRVFGEAAALLFTAGMSSP 217

Query: 362 ---------FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF-GAILLLLIFLAVIN 411
                         P      A    V I+   +++  P V R   G+  +L++ + + N
Sbjct: 218 PLNFNQWDILSPASPWNPFRPAETLAVHIWKVNSESLIPDVRRVADGSAAILVLVVLLFN 277

Query: 412 TAMLWLRNRFKKR 424
               WL  R  K+
Sbjct: 278 ITARWLGRRIHKK 290


>gi|84489162|ref|YP_447394.1| hypothetical protein Msp_0341 [Methanosphaera stadtmanae DSM 3091]
 gi|84372481|gb|ABC56751.1| PstA [Methanosphaera stadtmanae DSM 3091]
          Length = 281

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 70/242 (28%), Positives = 131/242 (54%), Gaps = 5/242 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F            GI   +V ++Y+    + ++ P+G+ SAIYL E++ +G F 
Sbjct: 41  PHISWEFLTTSPKDFGAEGGILPMIVSTIYVTFFAVLIATPIGVGSAIYLYEYAGEGKFV 100

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++    +LAS+PSI++G+ G A  + F  +     L   L LA+M +P+I+     AL
Sbjct: 101 KAIRFCSESLASLPSIIFGLFGLAFFVEFLNL-GWCILSASLTLAIMAMPTIMRTAENAL 159

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
             VP + R  +LG+GA++ QT+ + +LP A+P I+TG  + +ARA+ ETA +++    + 
Sbjct: 160 EAVPPNYREGSLGMGATRWQTIENVILPAAIPGIITGVILGMARAIEETAAIMYTVGSS- 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
            T  P+ + D A   P+ +Y+ A +     +  TF    +L++ +  I  +  +L +R++
Sbjct: 219 -TAIPITIFDPARPLPLHLYMLATEG--ISIPNTFATATVLIVIILAITISTNYLVDRYQ 275

Query: 423 KR 424
           K+
Sbjct: 276 KK 277


>gi|27363929|ref|NP_759457.1| phosphate ABC transporter permease PstA [Vibrio vulnificus CMCP6]
 gi|320157311|ref|YP_004189690.1| phosphate transport system permease PstA [Vibrio vulnificus
           MO6-24/O]
 gi|27360046|gb|AAO08984.1| phosphate ABC transporter, permease protein PstA [Vibrio vulnificus
           CMCP6]
 gi|319932623|gb|ADV87487.1| phosphate transport system permease protein PstA [Vibrio vulnificus
           MO6-24/O]
          Length = 556

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 125/263 (47%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G+++++LI+  +  PLG+ +AIYL E++    F+  ++
Sbjct: 287 WKFLSENPRDSNSAGGVFPAIFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNAFTRVIR 346

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             + NLA VPSIVYG+ G    +                          L   L LA++T
Sbjct: 347 IAVINLAGVPSIVYGVFGLGFFVYTIGSSIDNLFYAERLPAPTFGTPGLLWSALTLAVLT 406

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 407 LPVVIVTTEEGLTRIPNSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGE 466

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +    
Sbjct: 467 VAPLMLVGVVKLASSLPVDGQFPYIHLERKFMHLGFHIYDVGFQTSNIEAARPLVYATSF 526

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 527 LLVTVIVGLNLTAISIRNNLREK 549


>gi|289578657|ref|YP_003477284.1| phosphate ABC transporter inner membrane subunit PstA
           [Thermoanaerobacter italicus Ab9]
 gi|289528370|gb|ADD02722.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter italicus Ab9]
          Length = 295

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 120/255 (47%), Gaps = 13/255 (5%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
               N  F  +         GIG  +  SL +++I + +S P+G+ + IY+ E++  G  
Sbjct: 37  RTRLNVDFLTSPPKFMEAGGGIGPQLFNSLELLIITLIISVPIGLGAGIYMAEYAKPGLL 96

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ +I  L+S+PSIV G+ G  V +        + + G L L ++ LP +   +  +
Sbjct: 97  TEIIRLSIETLSSMPSIVIGLFGLLVFVTMTGWGY-SLIAGALALTVLNLPVMTRVSEDS 155

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM-- 359
           +R+VP+S+R A+  LGA+K QT+   V+P AMP I+TG  ++  R  GE A LL+     
Sbjct: 156 IRSVPNSLREASYALGATKWQTIVKVVVPAAMPGIITGIILTAGRIFGEAAALLYTAGMS 215

Query: 360 ---------VAFVTDYPVGVTDIATAFPVQIYLWAADA-ERPFVERTFGAILLLLIFLAV 409
                           P+ +   A    V I+   ++       E   GA  +LL+ + +
Sbjct: 216 SPALNFSNLNPSSPTSPLNIFRPAETLAVYIWKINSEGLAPDAREIADGAAAVLLLMVLI 275

Query: 410 INTAMLWLRNRFKKR 424
            N    WL N   KR
Sbjct: 276 FNILARWLGNVLYKR 290


>gi|89092204|ref|ZP_01165158.1| phosphate ABC transporter, permease protein [Oceanospirillum sp.
           MED92]
 gi|89083292|gb|EAR62510.1| phosphate ABC transporter, permease protein [Oceanospirillum sp.
           MED92]
          Length = 562

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 74/263 (28%), Positives = 129/263 (49%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         GI  A+ G++ M++I+  +  P G+ +A+YL E++ +GF +  ++
Sbjct: 294 WEFLSDDPREANTEGGIFPAIYGTVLMVIIMSVMVTPFGVVAAVYLREYAKQGFVTRVIR 353

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VPSIVYG+ G    + F                        L   + LAL+T
Sbjct: 354 IAVNNLAGVPSIVYGVFGLGFFVYFLGGHIDDAFFAEAKPAPTFGTPGLLWASITLALLT 413

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P ++R  +L LGA+K +T+   V+P+A PAI+TG  +++ARA GE
Sbjct: 414 VPVVIVATEEGLTRIPRAVREGSLALGATKFETLMKIVIPMASPAIMTGVILAIARAAGE 473

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      P+        +          IY     +          +    
Sbjct: 474 VAPLMLVGVVKLAPSLPLDGNYPFLHLDQKFMHLGFHIYDVGFQSPNVEAARPLVYATAF 533

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +A++N + + +RN  +++
Sbjct: 534 LLVAVIAMLNLSAIQIRNHLREK 556


>gi|57235018|ref|YP_180890.1| phosphate ABC transporter, permease protein [Dehalococcoides
           ethenogenes 195]
 gi|57225466|gb|AAW40523.1| phosphate ABC transporter, permease protein [Dehalococcoides
           ethenogenes 195]
          Length = 283

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 75/243 (30%), Positives = 125/243 (51%), Gaps = 6/243 (2%)

Query: 183 LDFNYGFFINGASSR-PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
             F++ F I   +       GI   +V +LY++ + + +  P+GI +AIYL E++     
Sbjct: 41  PGFSWDFLITPPAGGLAGEGGISSTIVTTLYLVGLTLLILVPVGIGAAIYLVEYAPDNRL 100

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F++  +  LA VPSI++G+ G A+ +      R + L G L LA + LP +I AT  A
Sbjct: 101 TRFIRYGVQTLAGVPSILFGLFGFALFVTALHF-RFSILSGALTLACLLLPVLITATEEA 159

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+ VP S R+ A+ LGA+K Q V H +LP A+P I TG  +   RALGETA L      +
Sbjct: 160 LKAVPRSYRAGAMALGATKWQAVTHVILPAALPGIATGVILCAGRALGETACLYVTMGGS 219

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
                P  +     +  + ++  A   E   +++      +L++ +  +N    ++  RF
Sbjct: 220 --AAMPESLLSGGRSLALHVFYLAT--ETNAMDKAMATAAVLIVIIVGLNGLTNFISRRF 275

Query: 422 KKR 424
           +KR
Sbjct: 276 QKR 278


>gi|167037244|ref|YP_001664822.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040616|ref|YP_001663601.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter sp. X514]
 gi|256751999|ref|ZP_05492868.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914657|ref|ZP_07131973.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter sp. X561]
 gi|307724109|ref|YP_003903860.1| phosphate ABC transporter inner membrane subunit PstA
           [Thermoanaerobacter sp. X513]
 gi|320115663|ref|YP_004185822.1| phosphate ABC transporter inner membrane subunit PstA
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166854856|gb|ABY93265.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter sp. X514]
 gi|166856078|gb|ABY94486.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256749109|gb|EEU62144.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889592|gb|EFK84738.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter sp. X561]
 gi|307581170|gb|ADN54569.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter sp. X513]
 gi|319928754|gb|ADV79439.1| phosphate ABC transporter, inner membrane subunit PstA
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 295

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/255 (27%), Positives = 119/255 (46%), Gaps = 13/255 (5%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
               N  F  +         GIG  +  SL +++I + +S P+G+ + IY+ E++  G  
Sbjct: 37  RTKLNIDFLTSPPKFMEAGGGIGPQLFNSLQLLIITLIISVPIGLGAGIYMAEYAKPGLL 96

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           +  ++ +   L+S+PSIV G+ G  V +        + + G L L ++ LP +   +  +
Sbjct: 97  TEIIRLSAETLSSMPSIVVGLFGLLVFVTMTGWGY-SLVAGALTLTVLNLPVMTRVSEDS 155

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM-- 359
           +R+VP+S+R A+  LGA+K QT+   V+P AMP I+TG  ++  R  GE A LL+     
Sbjct: 156 IRSVPNSLREASYALGATKWQTIVKVVVPAAMPGIITGIILTAGRIFGEAAALLYTAGMS 215

Query: 360 ---------VAFVTDYPVGVTDIATAFPVQIYLWAADA-ERPFVERTFGAILLLLIFLAV 409
                           P+ +   A    V I+   ++       +   GA  +LL+ + +
Sbjct: 216 SPALNFSNLNPSSPTSPLNIFRPAETLAVYIWKVNSEGLAPDARQIADGAAAVLLLMVLI 275

Query: 410 INTAMLWLRNRFKKR 424
            N    WL N   KR
Sbjct: 276 FNILARWLGNTLYKR 290


>gi|238798716|ref|ZP_04642188.1| Phosphate ABC transporter, permease protein PstA [Yersinia
           mollaretii ATCC 43969]
 gi|238717412|gb|EEQ09256.1| Phosphate ABC transporter, permease protein PstA [Yersinia
           mollaretii ATCC 43969]
          Length = 532

 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 78/262 (29%), Positives = 131/262 (50%), Gaps = 25/262 (9%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F  +   +     G+  A+ G++ M++++  +  PLG+ +A+YL E++ K   +  ++ 
Sbjct: 265 QFLTDNPRNASTEGGVFPAIFGTVLMVILMSIVVMPLGVIAAVYLHEYAGKNVLTRMIRI 324

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLIL----------------ALMTL 291
           ++ NLA VPSIVYG+ G    + F             +                 AL+TL
Sbjct: 325 SVVNLAGVPSIVYGVFGLGFFVYFIGGSLDKLFYAEALPNPTFGTPGVLWAALTLALLTL 384

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I+AT   L  +P+S+R  +  LGASK +T++H VLP+A PA++TG  +++ARA GET
Sbjct: 385 PVVIVATEEGLSRIPASLRQGSQALGASKAETLWHIVLPMAAPAMITGLILAVARAAGET 444

Query: 352 APLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILL 402
           APL+ VG+V      PV        +         QIY  A  +          F   LL
Sbjct: 445 APLMLVGVVKSAPLLPVDGIFPFLHLERKFMHLSFQIYDMAFQSPNVEAARPLVFATALL 504

Query: 403 LLIFLAVINTAMLWLRNRFKKR 424
           L+I +  +N A + +R+  +++
Sbjct: 505 LVIIVVGLNLAAIGIRHYLREK 526


>gi|284165752|ref|YP_003404031.1| phosphate ABC transporter inner membrane protein [Haloterrigena
           turkmenica DSM 5511]
 gi|284015407|gb|ADB61358.1| phosphate ABC transporter, inner membrane subunit PstA
           [Haloterrigena turkmenica DSM 5511]
          Length = 296

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 96/242 (39%), Positives = 149/242 (61%), Gaps = 1/242 (0%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F  N     P  AG   A+VGS+ +ML++  ++FPLG+ +AIYLEE++  G+ + 
Sbjct: 54  WLDWQFLTNPPHPDPFQAGFLPAIVGSIAIMLVIALVTFPLGVGAAIYLEEYAGDGYLTK 113

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F+Q NI NLA VPS+VYG+LG  + +  F +   + L     +AL+ LP +II+   A+R
Sbjct: 114 FIQLNIANLAGVPSVVYGLLGLGLFVGLFSIGYGSVLAAAFTIALLILPIVIISAQEAIR 173

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP S R A+ G+GA+K QT+ + VLP AMP I+TG+ ++L RA+GETAPL+ +     V
Sbjct: 174 SVPDSQRQASYGMGATKWQTIRNVVLPRAMPGIMTGTILALGRAIGETAPLIMIAAPTTV 233

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAERPFVE-RTFGAILLLLIFLAVINTAMLWLRNRFK 422
              P G     +A P+QIY WA+  +  F        ++ LL+ L  IN+  + +RNR++
Sbjct: 234 FGLPNGPFSKVSAMPLQIYNWASYPQTEFQYGVVAAGVVTLLVVLLTINSIAIVIRNRYQ 293

Query: 423 KR 424
           +R
Sbjct: 294 QR 295


>gi|222151443|ref|YP_002560599.1| ABC-type phosphate transport system permease component PstA
           [Macrococcus caseolyticus JCSC5402]
 gi|222120568|dbj|BAH17903.1| ABC-type phosphate transport system permease component PstA
           [Macrococcus caseolyticus JCSC5402]
          Length = 297

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 96/240 (40%), Positives = 159/240 (66%), Gaps = 4/240 (1%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF N +S+ P  AGI  A++G+L++M+ +  ++  LG+A+AIY+EE++   FF+ FV+ N
Sbjct: 57  FFTNFSSTTPSKAGIKGALIGTLWLMMTIAPIAITLGVATAIYMEEYAKDNFFTRFVKVN 116

Query: 249 INNLASVPSIVYGILGSAVLINFFKM----PRSTALVGGLILALMTLPSIIIATGVALRT 304
           I NLASVPS+V+G+LG  + +    +       + L   L ++LM LP II+++  A+R 
Sbjct: 117 IANLASVPSVVFGLLGLTLFVRGGGIEALSLGKSVLAAALTMSLMILPVIIVSSQEAIRA 176

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP++IR A+LGLG +K QT+ + VLP ++P ILTG+ ++L+RA+GETAPL+ +G+     
Sbjct: 177 VPNAIREASLGLGGTKWQTITNVVLPASIPGILTGTILALSRAIGETAPLVVIGIPTIFM 236

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P  + D   A P+QI+ WA   +  F   +  AI++LLI L  +N+  +++RN+++K+
Sbjct: 237 KTPDNIMDRFQALPMQIFTWAKLPKAEFQFVSSAAIIVLLIILIAMNSIAIFIRNKYQKK 296


>gi|332162592|ref|YP_004299169.1| Phosphate ABC transporter, permease protein PstA [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318606695|emb|CBY28193.1| phosphate transport system permease protein PstA [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666822|gb|ADZ43466.1| Phosphate ABC transporter, permease protein PstA [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330863171|emb|CBX73298.1| hypothetical protein YEW_CI09620 [Yersinia enterocolitica W22703]
          Length = 554

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 92/380 (24%), Positives = 156/380 (41%), Gaps = 34/380 (8%)

Query: 73  RFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSL 132
           R        + +      +AL  +            +A   +        R        L
Sbjct: 175 RQSKDIQFRQMNMLNQQFEALRLQKKRLQMRGEFDGKAQDRIEAEWGELQRSHQAMMEKL 234

Query: 133 IGKTVE---VSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGF 189
            G  ++    +LL            L            +    QKL             F
Sbjct: 235 RGLQIDQSRYTLLLRDMNGQVHP--LPLSQINRAWYPNEMSLGQKLRHFVVQTHK----F 288

Query: 190 FINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANI 249
             +   +     G+  A+ G++ M++++  +  PLG+ +A+YL E++ K + +  ++ ++
Sbjct: 289 LTDNPRNANTEGGVFPAIFGTVLMVILMSIVVMPLGVIAAVYLHEYAGKNWLTRMIRISV 348

Query: 250 NNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLIL----------------ALMTLPS 293
            NLA VPSIVYG+ G    + F             +                 AL+TLP 
Sbjct: 349 VNLAGVPSIVYGVFGLGFFVYFIGGSLDKLFYPEALPNPTFGTPGVLWAALTLALLTLPV 408

Query: 294 IIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAP 353
           +I+AT   L  +P+S+R  +L LGASK +T++H VLP+A PA++TG  +++ARA GETAP
Sbjct: 409 VIVATEEGLSRIPASLRQGSLALGASKAETLWHIVLPMAAPAMITGLILAVARAAGETAP 468

Query: 354 LLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLL 404
           L+ VG+V      PV        +         QIY  A  +          F   LLL+
Sbjct: 469 LMLVGVVKSAPLLPVDGVFPYLHLERKFMHLSFQIYDMAFQSPNVESARPLVFATALLLV 528

Query: 405 IFLAVINTAMLWLRNRFKKR 424
           I +  +N A + +R+  +++
Sbjct: 529 IIVVGLNLAAIGIRHHLREK 548


>gi|37678913|ref|NP_933522.1| ABC-type phosphate transport system, permease component [Vibrio
           vulnificus YJ016]
 gi|37197654|dbj|BAC93493.1| ABC-type phosphate transport system, permease component [Vibrio
           vulnificus YJ016]
          Length = 556

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 125/263 (47%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G+++++LI+  +  PLG+ +AIYL E++    F+  ++
Sbjct: 287 WKFLSENPRDSNSAGGVFPAIFGTVFLVLIMSIIVMPLGVIAAIYLHEYAKNNAFTRIIR 346

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             + NLA VPSIVYG+ G    +                          L   L LA++T
Sbjct: 347 IAVINLAGVPSIVYGVFGLGFFVYTIGSSIDNLFYAERLPAPTFGTPGLLWSALTLAVLT 406

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 407 LPVVIVTTEEGLTRIPNSVRHGSLALGATQFETLWRVVLPMATPAIITGLILAIARAAGE 466

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +    
Sbjct: 467 VAPLMLVGVVKLASSLPVDGQFPYIHLERKFMHLGFHIYDVGFQTSNIEAARPLVYATSF 526

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 527 LLVTVIVGLNLTAISIRNNLREK 549


>gi|298505211|gb|ADI83934.1| phosphate ABC transporter, membrane protein PstA [Geobacter
           sulfurreducens KN400]
          Length = 306

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 91/255 (35%), Positives = 142/255 (55%), Gaps = 14/255 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 FF +  S  PE AGI  A VG++ +ML+   ++ PLG+A+ +YLEE++ K + +
Sbjct: 50  PRLKPHFFTSFPSRFPEEAGILSAWVGTILVMLVTAFVAVPLGVAAGVYLEEYAPKNWLT 109

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           + ++ N+ NLA VPSIV+G+L   + +      + + L  GL LAL+ LP +I+AT  +L
Sbjct: 110 AIIEINVTNLAGVPSIVFGLLALGLFVYQLNFGQ-SILSAGLTLALLILPIVIVATRESL 168

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP SIR AA  LGA++ Q V +HVLP +   ILTG  + L+RA+GETAP++ +G + F
Sbjct: 169 RAVPGSIREAAYALGATRWQMVSNHVLPYSSSGILTGVIIGLSRAIGETAPVITIGALTF 228

Query: 363 VTDYPVGVT-------------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                 D  T  P+Q++ W +  E  F      A ++LL     
Sbjct: 229 IAFLPHSPVSGQFPFISFEWLKDPFTVMPIQMFNWTSRPEEEFQLNAAAAGVVLLAMTLA 288

Query: 410 INTAMLWLRNRFKKR 424
           +N   ++LR   +K+
Sbjct: 289 MNAVAIFLRYHIRKK 303


>gi|237808806|ref|YP_002893246.1| phosphate ABC transporter, inner membrane subunit PstA [Tolumonas
           auensis DSM 9187]
 gi|237501067|gb|ACQ93660.1| phosphate ABC transporter, inner membrane subunit PstA [Tolumonas
           auensis DSM 9187]
          Length = 548

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 73/284 (25%), Positives = 130/284 (45%), Gaps = 27/284 (9%)

Query: 168 QWKWFQKLDSDGALFLDFN--YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
              W  +++    +   F+    F  +         G+  A+ G+++M+L++  +  PLG
Sbjct: 259 DVNWPNQMNLLQKIGHWFHQIGKFVSDEPREANTEGGVFPAIFGTVFMVLLMTVIVTPLG 318

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK------------ 273
           + +A+YL E++ K   +  ++  + NLA VPSIVYG+ G    +                
Sbjct: 319 VVAAVYLHEYAGKNAMTKLIRIAVINLAGVPSIVYGVFGLGFFVYMLGGSLDRIFYPEAS 378

Query: 274 ----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVL 329
                     +   L LA++TLP +I++T   L  +PS+IR  +L LGA+K +T++  VL
Sbjct: 379 PNPVFGTPGVIWSALTLAILTLPVVIVSTEEGLSRIPSAIRHGSLALGATKAETLWRIVL 438

Query: 330 PLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIY 382
           P+A PAI+TG  +++ARA GE APL+ VG V      P+                   I+
Sbjct: 439 PMASPAIMTGLILAIARAAGEVAPLMLVGAVKLAPTLPLDGNFPYVHVERKFMHLGFHIF 498

Query: 383 LWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                +          +    LL+  +  +N   + +RN  +++
Sbjct: 499 DVGFQSPNVEAARPLVYATSFLLVTVIVGLNLTAISIRNHLREK 542


>gi|270307591|ref|YP_003329649.1| phosphate ABC transporter, permease protein [Dehalococcoides sp.
           VS]
 gi|270153483|gb|ACZ61321.1| phosphate ABC transporter, permease protein [Dehalococcoides sp.
           VS]
          Length = 283

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 125/243 (51%), Gaps = 6/243 (2%)

Query: 183 LDFNYGFFINGASSR-PEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
             F++ F     +       GI   +V +LY++ + + +  P+GI +AIYL E++     
Sbjct: 41  PGFSWDFLFTPPAGGLAGEGGISSTIVTTLYLVGLTLLILVPVGIGAAIYLVEYAPDNRL 100

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           + F++  +  LA VPSI++G+ G A+ +      R + L G L LA + LP +I AT  A
Sbjct: 101 TRFIRYGVQTLAGVPSILFGLFGFALFVTVLHF-RFSILSGALTLACLLLPVLITATEEA 159

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+TVP S R+ A+ LGA+K Q V H +LP A+P I TG  +   RALGETA L      +
Sbjct: 160 LKTVPRSYRAGAMALGATKWQAVTHVILPAALPGIATGVILCAGRALGETACLYVTMGGS 219

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
                P  +     +  + ++  +   E   +++      +L++ +  +N    ++  RF
Sbjct: 220 --AAMPDSLLSGGRSLALHVFYLST--ETNAIDKAMATAAVLIVIIVGLNALTNFISRRF 275

Query: 422 KKR 424
           +KR
Sbjct: 276 QKR 278


>gi|191637830|ref|YP_001986996.1| Phosphate ABC transporter, membrane-spanning subunit [Lactobacillus
           casei BL23]
 gi|190712132|emb|CAQ66138.1| Phosphate ABC transporter, membrane-spanning subunit [Lactobacillus
           casei BL23]
 gi|327381896|gb|AEA53372.1| hypothetical protein LC2W_1038 [Lactobacillus casei LC2W]
 gi|327385057|gb|AEA56531.1| hypothetical protein LCBD_1033 [Lactobacillus casei BD-II]
          Length = 294

 Score =  164 bits (415), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 67/254 (26%), Positives = 119/254 (46%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  + A S     GIG+ +  S Y++L+ + +S P+ + + IYL E++ K + +
Sbjct: 38  PHISWHFLTSPAQSFEAGGGIGIQLFNSFYLLLLAMLISTPISLGAGIYLSEYAKKNWLT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++ +I  L+S+PS+V G+ G  + +  FK    + L G L L +  LP +      +L
Sbjct: 98  DVIRTSIEILSSLPSVVVGLFGFLIFVLQFKF-GFSILSGALALTVFNLPLLTRNVEDSL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM--- 359
           R V    R A L LG S+ +TV H V+P A+P I+TG  +   R  GE A L++      
Sbjct: 157 RGVEYEQREAGLALGLSRWETVLHVVIPEALPGIITGMILGAGRVFGEAAALIYTAGQSA 216

Query: 360 --------VAFVTDYPVGVTDIATAFPVQIYLWAADA-ERPFVERTFGAILLLLIFLAVI 410
                          P+     A    V I+   ++  +   +  + GA  +L++ + + 
Sbjct: 217 PALDFTDWNPANIASPLNPFRPAETLAVHIWKINSEGIQPDAIAVSAGASAVLVLAVLLF 276

Query: 411 NTAMLWLRNRFKKR 424
           N    +  NR  K+
Sbjct: 277 NLGARYFGNRLFKK 290


>gi|313897387|ref|ZP_07830930.1| phosphate ABC transporter, permease protein PstA [Clostridium sp.
           HGF2]
 gi|312957757|gb|EFR39382.1| phosphate ABC transporter, permease protein PstA [Clostridium sp.
           HGF2]
          Length = 415

 Score =  164 bits (415), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 101/418 (24%), Positives = 177/418 (42%), Gaps = 17/418 (4%)

Query: 12  KYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIGALWQTHISLPIEFSETIVDPQK 71
           + R + + L      ++  +    LI +   I SKG         SL I+  +     + 
Sbjct: 10  RKRRLFDGLCNGVTYLSSGLSVFVLIAIFVFIFSKGFS-------SLGIDLLKGNYWSKN 62

Query: 72  KRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPS 131
                                       S      +    Q                   
Sbjct: 63  YLTSVETTKNHPGSFERPSSLSEEASFSSKWGIGFVDTKDQNGDAIVLVEYIDEASPFHY 122

Query: 132 LIGKTV-EVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFF 190
           +  +++ +  +  S  +   ++   Y   +   M           +   AL         
Sbjct: 123 MKDESIKDKDVSLSTEVGFQVENLGYRTKSGATMIAGNIMSQNAAEVAQALDSSAQS--- 179

Query: 191 INGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANIN 250
           I     +    GI  +++ +LY++LI + +S PLGIASAIYL E++     +S +++ I 
Sbjct: 180 ITKVYYKTPGGGIRGSIISTLYLILISLLISLPLGIASAIYLHEYAKPNRLTSLIRSAIE 239

Query: 251 NLASVPSIVYGILGSAVLINF---FKMPRSTALVGGLILALMTLPSIIIATGVALRTVPS 307
            L  VPSI++G++G AVL      F    +  L+G   ++++ LP+II +T  AL  VP 
Sbjct: 240 MLTGVPSIIFGLMGVAVLFPITQLFGATTTNILLGSFTMSIILLPTIIRSTEEALIVVPQ 299

Query: 308 SIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYP 367
           S+R A+L +GA++ QT+F  VLP A+P ILTG  +S+ R +GE+A L++  M  +V D P
Sbjct: 300 SLRDASLSVGANQSQTIFKVVLPCAVPGILTGVLLSIGRVIGESAALIYT-MGTYVNDTP 358

Query: 368 VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKRW 425
             +    T+  V IY   +  +  F E      +++L+F+ ++N  +  L  +  K W
Sbjct: 359 T-LMSQGTSLAVHIYNIMSSEQPNF-ELASAISIVILVFVLILNICVKLLSKKLNKSW 414


>gi|188585608|ref|YP_001917153.1| phosphate ABC transporter, inner membrane subunit PstA
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179350295|gb|ACB84565.1| phosphate ABC transporter, inner membrane subunit PstA
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 305

 Score =  164 bits (415), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 86/244 (35%), Positives = 139/244 (56%), Gaps = 3/244 (1%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           F   +  F I     +    GI  A++G+ Y+ ++ +  S P+GI++AIYL E++ KG+F
Sbjct: 59  FEVISLEFLIERPLQQMTEGGIFPAILGTFYLSVLTLLFSLPIGISAAIYLHEWAGKGWF 118

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
              ++ +I NLA +PSIVYG+ G A+  +      S+ L   L L+LMTLP +I ++  A
Sbjct: 119 VRLIRLSIRNLAGIPSIVYGLFGLALFASGMGF-GSSLLSASLTLSLMTLPIVITSSEEA 177

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           L+ VP++ R AAL LGA++ +T+   VLP A+P + TGS + LARA GETAP++  G   
Sbjct: 178 LKGVPNNFRQAALSLGATRWETIKLQVLPYALPGMATGSILGLARAAGETAPIILTGAAY 237

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFV--ERTFGAILLLLIFLAVINTAMLWLRN 419
           ++   P  V D   A P  +Y+ A             FG  L+L++ +  +N+  + +R 
Sbjct: 238 YLPYLPESVFDRFMALPYHLYILATQHSDISTVRPIAFGTALVLILIVLTVNSVAILIRV 297

Query: 420 RFKK 423
           + +K
Sbjct: 298 KIRK 301


>gi|262276584|ref|ZP_06054393.1| phosphate transport system permease protein PstA [Grimontia
           hollisae CIP 101886]
 gi|262220392|gb|EEY71708.1| phosphate transport system permease protein PstA [Grimontia
           hollisae CIP 101886]
          Length = 531

 Score =  164 bits (415), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 73/299 (24%), Positives = 133/299 (44%), Gaps = 30/299 (10%)

Query: 156 YSPANVHRMSDYQWKWFQKLDSDGALFLDFNY-----GFFINGASSRPEVAGIGVAVVGS 210
                   ++          ++        ++      F            G+  A+ G+
Sbjct: 225 DRHGEPVTIALNDVLRLWYPNNMDWPEKLTHWAQQIAHFVTENPREANSEGGVFPAIFGT 284

Query: 211 LYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN 270
           + M+L++  +  PLG+ +A+YL E++ K  F+  ++  + NLA VPSIVYG+ G    + 
Sbjct: 285 VLMVLLMSVMVTPLGVLAAVYLHEYAGKNTFTRIIRIAVVNLAGVPSIVYGVFGLGFFVY 344

Query: 271 FFK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAAL 314
           F                        L   L LA++TLP +I++T   L  +P+S+R  ++
Sbjct: 345 FVGGSIDSLFYSDALPNPTFGTPGILWSSLTLAILTLPVVIVSTEEGLARIPTSVRHGSM 404

Query: 315 GLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG----- 369
            LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V      P+      
Sbjct: 405 ALGATQAETLWRIVLPMASPAIMTGLILAIARAAGEVAPLMLVGVVKVAPALPLDANFPF 464

Query: 370 --VTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             +          +Y     +          +   LLL+  +  +N A + +RN  +++
Sbjct: 465 LHLDRKFMHLGYHVYDVGFQSPNIEAARPLVYATSLLLVTVIVSLNLAAITIRNHLREK 523


>gi|312877062|ref|ZP_07737035.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796203|gb|EFR12559.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor lactoaceticus 6A]
          Length = 280

 Score =  164 bits (415), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 75/241 (31%), Positives = 127/241 (52%), Gaps = 5/241 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              +  F +       +  GI   +VG+LY+ L+ + ++ P+G+ +AIYL E++ KG   
Sbjct: 40  KGISLSFILQYPEEMGKSGGIFPVIVGTLYVTLLAVIIAAPVGVLAAIYLTEYAKKGKVV 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     LA +PSI+YG+ G A  +      R + L G L L++M LP+II  +  A+
Sbjct: 100 ELIRFGTETLAGIPSIIYGLFGFAFFVIALGF-RWSILSGALTLSIMILPTIIRTSEEAI 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S R  +L LGA+K QT+   V+P AMP ILTG  + + RA+GETA +L     + 
Sbjct: 159 KTVPMSFREGSLALGATKWQTIAKVVIPPAMPGILTGVILGVGRAIGETAAVLLTAGSSL 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             ++P  +        V +Y+    +E      ++    LL++ + +INT    +  R+ 
Sbjct: 219 --NFPTSIFSPTRTMSVHLYIL--SSEGLSKLNSYATATLLIVIVFIINTFANLIIRRYN 274

Query: 423 K 423
           +
Sbjct: 275 R 275


>gi|312793344|ref|YP_004026267.1| phosphate ABC transporter inner membrane subunit PstA
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312180484|gb|ADQ40654.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 280

 Score =  164 bits (415), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 75/241 (31%), Positives = 127/241 (52%), Gaps = 5/241 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              +  F +       +  GI   +VG+LY+ L+ + ++ P+G+ +AIYL E++ KG   
Sbjct: 40  KGISLSFILQYPEEMGKSGGIFPVIVGTLYVTLLAVIIAAPVGVLAAIYLTEYAKKGKVV 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     LA +PSI+YG+ G A  +      R + L G L L++M LP+II  +  A+
Sbjct: 100 ELIRFGTETLAGIPSIIYGLFGFAFFVIALGF-RWSILSGALTLSIMILPTIIRTSEEAI 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S R  +L LGA+K QT+   V+P AMP ILTG  + + RA+GETA +L     + 
Sbjct: 159 KTVPMSFREGSLALGATKWQTIAKVVIPPAMPGILTGVILGVGRAIGETAAVLLTAGSSL 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             ++P  +        V +Y+    +E      ++    LL++ + +INT    +  R+ 
Sbjct: 219 --NFPTSIFSPTRTMSVHLYIL--SSEGLSKLNSYATATLLIVIVFIINTFANLIIRRYN 274

Query: 423 K 423
           +
Sbjct: 275 R 275


>gi|39996199|ref|NP_952150.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Geobacter sulfurreducens PCA]
 gi|39982964|gb|AAR34423.1| phosphate ABC transporter, permease protein [Geobacter
           sulfurreducens PCA]
          Length = 306

 Score =  164 bits (415), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 91/255 (35%), Positives = 142/255 (55%), Gaps = 14/255 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
                 FF +  S  PE AGI  A VG++ +ML+   ++ PLG+A+ +YLEE++ K + +
Sbjct: 50  PRLKPHFFTSFPSRFPEEAGILSAWVGTILVMLVTAFVAVPLGVAAGVYLEEYAPKNWLT 109

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           + ++ N+ NLA VPSIV+G+L   + +      + + L  GL LAL+ LP +I+AT  +L
Sbjct: 110 AIIEINVTNLAGVPSIVFGLLALGLFVYQLNFGQ-SILSAGLTLALLILPIVIVATRESL 168

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP SIR AA  LGA++ Q V +HVLP +   ILTG  + L+RA+GETAP++ +G + F
Sbjct: 169 RAVPGSIREAAYALGATRWQMVSNHVLPYSSSGILTGVIIGLSRAIGETAPVITIGALTF 228

Query: 363 VTDYPVGVT-------------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAV 409
           +   P                 D  T  P+Q++ W +  E  F      A ++LL     
Sbjct: 229 IAFLPHSPISGQFPFISFEWLKDPFTVMPIQMFNWTSRPEEEFQLNAAAAGVVLLAMTLA 288

Query: 410 INTAMLWLRNRFKKR 424
           +N   ++LR   +K+
Sbjct: 289 MNAVAIFLRYHIRKK 303


>gi|238783839|ref|ZP_04627857.1| Phosphate ABC transporter, permease protein PstA [Yersinia
           bercovieri ATCC 43970]
 gi|238715226|gb|EEQ07220.1| Phosphate ABC transporter, permease protein PstA [Yersinia
           bercovieri ATCC 43970]
          Length = 532

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 75/262 (28%), Positives = 129/262 (49%), Gaps = 25/262 (9%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F  +   +     G+  A+ G++ M++++  +  PLG+ +A+YL E++ K + +  ++ 
Sbjct: 265 QFLTDNPRNASTEGGVFPAIFGTVLMVILMSIVVMPLGVIAAVYLHEYAGKNWLTRMIRI 324

Query: 248 NINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMT----------------L 291
           ++ NLA VPSIVYG+ G    + F             + +                   L
Sbjct: 325 SVVNLAGVPSIVYGVFGLGFFVYFIGGSLDKLFYPEALPSPTFGTPGVLWAALTLALLTL 384

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I+AT   L  +P+S+R  +  LGASK +T++H VLP+A PA++TG  +++ARA GET
Sbjct: 385 PVVIVATEEGLARIPASLRQGSQALGASKAETLWHIVLPMAAPAMITGLILAVARAAGET 444

Query: 352 APLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILL 402
           APL+ VG+V      PV        +         QIY  A  +          F   LL
Sbjct: 445 APLMLVGVVKSAPLLPVDGIFPFLHLERKFMHLSFQIYDMAFQSPNVEAARPLVFAIALL 504

Query: 403 LLIFLAVINTAMLWLRNRFKKR 424
           L+I +  +N A + +R+  +++
Sbjct: 505 LVIIVVGLNLAAIGIRHHLREK 526


>gi|154494330|ref|ZP_02033650.1| hypothetical protein PARMER_03685 [Parabacteroides merdae ATCC
           43184]
 gi|154085774|gb|EDN84819.1| hypothetical protein PARMER_03685 [Parabacteroides merdae ATCC
           43184]
          Length = 295

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 82/243 (33%), Positives = 129/243 (53%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F            GI  A+VG+ Y+++    +SFP+GI S IY+ E++  G    
Sbjct: 50  VISWDFLTKAPEEGMTKGGIFPAIVGTFYLIVGSSIISFPIGIMSGIYMNEYATNGKVVR 109

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ VPS+V+G+ G ++ +N       + + G   LALM+LP II  T  AL+
Sbjct: 110 FIRIMTNNLSGVPSVVFGLFGMSLFVNALGW-GDSIIAGSFTLALMSLPLIIRTTEEALK 168

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           ++  S R  +L LGA+K+QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F+
Sbjct: 169 SIDDSFRHGSLALGATKLQTIRRVVLPMAFPNIITGLILSVGRVSGETAPILFTVAAYFL 228

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +             +G  L+L+  + V+N     LRN F
Sbjct: 229 PQLPGSIFDQCMALPYHLYVISTSGTDIEASRGMAYGTALVLIAIVLVVNLLANLLRNYF 288

Query: 422 KKR 424
            K+
Sbjct: 289 AKK 291


>gi|326331971|ref|ZP_08198257.1| phosphate ABC transporter, permease protein PstA [Nocardioidaceae
           bacterium Broad-1]
 gi|325950284|gb|EGD42338.1| phosphate ABC transporter, permease protein PstA [Nocardioidaceae
           bacterium Broad-1]
          Length = 351

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 113/237 (47%), Gaps = 2/237 (0%)

Query: 181 LFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGF 240
           +  +F      +   +  E  G+  A+ G+L +  I   +S P+GI +AIYL E+     
Sbjct: 107 INPEFLTYSMRSV--TGDEQGGLYHALTGTLIVTGIAALISIPIGIMTAIYLIEYGKGNR 164

Query: 241 FSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGV 300
            +  +   ++ +  +PSIV G+   A+              GG+ L+L+ +P+++ +T  
Sbjct: 165 LAKAITFLVDVMTGIPSIVAGLFAFALFTLIVGPGTRFGFGGGVALSLLMIPTVVRSTEE 224

Query: 301 ALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMV 360
            L+ VP  +R AA  LG  K +T+   VLP A+  I+TG  ++++R +GETAPLL     
Sbjct: 225 MLKLVPDDLREAAYALGVPKWRTITRMVLPTAIGGIVTGVVLAISRVIGETAPLLVASGF 284

Query: 361 AFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
               +            PV IY   ++A    VE  +G  L+L I + V+N     +
Sbjct: 285 NPNMNTSAFDDSPMMTVPVFIYTQLSEATHKGVEYAWGGALVLFILVMVLNLIARIV 341


>gi|254490338|ref|ZP_05103527.1| phosphate ABC transporter, permease protein PstA, putative
           [Methylophaga thiooxidans DMS010]
 gi|224464471|gb|EEF80731.1| phosphate ABC transporter, permease protein PstA, putative
           [Methylophaga thiooxydans DMS010]
          Length = 561

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 77/262 (29%), Positives = 128/262 (48%), Gaps = 25/262 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            GI  A+ G++ M++I+  +  P G+ +A+YL+E++ +G     ++
Sbjct: 293 WEFVSGDPREANTEGGIFPAIFGTVMMVIIMAIMVTPFGVVAAVYLKEYAKQGPVIRLIR 352

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             +NNLA VPSIVYG+ G    + F                        L   L LA++T
Sbjct: 353 IAVNNLAGVPSIVYGVFGLGFFVYFVGGSIDELLFQAKLPSPTFGSPGLLWASLTLAILT 412

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           +P +I+AT   L  +P +IR  +L LGA+K +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 413 VPVVIVATEEGLSRIPRAIREGSLALGATKAETLWRTVLPMAAPAMMTGLILAVARAAGE 472

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAIL 401
            APL+ VG+V      PV        +          IY     +          +    
Sbjct: 473 VAPLMMVGVVKLAPALPVDNIAPYLHLDRQFMHLGFHIYDVGFQSPNVEAARPLVYATAF 532

Query: 402 LLLIFLAVINTAMLWLRNRFKK 423
           LL++ + V+N A + +RNR ++
Sbjct: 533 LLVLIIIVLNMAAIGIRNRLRE 554


>gi|53714047|ref|YP_100039.1| putative ABC transporter permease [Bacteroides fragilis YCH46]
 gi|60682242|ref|YP_212386.1| phosphate transport system permease protein [Bacteroides fragilis
           NCTC 9343]
 gi|253564689|ref|ZP_04842145.1| phosphate transport system permease [Bacteroides sp. 3_2_5]
 gi|265766334|ref|ZP_06094375.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_16]
 gi|52216912|dbj|BAD49505.1| putative ABC transporter permease protein [Bacteroides fragilis
           YCH46]
 gi|60493676|emb|CAH08465.1| phosphate transport system permease protein [Bacteroides fragilis
           NCTC 9343]
 gi|251946154|gb|EES86531.1| phosphate transport system permease [Bacteroides sp. 3_2_5]
 gi|263254002|gb|EEZ25467.1| phosphate ABC transporter, permease PstA [Bacteroides sp. 2_1_16]
 gi|301163720|emb|CBW23274.1| phosphate transport system permease protein [Bacteroides fragilis
           638R]
          Length = 291

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 134/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F     +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG    
Sbjct: 46  VISWDFLTTAPTDGMTGGGIWPAIVGTFYLMVGSALFAFPVGVMSGIYMNEYAPKGKLVR 105

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 106 FIRVMTNNLSGIPSIVFGLFGMALFVNYMDF-GDSILAGSLTLGLLCVPLVIRTTEEALK 164

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P S+R  +  LGA+K+QT++H +LP+ MP I+TG  ++L R  GETAP+LF     F+
Sbjct: 165 AIPDSMREGSRALGATKLQTIWHVILPMGMPNIITGLILALGRVSGETAPILFTCAAYFL 224

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 225 PQLPTSILDQCMALPYHLYVISTSGTDMEAQLPLAYGTALVLIVIILLVNLLANALRKYF 284

Query: 422 KKR 424
           +K+
Sbjct: 285 EKK 287


>gi|308050092|ref|YP_003913658.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Ferrimonas balearica DSM 9799]
 gi|307632282|gb|ADN76584.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Ferrimonas balearica DSM 9799]
          Length = 281

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 74/242 (30%), Positives = 127/242 (52%), Gaps = 5/242 (2%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS-HKGFFS 242
             ++GF  N  +   E +GI   ++G++YM+++ I ++ P+GI +AIYL E++       
Sbjct: 40  HVDWGFITNNYTRTGEESGIWPMIMGTIYMVIVSILIAGPIGIMTAIYLTEYAKPGSKLV 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++    +LA +PSI+YG+ G    +    +   + L G L LA++ LP II  T  A+
Sbjct: 100 KVIRFCTESLAGIPSIIYGLFGLTFFVTILGL-GFSILSGALTLAILILPVIIRTTEEAI 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
             VP + R A+ GLGAS++ TV+  +LP AMP I+T   +S+ R +GE+AP+      A+
Sbjct: 159 IAVPLAYREASFGLGASRLYTVWRVILPSAMPGIVTSLILSIGRIIGESAPVFLTAGTAY 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPF-VERTFGAILLLLIFLAVINTAMLWLRNRF 421
           +   P  V D      V +Y+   +       +  F    +L++ +  IN     + +RF
Sbjct: 219 L--MPDSVMDSIRTLTVHLYMLTTELYTQHDWDMAFATATVLIVVVLGINLITKLISSRF 276

Query: 422 KK 423
            K
Sbjct: 277 SK 278


>gi|59712591|ref|YP_205367.1| phosphate transport system permease protein PstA [Vibrio fischeri
           ES114]
 gi|59480692|gb|AAW86479.1| phosphate transport system permease protein PstA [Vibrio fischeri
           ES114]
          Length = 511

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 73/261 (27%), Positives = 122/261 (46%), Gaps = 25/261 (9%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F            G+  A+ G++ ++L++  +  PLG+ +AIYL E++     +  ++  
Sbjct: 245 FVSEPPREANSEGGVFPAIFGTILLVLLMSVIVMPLGVIAAIYLHEYAKPNVLTRLIRIA 304

Query: 249 INNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTLP 292
           + NLA VPSIVYG+ G    +                          L   L LA++TLP
Sbjct: 305 VINLAGVPSIVYGVFGLGFFVYVVGGTLDQLFYSNELPTPTFGTPGLLWSALTLAILTLP 364

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +I+AT   L  +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE A
Sbjct: 365 VVIVATEEGLSRIPNSVRHGSLALGATQFETLWKIVLPMASPAIMTGLILAVARAAGEVA 424

Query: 353 PLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFVERTFGAILLL 403
           PL+ VG+V      PV                   IY     +          +    LL
Sbjct: 425 PLMLVGVVKLAPSLPVDSVAPYLHLDRKFMHLGYHIYDVGFQSPNVEAARPIVYATAFLL 484

Query: 404 LIFLAVINTAMLWLRNRFKKR 424
           +  +  +N A + +RN  +++
Sbjct: 485 VTVIIGLNLAAIAIRNNLREK 505


>gi|300717932|ref|YP_003742735.1| phosphate ABC transporter permease subunit [Erwinia billingiae
           Eb661]
 gi|299063768|emb|CAX60888.1| Phosphate ABC transporter, permease subunit [Erwinia billingiae
           Eb661]
          Length = 548

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 84/263 (31%), Positives = 133/263 (50%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G++ M+L++  +  PLG+ +AI+L E++  G  +  V+
Sbjct: 280 WHFVSGTQGDSLGEGGVFPAIFGTVLMVLLMSIVVMPLGVIAAIWLHEYAGNGLMTRLVR 339

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             + NLA VPSIVYG+ G    +                          L   L LAL+T
Sbjct: 340 IAVVNLAGVPSIVYGVFGLGFFVWLVGGSLDKLFFADALPDPTFGTPGLLWASLTLALLT 399

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+AT   L  +P S+R  +L LGA++ +T++H  LPLA+PA+LTG  +++ARA GE
Sbjct: 400 LPVVIVATEEGLSRIPKSLRQGSLALGATQAETLWHVTLPLAVPAMLTGLILAVARAAGE 459

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAERPFVER--TFGAIL 401
           TAPL+ VG+V  V + P+        +         QIY  A  +     +R   F   L
Sbjct: 460 TAPLMLVGVVKMVPELPIDAVFPYLHLDRKFMHLGFQIYDLAFQSPNAQADRPLVFATAL 519

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + LR+R ++R
Sbjct: 520 LLVTIILALNLLAMVLRHRLRER 542


>gi|319425838|gb|ADV53912.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           putrefaciens 200]
          Length = 552

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 87/391 (22%), Positives = 158/391 (40%), Gaps = 35/391 (8%)

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
                +    K   +    +   +Y     + L  K    + +  L       L+T    
Sbjct: 164 HIDRAVALSDKALKLQKQDIGAINY---AIERLRLKERRYELDGELTDSRKSELATAKEA 220

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
             +  L+ +  L   T+       + I   ++G       +   S     +   L   G 
Sbjct: 221 LQKDYLVLEKELF--TLRDEAARDSVIVRDMRGV---EVELKLDSVLDVTYVNHLGLLGK 275

Query: 181 LFLDF--NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           +   F     F  +         G+  A+ G+++M+L++  +  P G+ +AIYL E++ K
Sbjct: 276 VRHWFVGLGRFMKDDPREANTEGGVFPAIFGTVFMVLLMAIIVTPFGVVAAIYLHEYAKK 335

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVG 282
           G  +  ++  + NLA VPSIVYG+ G    +                          +  
Sbjct: 336 GPITKMIRIAVINLAGVPSIVYGVFGLGFFVYMMGGSIDQLFYAEALPAPTFGSPGVIWS 395

Query: 283 GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV 342
            L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  V+P+A PAI+TG  +
Sbjct: 396 ALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVIPMASPAIMTGLIL 455

Query: 343 SLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFV 393
           ++ARA GE APL+ VG+V      P+                   IY     +       
Sbjct: 456 AVARAAGEVAPLMLVGVVKLAPTLPLDFNFPFVHLERKFMHLGFHIYDVGFQSPNVEAAR 515

Query: 394 ERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              +    LL+  +  +N   + +RN  +++
Sbjct: 516 PLVYATSFLLVTVIVALNLTAISVRNHLREK 546


>gi|218262380|ref|ZP_03476866.1| hypothetical protein PRABACTJOHN_02540 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223414|gb|EEC96064.1| hypothetical protein PRABACTJOHN_02540 [Parabacteroides johnsonii
           DSM 18315]
          Length = 295

 Score =  164 bits (414), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 82/243 (33%), Positives = 129/243 (53%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F            GI  A+VG+ Y+++    +SFP+GI S IY+ E++  G    
Sbjct: 50  VISWDFLTKAPEEGMTKGGIFPAIVGTFYLIVGSSIISFPIGIMSGIYMNEYATNGKVVR 109

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ VPS+V+G+ G ++ +N       + + G   LALM+LP II  T  AL+
Sbjct: 110 FIRIMTNNLSGVPSVVFGLFGMSLFVNALGW-GDSIIAGSFTLALMSLPLIIRTTEEALK 168

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           ++  S R  +L LGA+K+QT+   VLP+A P I+TG  +S+ R  GETAP+LF     F+
Sbjct: 169 SIDDSFRHGSLALGATKLQTIRRVVLPMAFPNIITGLILSVGRVSGETAPILFTVAAYFL 228

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +             +G  L+L+  + V+N     LRN F
Sbjct: 229 PQLPGSIFDQCMALPYHLYVISTSGTDIEASRGMAYGTALVLIAIVLVVNLLANLLRNYF 288

Query: 422 KKR 424
            K+
Sbjct: 289 AKK 291


>gi|317129721|ref|YP_004096003.1| phosphate ABC transporter inner membrane subunit PstA [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474669|gb|ADU31272.1| phosphate ABC transporter, inner membrane subunit PstA [Bacillus
           cellulosilyticus DSM 2522]
          Length = 307

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 157/243 (64%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  N  S+ PE AGI  A+VG++++M+IV  L+  LGI +AIYLEE++ KG   S
Sbjct: 65  WISIDFLTNKLSTLPERAGIFGAIVGTIWLMVIVGPLTMLLGIGTAIYLEEYAKKGKVHS 124

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F+Q NI NLA VPSIV+G+LG  + +  F     + + GG+ ++L+ LP +++A   A+R
Sbjct: 125 FIQTNITNLAGVPSIVFGLLGLTIFVRMFGF-GPSIIAGGMTMSLLVLPIVVVAAQEAIR 183

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
           +VP  +R A+ G+GA+K QT+ + VLP ++  ILTG  ++L+RA+GETAPL+ +G+ A +
Sbjct: 184 SVPQHLREASYGMGATKWQTIKNIVLPASIAGILTGVILALSRAIGETAPLVALGIPALI 243

Query: 364 TDYPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P GV D  T  P+QIY W  D+     + +     I++LLI L ++N+  + +RN+F
Sbjct: 244 IPIPGGVMDNFTVLPMQIYYWTIDSVLVDEYAQMAAATIIVLLIILFLMNSIAIIIRNKF 303

Query: 422 KKR 424
           + R
Sbjct: 304 QNR 306


>gi|220903840|ref|YP_002479152.1| phosphate ABC transporter inner membrane subunit PstA
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868139|gb|ACL48474.1| phosphate ABC transporter, inner membrane subunit PstA
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 306

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 83/244 (34%), Positives = 134/244 (54%), Gaps = 3/244 (1%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F      S     GI   ++G+  + L  + L+FPLG+ASA+YL E++ +  F+
Sbjct: 63  PALSWEFISQSPRSMMTEGGILPCIIGTAILSLGALLLAFPLGVASAVYLHEYAKRNAFA 122

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
            +V+  +NNLA VPS+V+G+ G +  + F  +   + L G L LA++TLP II     AL
Sbjct: 123 RYVRLGVNNLAGVPSVVFGLFGLSFFVTFCGLGV-SILSGVLTLAVLTLPVIIGTAEEAL 181

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           R VP + R A+L LGA+K QT+   VLP A+P +LTG+ + +ARA GETA ++F   V +
Sbjct: 182 RNVPDTYREASLALGATKSQTISRVVLPCALPGMLTGAILGVARAAGETAAIMFTAAVFY 241

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERP--FVERTFGAILLLLIFLAVINTAMLWLRNR 420
               P  +     A P  +Y+ A             +G  L+LL+ +  +N   + LR+ 
Sbjct: 242 TPKTPDSIFSSVMALPYHMYVLATAGTEIEKTRPLQYGTGLVLLLLVLGMNLVAILLRDH 301

Query: 421 FKKR 424
            +++
Sbjct: 302 LQRK 305


>gi|222529155|ref|YP_002573037.1| phosphate ABC transporter inner membrane subunit PstA
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222456002|gb|ACM60264.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 280

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 75/241 (31%), Positives = 127/241 (52%), Gaps = 5/241 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              +  F +       +  GI   +VG+LY+ L+ + ++ P+G+ +AIYL E++ KG   
Sbjct: 40  KGISLNFILQYPEEMGKSGGIFPVIVGTLYVTLLAVIIASPVGVLAAIYLTEYAKKGKVV 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     LA +PSI+YG+ G A  +      R + L G L L++M LP+II  +  A+
Sbjct: 100 ELIRFGTETLAGIPSIIYGLFGFAFFVIALGF-RWSILSGALTLSIMILPTIIRTSEEAI 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S R  +L LGA+K QT+   V+P AMP ILTG  + + RA+GETA +L     + 
Sbjct: 159 KTVPMSFREGSLALGATKWQTIAKVVIPPAMPGILTGVILGVGRAIGETAAVLLTAGSSL 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             ++P  +        V +Y+    +E      ++    LL++ + +INT    +  R+ 
Sbjct: 219 --NFPTSIFSPTRTMSVHLYIL--SSEGLSKLNSYATATLLIVIVFIINTFANMIIRRYN 274

Query: 423 K 423
           +
Sbjct: 275 R 275


>gi|163802445|ref|ZP_02196338.1| phosphate ABC transporter, permease protein [Vibrio sp. AND4]
 gi|159173746|gb|EDP58561.1| phosphate ABC transporter, permease protein [Vibrio sp. AND4]
          Length = 557

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 80/338 (23%), Positives = 143/338 (42%), Gaps = 37/338 (10%)

Query: 124 KTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKW-------FQKLD 176
             L+ +     +         + +D    G+      V  M+  Q          +   +
Sbjct: 213 DFLLDNNQRKSEIEAELAKLDSQLDGLRLGFSDYTLIVEDMTGAQVSIPLEDILDYWHPN 272

Query: 177 SDGALFLDFNYG-----FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIY 231
                    ++G     F   G        G+  A+ G++++++I+  +  PLG+ +AIY
Sbjct: 273 QMSLPEKVAHWGKQVWKFLSEGPRESNSEGGVFPAIFGTVFLVIIMSIIVMPLGVVAAIY 332

Query: 232 LEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----------------MP 275
           L E++     +  ++  + NLA VPSIVYG+ G    +                      
Sbjct: 333 LHEYAKNNALTRMIRIAVINLAGVPSIVYGVFGLGFFVYTIGASIDNVFYAERLPAPTFG 392

Query: 276 RSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPA 335
               L   L LA++TLP +I+ T   L  +PSS+R  +L LGA++ +T++  VLP+A PA
Sbjct: 393 TPGLLWSALTLAVLTLPVVIVTTEEGLTRIPSSVRHGSLALGATQFETLWRVVLPMATPA 452

Query: 336 ILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAA 386
           I+TG  +++ARA GE APL+ VG+V   +  PV        +         Q+Y   +  
Sbjct: 453 IITGLILAVARAAGEVAPLMLVGVVKLASSLPVDGQFPYVHLDRKFMHLGFQVYDVGFQT 512

Query: 387 DAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                     +    LL+  +  +N   + +RN  +++
Sbjct: 513 SNIEAARPLVYATSFLLVTVIVGLNLTAISIRNNLREK 550


>gi|158333403|ref|YP_001514575.1| phosphate ABC transporter permease PstA [Acaryochloris marina
           MBIC11017]
 gi|158303644|gb|ABW25261.1| phosphate ABC transporter, permease protein PstA [Acaryochloris
           marina MBIC11017]
          Length = 311

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 154/245 (62%), Gaps = 6/245 (2%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             +  F  +  S +   AG+  A++G+++++ I   ++FP+G+ S I+LEEF+    F+ 
Sbjct: 63  SLSVDFLTSPPSRKAAKAGLWPALMGTVWLLCITAAVAFPIGVGSGIFLEEFAPDNLFTR 122

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFK--MPRSTALVGGLILALMTLPSIIIATGVA 301
            ++ N+ NLA+VPSIVYG+LG  V ++  +     S+ L GGL LAL+ LP II++T  A
Sbjct: 123 IIEINVGNLAAVPSIVYGLLGLTVFVDIMRPITGGSSVLAGGLTLALLILPIIIVSTREA 182

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
           LR VPSS+R     LGA++ Q +   V P ++P ILTG+ ++L+RA+GETAP+L VG   
Sbjct: 183 LRAVPSSLRQGGFALGATRWQVIRDLVFPQSLPGILTGTILALSRAIGETAPILVVGAAG 242

Query: 362 FVTDYP----VGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWL 417
           ++   P     G+    TA P+QIY+W A A++ F     G I++LL+ L ++NT  + L
Sbjct: 243 YIAFAPPLSLEGLQSDFTALPIQIYVWIARAQKSFEPIAAGGIIILLVVLLLMNTTAILL 302

Query: 418 RNRFK 422
           RN+F+
Sbjct: 303 RNKFQ 307


>gi|260776655|ref|ZP_05885550.1| phosphate transport system permease protein PstA [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607878|gb|EEX34143.1| phosphate transport system permease protein PstA [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 548

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 84/363 (23%), Positives = 148/363 (40%), Gaps = 28/363 (7%)

Query: 89  VRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGK--TVEVSLLASAN 146
           V  A A +L +      L  +                 +    +  +   + + L     
Sbjct: 180 VISAQADRLRLEKKRRELNGRLDAEFIKRYDAQSSMFSLQLAEMESQLDALRLELEQQGL 239

Query: 147 IDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVA 206
           I   +KG  Y       +  +       ++          + F  +         G+  A
Sbjct: 240 IVEDMKGNQYRIPLSRILDVWYPNQMTIVEKVAQWAHQ-AWKFLSDDPRESNSEGGVFPA 298

Query: 207 VVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSA 266
           + G++ ++LI+  +  PLG+ +AIYL E++    F+  ++  + NLA VPSIVYG+ G  
Sbjct: 299 MFGTVLLVLIMSIIVMPLGVIAAIYLHEYAKNNAFTRLIRVAVINLAGVPSIVYGVFGLG 358

Query: 267 VLINFFKMPRSTALVGG----------------LILALMTLPSIIIATGVALRTVPSSIR 310
             +        +                     L LA++TLP +I+AT   L  +PSS+R
Sbjct: 359 FFVYTLGGSIDSLFYAEKLPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLTRIPSSVR 418

Query: 311 SAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG- 369
             +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG V   +  PV  
Sbjct: 419 HGSLALGATQFETMWRIVLPMASPAIITGLILAVARAAGEVAPLMLVGAVKLASSLPVDS 478

Query: 370 ------VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
                 +          IY   +            +    LL+  +  +N   + +RN  
Sbjct: 479 QFPFLHLDRKFMHLGFHIYDVGFQTTNIESARPLVYATSFLLVSVIVGLNLTAISIRNNL 538

Query: 422 KKR 424
           +++
Sbjct: 539 REK 541


>gi|266623751|ref|ZP_06116686.1| phosphate ABC transporter, permease protein PstA [Clostridium
           hathewayi DSM 13479]
 gi|288864451|gb|EFC96749.1| phosphate ABC transporter, permease protein PstA [Clostridium
           hathewayi DSM 13479]
          Length = 300

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 75/243 (30%), Positives = 127/243 (52%), Gaps = 6/243 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F     S+     GI   +V +LY+++I + ++ PLG+ +AIYL E++  G   
Sbjct: 59  PQINWEFLSTVPSTIRGTFGILGNIVNTLYIVVITLLIATPLGVGAAIYLNEYAKGGRAV 118

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     L+ +PSI++G+ G         +   + L G L L++M LP I   T  AL
Sbjct: 119 CLIEFTTETLSGIPSIIFGLFGYVFFGTTLGLGY-SILTGALTLSIMVLPLITRTTQEAL 177

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S RS ALG+GA+K   +   +LP AMP I+TG  +++ R +GE+A LLF     +
Sbjct: 178 KTVPDSYRSGALGIGATKWYMIRTILLPSAMPGIVTGVILAIGRIVGESAALLFTAGSGY 237

Query: 363 --VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNR 420
               D+   + +      +Q+YL      +   ++ FG  ++LL+ +  IN    +L ++
Sbjct: 238 LLAKDFFGKIFESGGTLTIQLYLSMQ---KAKYDQAFGIAVVLLLIVLAINGLAKYLSHK 294

Query: 421 FKK 423
           F K
Sbjct: 295 FNK 297


>gi|120599467|ref|YP_964041.1| phosphate ABC transporter inner membrane subunit PstA [Shewanella
           sp. W3-18-1]
 gi|120559560|gb|ABM25487.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           sp. W3-18-1]
          Length = 552

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 87/391 (22%), Positives = 158/391 (40%), Gaps = 35/391 (8%)

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
                +    K   +    +   +Y     + L  K    + +  L       L+T    
Sbjct: 164 HIDRAVALSDKALKLQKQDIGAINY---AIERLRLKERRYELDGELTDSRKSELATAKEA 220

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
             +  L+ +  L   T+       + I   ++G       +   S     +   L   G 
Sbjct: 221 LQKDYLVLEKELF--TLRDEAARDSVIVRDMRGV---EVELKLDSVLDVTYVNHLGLLGK 275

Query: 181 LFLDF--NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           +   F     F  +         G+  A+ G+++M+L++  +  P G+ +AIYL E++ K
Sbjct: 276 VRHWFVGLGRFMKDDPREANTEGGVFPAIFGTVFMVLLMAIIVTPFGVVAAIYLHEYAKK 335

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVG 282
           G  +  ++  + NLA VPSIVYG+ G    +                          +  
Sbjct: 336 GPITKMIRIAVINLAGVPSIVYGVFGLGFFVYMMGGSIDQLFYAEALPAPTFGSPGVIWS 395

Query: 283 GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV 342
            L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  V+P+A PAI+TG  +
Sbjct: 396 ALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVIPMASPAIMTGLIL 455

Query: 343 SLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFV 393
           ++ARA GE APL+ VG+V      P+                   IY     +       
Sbjct: 456 AVARAAGEVAPLMLVGVVKLAPTLPLDFNFPFVHLERKFMHLGFHIYDVGFQSPNVEAAR 515

Query: 394 ERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              +    LL+  +  +N   + +RN  +++
Sbjct: 516 PLVYATSFLLVTVIVALNLTAISVRNHLREK 546


>gi|56461207|ref|YP_156488.1| ABC-type phosphate transport system, permease [Idiomarina
           loihiensis L2TR]
 gi|56180217|gb|AAV82939.1| ABC-type phosphate transport system, permease component [Idiomarina
           loihiensis L2TR]
          Length = 551

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 71/284 (25%), Positives = 126/284 (44%), Gaps = 27/284 (9%)

Query: 168 QWKWFQKLDSDGALFLDFN--YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
              +   +     +   F     F            G+  A+ G+++M+L++  +  P G
Sbjct: 262 DVNFPNDMGFFSKIGHFFQQIGKFVSEPPREANTEGGVFPAIFGTVFMVLLMSIIVTPFG 321

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK------------ 273
           + +A+YL E++ K   +  ++  + NLA VPSIVYG+ G    +                
Sbjct: 322 VIAAVYLHEYAGKNAVTKLIRIAVINLAGVPSIVYGVFGLGFFVYMVGGSLDQVFYPEAL 381

Query: 274 ----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVL 329
                     L   + LA++TLP +I++T   L  +P S+R  +L LGA+K +T++  VL
Sbjct: 382 PSPTFGTPGVLWSAVTLAILTLPVVIVSTEEGLSRIPPSLREGSLSLGATKWETIWRIVL 441

Query: 330 PLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIY 382
           P+A PAI+TG  +++ARA GE APL+ VG+V      P+        +          IY
Sbjct: 442 PMASPAIMTGLILAVARAAGEVAPLMLVGVVKSAPMLPLDGNFPYFHLDRKFMHLGFHIY 501

Query: 383 LWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                +          +    LL+  +  +N   + +RN  +++
Sbjct: 502 DVGFQSPNVEAARPLVYATSFLLITVIVGLNLTAIGVRNHLREK 545


>gi|157962565|ref|YP_001502599.1| phosphate ABC transporter inner membrane subunit PstA [Shewanella
           pealeana ATCC 700345]
 gi|157847565|gb|ABV88064.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           pealeana ATCC 700345]
          Length = 550

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 91/408 (22%), Positives = 175/408 (42%), Gaps = 43/408 (10%)

Query: 45  SKGIGALWQTHISLPIEFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNH 104
           S+ I A +Q+HI+  +E ++  +D Q        ++   +Y L   +  +R+  + ++  
Sbjct: 152 SQDIEADFQSHINRAVELNDEALDIQ------KGVIGSINYELENLRLKSRRYELDNALT 205

Query: 105 ALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRM 164
              +   +  S                 + +    +L   A  DS +   +       ++
Sbjct: 206 ETRKAEIEAASAKLNAEYL---------VVEKEFFALKTQAGRDSVVIRDMRGEEVTLKL 256

Query: 165 SDY-QWKWFQKLDSDGALFLDF--NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLS 221
                  +  +L   G +   F     F  +         G+  A+ G+++M++++  + 
Sbjct: 257 DTILDVTYANRLGLMGRIGHWFIGVGKFVSDDPREANTEGGVFPAIFGTVFMVMLMAVIV 316

Query: 222 FPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK-------- 273
            P G+ +AIYL E++ KG  +  ++  + NLA VPSIVYG+ G    +  F         
Sbjct: 317 TPFGVIAAIYLHEYAKKGPVTKMIRIAVINLAGVPSIVYGVFGLGFFVYMFGGTLDQLFY 376

Query: 274 --------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVF 325
                         +   L LA++TLP +I++T   L  +PSS+R  +L LGA+K +T++
Sbjct: 377 PEALPAPTFGSPGVIWSALTLAILTLPVVIVSTEEGLSRIPSSVRQGSLALGATKAETLW 436

Query: 326 HHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFP 378
             ++P+A PAI+TG  +++ARA GE APL+ VG+V      P+ +               
Sbjct: 437 RIIIPMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLPIDMNFPFVHLERKFMHLG 496

Query: 379 VQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             IY     +          +    LL+  +  +N   + +RN  +++
Sbjct: 497 FHIYDVGFQSPNVEAARPLVYATSFLLVSVIVALNLTAIGVRNHLREK 544


>gi|189467050|ref|ZP_03015835.1| hypothetical protein BACINT_03433 [Bacteroides intestinalis DSM
           17393]
 gi|189435314|gb|EDV04299.1| hypothetical protein BACINT_03433 [Bacteroides intestinalis DSM
           17393]
          Length = 286

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 136/243 (55%), Gaps = 3/243 (1%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSS 243
             ++ F     +      GI  A+VG+ Y+M+     +FP+G+ S IY+ E++ KG+   
Sbjct: 41  VISWEFLTTAPTDGMTAGGIFPAIVGTFYLMIGSALFAFPVGVMSGIYMNEYAPKGWVVR 100

Query: 244 FVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALR 303
           F++   NNL+ +PSIV+G+ G A+ +N+      + L G L L L+ +P +I  T  AL+
Sbjct: 101 FIRMMTNNLSGIPSIVFGLFGMALFVNYMGF-GDSILAGSLTLGLLCVPLVIRTTEEALK 159

Query: 304 TVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFV 363
            +P ++R  +  LGA+K+QT++H VLP+AMP ++TG  ++L R  GETAP+LF     F+
Sbjct: 160 AIPDTLREGSRALGATKLQTIWHVVLPMAMPNVITGLILALGRVSGETAPILFTCAAYFL 219

Query: 364 TDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRF 421
              P  + D   A P  +Y+ +         +   +G  L+L++ + ++N     LR  F
Sbjct: 220 PQLPTSILDQCMALPYHLYVISTSGTDMDAQLPLAYGTALVLIVIILLVNLLANALRKYF 279

Query: 422 KKR 424
           +K+
Sbjct: 280 EKK 282


>gi|332686418|ref|YP_004456192.1| phosphate transport system permease PstA [Melissococcus plutonius
           ATCC 35311]
 gi|332370427|dbj|BAK21383.1| phosphate transport system permease protein PstA (TC 3.A.1.7.1)
           [Melissococcus plutonius ATCC 35311]
          Length = 294

 Score =  163 bits (413), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 65/254 (25%), Positives = 120/254 (47%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F    + +     GIG+ +  SLY+++I + +SFP+ + + IYL E++ K + +
Sbjct: 38  PHVSWHFLTRHSKAYQSGGGIGIQLFNSLYLLIITMLISFPISLGAGIYLSEYAEKNWLT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             V+++I  L+S+PS+V G+ G  + +        + + G L L    LP +      +L
Sbjct: 98  DIVRSSIEILSSLPSVVVGLFGFLIFVIQIG-YGFSIISGALALTFFNLPLLTRNVEESL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM--- 359
           + V  + R A L LG SK +TV   V+P A+P I+TG  +S  R  GE A L++      
Sbjct: 157 KAVHYTQREAGLSLGLSKWETVIRVVVPEALPGIITGVILSSGRIFGEAAALIYTAGQSA 216

Query: 360 --------VAFVTDYPVGVTDIATAFPVQIYLWAADAE-RPFVERTFGAILLLLIFLAVI 410
                          P+ +   A    V I+    +      V+ + GA  +L++ + + 
Sbjct: 217 PPLDFSNWNPLSVSSPISIFRQAETLAVHIWKVNTEGTMPDSVQVSAGASAVLILVVLLF 276

Query: 411 NTAMLWLRNRFKKR 424
           N    ++ N+  K+
Sbjct: 277 NLGARFIGNKLYKK 290


>gi|309390010|gb|ADO77890.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Halanaerobium praevalens DSM 2228]
          Length = 283

 Score =  163 bits (413), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 90/240 (37%), Positives = 151/240 (62%), Gaps = 1/240 (0%)

Query: 185 FNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSF 244
            ++ FF    S  P  AGI   + G++Y++ ++I ++F +G A+AIYLEE++ +   +  
Sbjct: 45  LDWEFFTRFDSRFPAKAGIKAGLFGTIYVIGLMIPITFSVGTATAIYLEEYAPENKLTDL 104

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++ NI NLA +PSI+YG+LG  V + +  M R + L G L L+L+ LP +I++   +L++
Sbjct: 105 IKLNIANLAGIPSIIYGMLGLGVFVRYLNMGR-SVLAGALTLSLLVLPVVIVSAQESLKS 163

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S+R+A+  LGA+   TV+  VLP A+P+ILTG  ++++RA+GETAPL+ +G + FV 
Sbjct: 164 VPDSLRNASYALGANHWHTVYRVVLPSALPSILTGFILAISRAIGETAPLIMMGALTFVM 223

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
             P G+ D  T  P+QI+ W +  +  F        LLLLI L ++N    ++R ++ ++
Sbjct: 224 FTPQGIMDSFTVIPIQIFNWTSLPKVEFELVAASGSLLLLILLFILNGLATFIRYKYSRK 283


>gi|113970894|ref|YP_734687.1| phosphate ABC transporter inner membrane subunit PstA [Shewanella
           sp. MR-4]
 gi|113885578|gb|ABI39630.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           sp. MR-4]
          Length = 552

 Score =  163 bits (413), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 74/284 (26%), Positives = 130/284 (45%), Gaps = 27/284 (9%)

Query: 168 QWKWFQKLDSDGALFLDF--NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
              +   L   G +   F     F  +         G+  A+ G+++M+L++  +  P G
Sbjct: 263 DVTYVNHLGLMGKIGKWFVGLGRFVSDDPREANTEGGVFPAIFGTVFMVLLMAIIVTPFG 322

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK------------ 273
           + +AIYL E++ KG  +  ++  + NLA VPSIVYG+ G    +                
Sbjct: 323 VIAAIYLHEYAKKGPITKMIRIAVINLAGVPSIVYGVFGLGFFVYMMGGSIDQLFYAEAL 382

Query: 274 ----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVL 329
                     +   L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  V+
Sbjct: 383 PSPTFGSPGVIWSALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVI 442

Query: 330 PLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIY 382
           P+A PAI+TG  +++ARA GE APL+ VG+V      P+ +                 IY
Sbjct: 443 PMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLPLDLNFPFVHLERKFMHLGFHIY 502

Query: 383 LWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                +          +    LL+  +  +N   + +RN  +++
Sbjct: 503 DVGFQSPNVEAARPLVYATSFLLVTVIVALNLTAISVRNHLREK 546


>gi|146292535|ref|YP_001182959.1| phosphate ABC transporter inner membrane subunit PstA [Shewanella
           putrefaciens CN-32]
 gi|145564225|gb|ABP75160.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           putrefaciens CN-32]
          Length = 552

 Score =  163 bits (412), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 87/391 (22%), Positives = 158/391 (40%), Gaps = 35/391 (8%)

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
                +    K   +    +   +Y     + L  K    + +  L       L+T    
Sbjct: 164 HIDRAVALSDKALKLQKQDIGAINY---AIERLRLKERRYELDGELTDSRKSELATAKEA 220

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
             +  L+ +  L   T+       + I   ++G       +   S     +   L   G 
Sbjct: 221 LQKDYLVLEKELF--TLRDEAARDSVIVRDMRGV---EVELKLDSVLDVTYVNHLGLLGK 275

Query: 181 LFLDF--NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           +   F     F  +         G+  A+ G+++M+L++  +  P G+ +AIYL E++ K
Sbjct: 276 VRHWFVGLGRFMKDDPREANTEGGVFPAIFGTVFMVLLMAIIVTPFGVVAAIYLHEYAKK 335

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVG 282
           G  +  ++  + NLA VPSIVYG+ G    +                          +  
Sbjct: 336 GPITKMIRIAVINLAGVPSIVYGVFGLGFFVYMMGGFIDQLFYAEALPAPTFGSPGVIWS 395

Query: 283 GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV 342
            L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  V+P+A PAI+TG  +
Sbjct: 396 ALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVIPMASPAIMTGLIL 455

Query: 343 SLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFV 393
           ++ARA GE APL+ VG+V      P+                   IY     +       
Sbjct: 456 AVARAAGEVAPLMLVGVVKLAPTLPLDFNFPFVHLERKFMHLGFHIYDVGFQSPNVEAAR 515

Query: 394 ERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              +    LL+  +  +N   + +RN  +++
Sbjct: 516 PLVYATSFLLVTVIVALNLTAISVRNHLREK 546


>gi|24373291|ref|NP_717334.1| phosphate ABC transporter, permease protein, putative [Shewanella
           oneidensis MR-1]
 gi|24347534|gb|AAN54778.1|AE015617_13 phosphate ABC transporter, permease protein, putative [Shewanella
           oneidensis MR-1]
          Length = 552

 Score =  163 bits (412), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 72/284 (25%), Positives = 128/284 (45%), Gaps = 27/284 (9%)

Query: 168 QWKWFQKLDSDGALFLDFNY--GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
              +   L     +   F     F  +         G+  A+ G+++M+L++  +  P G
Sbjct: 263 DVTYVNHLSLISKVKHWFVSMGRFLWDDPREANTEGGVFPAIFGTVFMVLVMAVIVTPFG 322

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK------------ 273
           + +AIY+ E++ KG  +  ++  + NLA VPSIVYG+ G    +                
Sbjct: 323 VIAAIYMHEYAKKGPITKIIRIAVINLAGVPSIVYGVFGLGFFVYMMGGTIDQLFYAEAL 382

Query: 274 ----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVL 329
                     +   L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  V+
Sbjct: 383 PAPTFGSPGVIWSALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVI 442

Query: 330 PLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIY 382
           P+A PAI+TG  +++ARA GE APL+ VG+V      P+                   IY
Sbjct: 443 PMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLPLDFNFPFVHLERKFMHLGFHIY 502

Query: 383 LWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                +          +    LL+  +  +N   + +RN  +++
Sbjct: 503 DVGFQSPNVEAARPLVYATSFLLVTVIMALNLTAISVRNHLREK 546


>gi|117921174|ref|YP_870366.1| phosphate ABC transporter inner membrane subunit PstA [Shewanella
           sp. ANA-3]
 gi|117613506|gb|ABK48960.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           sp. ANA-3]
          Length = 552

 Score =  163 bits (412), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 74/284 (26%), Positives = 130/284 (45%), Gaps = 27/284 (9%)

Query: 168 QWKWFQKLDSDGALFLDF--NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
              +   L   G +   F     F  +         G+  A+ G+++M+L++  +  P G
Sbjct: 263 DVTYVNHLGLMGKIGKWFVGLGRFVSDDPREANTEGGVFPAIFGTVFMVLLMAIIVTPFG 322

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK------------ 273
           + +AIYL E++ KG  +  ++  + NLA VPSIVYG+ G    +                
Sbjct: 323 VIAAIYLHEYAKKGPITKMIRIAVINLAGVPSIVYGVFGLGFFVYMMGGSIDQLFYAEAL 382

Query: 274 ----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVL 329
                     +   L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  V+
Sbjct: 383 PSPTFGSPGVIWSALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVI 442

Query: 330 PLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIY 382
           P+A PAI+TG  +++ARA GE APL+ VG+V      P+ +                 IY
Sbjct: 443 PMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLPLDLNFPFVHLERKFMHLGFHIY 502

Query: 383 LWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                +          +    LL+  +  +N   + +RN  +++
Sbjct: 503 DVGFQSPNVEAARPLVYATSFLLVTVIVALNLTAISVRNHLREK 546


>gi|114048118|ref|YP_738668.1| phosphate ABC transporter inner membrane subunit PstA [Shewanella
           sp. MR-7]
 gi|113889560|gb|ABI43611.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           sp. MR-7]
          Length = 552

 Score =  163 bits (412), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 74/284 (26%), Positives = 130/284 (45%), Gaps = 27/284 (9%)

Query: 168 QWKWFQKLDSDGALFLDF--NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLG 225
              +   L   G +   F     F  +         G+  A+ G+++M+L++  +  P G
Sbjct: 263 DVTYVNHLGLMGKIGKWFVGLGRFVSDDPREANTEGGVFPAIFGTVFMVLLMAIIVTPFG 322

Query: 226 IASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK------------ 273
           + +AIYL E++ KG  +  ++  + NLA VPSIVYG+ G    +                
Sbjct: 323 VIAAIYLHEYAKKGPITKMIRIAVINLAGVPSIVYGVFGLGFFVYMMGGSIDQLFYAEAL 382

Query: 274 ----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVL 329
                     +   L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  V+
Sbjct: 383 PSPTFGSPGVIWSALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVI 442

Query: 330 PLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIY 382
           P+A PAI+TG  +++ARA GE APL+ VG+V      P+ +                 IY
Sbjct: 443 PMASPAIMTGLILAVARAAGEVAPLMLVGVVKLAPTLPLDLNFPFVHLERKFMHLGFHIY 502

Query: 383 LWAADAE--RPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
                +          +    LL+  +  +N   + +RN  +++
Sbjct: 503 DVGFQSPNVEAARPLVYATSFLLVTVIVALNLTAISVRNHLREK 546


>gi|312127782|ref|YP_003992656.1| phosphate ABC transporter inner membrane subunit PstA
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311777801|gb|ADQ07287.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 280

 Score =  163 bits (412), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 127/241 (52%), Gaps = 5/241 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              +  F +       +  GI   +VG+LY+ L+ + ++ P+G+ +AIYL E++ KG   
Sbjct: 40  KGISLSFILQYPEEMGKSGGIFPVIVGTLYVTLLAVIIAAPVGVLAAIYLTEYAKKGKVV 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     LA +PSI+YG+ G A  +      R + L G L L++M LP+II  +  A+
Sbjct: 100 ELIRFGTETLAGIPSIIYGLFGFAFFVIALGF-RWSILSGALTLSIMILPTIIRTSEEAI 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S R  +L LGA+K QT+   V+P AMP ILTG  + + RA+GETA +L     + 
Sbjct: 159 KTVPMSFREGSLALGATKWQTIAKVVIPPAMPGILTGVILGVGRAIGETAAVLLTAGSSL 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             ++P  +        V +Y+    +E      ++    LL++ + VINT    +  R+ 
Sbjct: 219 --NFPTSIFSPTRTMSVHLYIL--SSEGLSKLNSYATATLLIVIVFVINTFANMIIRRYN 274

Query: 423 K 423
           +
Sbjct: 275 R 275


>gi|46200026|ref|YP_005693.1| phosphate transport system permease protein pstA [Thermus
           thermophilus HB27]
 gi|46197653|gb|AAS82066.1| phosphate transport system permease protein pstA [Thermus
           thermophilus HB27]
          Length = 401

 Score =  163 bits (412), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 98/259 (37%), Positives = 148/259 (57%), Gaps = 1/259 (0%)

Query: 167 YQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGI 226
            + K   +      L    +  F     S  P  AGIGVA+ G+++++ + +  + P+G+
Sbjct: 144 QELKVGLEEGERLVLNPWLDQTFLTRPPSRSPLTAGIGVAIWGTVWVLSLALLFAIPVGV 203

Query: 227 ASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLIL 286
            +AI LEE+  +G  S  ++ N+ NLA VPSIVYG+LG A+ +    +   + L   L L
Sbjct: 204 GTAILLEEYLREGRLSRILEVNLRNLAGVPSIVYGLLGLALFVRGMGL-GPSVLAAALTL 262

Query: 287 ALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLAR 346
            L+ +P I++    ALR VP S+R AA  LGA++ Q VF  V+P A+P ++TG  +S AR
Sbjct: 263 GLLGVPVIVVTAREALRAVPDSLRQAAFALGATRRQVVFRVVVPAALPGMVTGVILSAAR 322

Query: 347 ALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIF 406
            +GE APLL VG  A+V  +P G     T  PVQIYLW +  +  F       IL++L+ 
Sbjct: 323 LMGEAAPLLLVGAAAYVPFFPSGPLSQYTVVPVQIYLWISQNQPEFARVAAAGILVMLLL 382

Query: 407 LAVINTAMLWLRNRFKKRW 425
           L+V+    L+LRNRF++ W
Sbjct: 383 LSVLYLMALYLRNRFRREW 401


>gi|37519579|ref|NP_922956.1| phosphate ABC transporter permease protein [Gloeobacter violaceus
           PCC 7421]
 gi|35210570|dbj|BAC87951.1| phosphate ABC transporter permease protein [Gloeobacter violaceus
           PCC 7421]
          Length = 304

 Score =  163 bits (412), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 89/249 (35%), Positives = 136/249 (54%), Gaps = 14/249 (5%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           FF +  S   E AGI  A VGS  +ML+    + PLG+AS IYLEE++ K +F+  ++ N
Sbjct: 54  FFTSFPSRFAEQAGILSAWVGSCLVMLVTAAAAVPLGVASGIYLEEYAPKNWFTEIIEVN 113

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
           I NLA VPSI++G++   + +    +  S    G  +  L+ LP +I++T  +LR VP S
Sbjct: 114 ITNLAGVPSIIFGLMALGLFVYGLGLGESILTAGLTLALLI-LPIVIVSTRESLRAVPDS 172

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           IR AA  LGA++ Q V  H+LP +   ILTG  + L+RA+GETAPL+ +G + F+   P 
Sbjct: 173 IREAAYALGATRWQVVSDHILPYSTGGILTGIIIGLSRAIGETAPLITIGALTFIAFLPD 232

Query: 369 GVT-------------DIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAML 415
                              T  P+Q++ W +  +  F      A L+L++    +N   +
Sbjct: 233 LPLRAEFPFFSFQWLSSGFTVLPIQMFNWVSRPQEAFQLNAAAAGLVLIVMTLGMNALAI 292

Query: 416 WLRNRFKKR 424
           +LR  F+KR
Sbjct: 293 YLRYSFRKR 301


>gi|84393914|ref|ZP_00992656.1| phosphate ABC transporter, permease protein [Vibrio splendidus
           12B01]
 gi|84375464|gb|EAP92369.1| phosphate ABC transporter, permease protein [Vibrio splendidus
           12B01]
          Length = 569

 Score =  163 bits (412), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 70/263 (26%), Positives = 123/263 (46%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G++ +++++  +  PLG+ +AIYL E++     +  ++
Sbjct: 300 WKFLSENPRDSNSEGGVFPAIFGTVLLVILMSIVVMPLGVVAAIYLHEYARNNALTRLIR 359

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG----------------LILALMT 290
             + NLA VPSIVYG+ G    +        +                     L LA++T
Sbjct: 360 IAVINLAGVPSIVYGVFGLGFFVYTIGGSIDSLFYAERLPAPTFGTPGLLWSALTLAVLT 419

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 420 LPVVIVTTEEGLTRIPSSVRHGSLALGATQFETLWRIVLPMASPAIITGLILAIARAAGE 479

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +    
Sbjct: 480 VAPLMLVGVVKLASSLPVDGQFPYLHLERKFMHLGFHIYDVGFQTSNIEAARPLVYATSF 539

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 540 LLVTVIVGLNLTAINIRNNLREK 562


>gi|228993014|ref|ZP_04152937.1| ABC transporter permease protein [Bacillus pseudomycoides DSM
           12442]
 gi|228766662|gb|EEM15302.1| ABC transporter permease protein [Bacillus pseudomycoides DSM
           12442]
          Length = 288

 Score =  162 bits (411), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 90/252 (35%), Positives = 148/252 (58%), Gaps = 1/252 (0%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
                            +  FF+N AS  P+ AGI  A+ G++  M IV+ +SF  G+ +
Sbjct: 37  ILILLLYQIFEKGISYLSIDFFMNFASRNPKQAGIAAALSGTIVFMSIVVPVSFIFGVGT 96

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           A+YLE ++ +  F+  V+ NI  LA VPS+V+G+LG  + +   ++  S        ++L
Sbjct: 97  ALYLEHYARQSVFTRIVELNIQTLAGVPSVVFGLLGLTIFVYGLQLGESIVTAAF-TMSL 155

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP++++++  A+R VPSS+  A+ G+GA+K QT++  V+P A+P ILTG  ++L+RA+
Sbjct: 156 LVLPTVVVSSQEAIRMVPSSLLEASYGVGATKWQTMYQIVVPTALPGILTGCVLALSRAI 215

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           GE APLL +G +AF    P+ + D  T  P+QI+ W +  +  F       +++LL  L 
Sbjct: 216 GEAAPLLVIGALAFANYIPLNMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLL 275

Query: 409 VINTAMLWLRNR 420
           +IN  +LWLRNR
Sbjct: 276 IINVVVLWLRNR 287


>gi|71278005|ref|YP_270309.1| phosphate ABC transporter permease [Colwellia psychrerythraea 34H]
 gi|71143745|gb|AAZ24218.1| phosphate ABC transporter, permease protein [Colwellia
           psychrerythraea 34H]
          Length = 545

 Score =  162 bits (411), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 76/262 (29%), Positives = 127/262 (48%), Gaps = 25/262 (9%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F I          G+  A+ G++ M+L++  +  P G+ +AIYL E++ K  F+  ++ 
Sbjct: 278 SFLIEDPREANTEGGVFPAIFGTVLMVLLMTVIVSPFGVIAAIYLHEYAGKNAFTKLLRI 337

Query: 248 NINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTL 291
            + NLA VPSIVYG+ G    +                          L   L LA++TL
Sbjct: 338 AVINLAGVPSIVYGVFGLGFFVYMVGGSLDQLFYSENLPSPTFGTPGVLWSALTLAILTL 397

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I++T   L  +PS++R  +L LGA+K +T++  +LP+A PAI+TG  +++ARA GE 
Sbjct: 398 PVVIVSTEEGLSRIPSTMRHGSLALGATKAETLWRIILPIASPAIMTGIILAIARAAGEV 457

Query: 352 APLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILL 402
           APL+ VG+V    + P+        +          IY     +          F   LL
Sbjct: 458 APLMLVGVVKMAPNLPLDGNFPFLHLDRKFMHLGFHIYDVGFQSPNVEAARPLVFATALL 517

Query: 403 LLIFLAVINTAMLWLRNRFKKR 424
           L+  +  +N   + +RN+ ++R
Sbjct: 518 LVTIIVALNMTAVSIRNKLRER 539


>gi|86145564|ref|ZP_01063894.1| phosphate ABC transporter, permease protein [Vibrio sp. MED222]
 gi|85836535|gb|EAQ54661.1| phosphate ABC transporter, permease protein [Vibrio sp. MED222]
          Length = 569

 Score =  162 bits (411), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 70/263 (26%), Positives = 123/263 (46%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G++ +++++  +  PLG+ +AIYL E++     +  ++
Sbjct: 300 WKFLSENPRDSNSEGGVFPAIFGTVLLVILMSIVVMPLGVVAAIYLHEYAKNNALTRLIR 359

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG----------------LILALMT 290
             + NLA VPSIVYG+ G    +        +                     L LA++T
Sbjct: 360 IAVINLAGVPSIVYGVFGLGFFVYTIGGSIDSLFYAERLPAPTFGTPGLLWSALTLAVLT 419

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 420 LPVVIVTTEEGLTRIPSSVRHGSLALGATQFETLWRIVLPMASPAIITGLILAIARAAGE 479

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +    
Sbjct: 480 VAPLMLVGVVKLASSLPVDGQFPYLHLERKFMHLGFHIYDVGFQTSNIEAARPLVYATSF 539

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 540 LLVTVIVGLNLTAINIRNNLREK 562


>gi|312884264|ref|ZP_07743973.1| ABC transporter transmembrane protein [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368037|gb|EFP95580.1| ABC transporter transmembrane protein [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 548

 Score =  162 bits (411), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 82/365 (22%), Positives = 148/365 (40%), Gaps = 45/365 (12%)

Query: 85  YNLLVRKALARKLSISDSNHALLRQASQMLSTTARYHLRKTLMTDPSLIGKTVEVSLLAS 144
           ++  +   L                  + +    +  L    +    + G+   V +  S
Sbjct: 197 FDKSLDADLMASYYAKSQTLREKLMQVEKVLDGLQRQLASQGVIVEEMKGQQ--VKIPLS 254

Query: 145 ANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIG 204
             +D+     +  P  +         W +++           + F  +         G+ 
Sbjct: 255 QILDAWYPNQMNLPEKL-------LHWVKQV-----------WKFLSDDPRESNSEGGVF 296

Query: 205 VAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILG 264
            A+ G++ ++LI+  +  PLG+ +AIYL E++     +  ++  + NLA VPSIVYG+ G
Sbjct: 297 PAMFGTVLLVLIMSVIVMPLGVIAAIYLHEYAKNNLVTRLIRVAVINLAGVPSIVYGVFG 356

Query: 265 SAVLINFFK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
               +                          L   L LA++TLP +I+AT   L  +P S
Sbjct: 357 LGFFVYMVGGSIDTLFYPERLPAPTFGTPGLLWSALTLAILTLPVVIVATEEGLTRIPVS 416

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           +R  +L LGA++ +T++  VLP+A PAILTG  +++ARA GE APL+ VG V   +  PV
Sbjct: 417 VRQGSLALGATQFETLWRIVLPMASPAILTGLILAVARAAGEVAPLMLVGAVKLASSLPV 476

Query: 369 G-------VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRN 419
                   +          IY   +            +    LL+  +  +N   + +RN
Sbjct: 477 DDQFPFVHLERKFMHLGFHIYDVGFQTTNIESARPLVYATSFLLVTVIVGLNLTAISIRN 536

Query: 420 RFKKR 424
             +++
Sbjct: 537 NLREK 541


>gi|108758134|ref|YP_632952.1| phosphate ABC transporter permease PstA [Myxococcus xanthus DK
           1622]
 gi|108462014|gb|ABF87199.1| phosphate ABC transporter, permease protein PstA [Myxococcus
           xanthus DK 1622]
          Length = 303

 Score =  162 bits (411), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 77/258 (29%), Positives = 127/258 (49%), Gaps = 16/258 (6%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK-GFF 241
              ++ F     S      GI  A+ G+  + L++     P+G+ +A+YL E++     F
Sbjct: 41  RHLSWTFLTQPPSDGMMGGGIFPAIFGTAALTLLMTLAVMPVGVLTAVYLHEYAPPESRF 100

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINF-------------FKMPRSTALVGGLILAL 288
           + +V+  + NLA VPSIV+G+ G    I F                 +   L   L LA+
Sbjct: 101 ARWVRVAVVNLAGVPSIVFGLFGLGFFILFVGGNLDRMLGYEEMHWAQPGILWASLTLAV 160

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           +TLP +I++T  ALR VP   R+A+L LGA++ QT+   VLP A+P ILTG+ ++++R  
Sbjct: 161 LTLPVVIVSTEEALRAVPLEQRTASLALGATQSQTLARVVLPGALPGILTGAVLAISRGA 220

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIF 406
           GE AP+LF G   F+ D P  +           Y+ A  +          +  +L+LL  
Sbjct: 221 GEVAPILFTGAAYFLPDLPTHLDSQFMHLGYHTYVMATQSPNVTEASGPLYATVLVLLAL 280

Query: 407 LAVINTAMLWLRNRFKKR 424
              +N   + +R R +++
Sbjct: 281 TFALNLVAVIIRTRTRRK 298


>gi|228999064|ref|ZP_04158646.1| ABC transporter permease protein [Bacillus mycoides Rock3-17]
 gi|228760681|gb|EEM09645.1| ABC transporter permease protein [Bacillus mycoides Rock3-17]
          Length = 288

 Score =  162 bits (411), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 90/252 (35%), Positives = 148/252 (58%), Gaps = 1/252 (0%)

Query: 169 WKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIAS 228
                            +  FF+N AS  P+ AGI  A+ G++  M IV+ +SF  G+ +
Sbjct: 37  ILILLLYQIFEKGISYLSIDFFMNFASRNPKQAGIAAALSGTIVFMSIVVPVSFIFGVGT 96

Query: 229 AIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILAL 288
           A+YLE ++ +  F+  V+ NI  LA VPS+V+G+LG  + +   ++  S        ++L
Sbjct: 97  ALYLEHYARQSVFTRIVELNIQTLAGVPSVVFGLLGLTIFVYGLQLGESIVTAAF-TMSL 155

Query: 289 MTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARAL 348
           + LP++++++  A+R VPSS+  A+ G+GA+K QT++  V+P A+P ILTG  ++L+RA+
Sbjct: 156 LVLPTVVVSSQEAIRMVPSSLLEASYGVGATKWQTMYQIVVPTALPGILTGCVLALSRAI 215

Query: 349 GETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLA 408
           GE APLL +G +AF    P+ + D  T  P+QI+ W +  +  F       +++LL  L 
Sbjct: 216 GEAAPLLIIGALAFANYIPLNMFDRFTVLPIQIFNWMSRPQEEFQHVAAAGMIVLLGLLL 275

Query: 409 VINTAMLWLRNR 420
           +IN  +LWLRNR
Sbjct: 276 IINVVVLWLRNR 287


>gi|146318757|ref|YP_001198469.1| phosphate ABC transporter permease [Streptococcus suis 05ZYH33]
 gi|223933466|ref|ZP_03625450.1| phosphate ABC transporter, inner membrane subunit PstA
           [Streptococcus suis 89/1591]
 gi|253751854|ref|YP_003024995.1| phosphate ABC transporter permease [Streptococcus suis SC84]
 gi|253753677|ref|YP_003026818.1| phosphate ABC transporter permease [Streptococcus suis P1/7]
 gi|253755443|ref|YP_003028583.1| phosphate ABC transporter permease [Streptococcus suis BM407]
 gi|330832919|ref|YP_004401744.1| putative phosphate ABC transporter (permease) [Streptococcus suis
           ST3]
 gi|145689563|gb|ABP90069.1| putative phosphate ABC transporter (permease protein)
           [Streptococcus suis 05ZYH33]
 gi|223897839|gb|EEF64216.1| phosphate ABC transporter, inner membrane subunit PstA
           [Streptococcus suis 89/1591]
 gi|251816143|emb|CAZ51767.1| putative phosphate ABC transporter permease protein [Streptococcus
           suis SC84]
 gi|251817907|emb|CAZ55680.1| putative phosphate ABC transporter permease protein [Streptococcus
           suis BM407]
 gi|251819923|emb|CAR46003.1| putative phosphate ABC transporter permease protein [Streptococcus
           suis P1/7]
 gi|319758209|gb|ADV70151.1| putative phosphate ABC transporter (permease protein)
           [Streptococcus suis JS14]
 gi|329307142|gb|AEB81558.1| putative phosphate ABC transporter (permease protein)
           [Streptococcus suis ST3]
          Length = 295

 Score =  162 bits (410), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 121/254 (47%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  + +SS     GIG+ +  S +++++ + +S PL   + IYL E++ KG  +
Sbjct: 38  PHVSWDFLTSKSSSYKAGGGIGIQLYNSFFLLVVTLLISVPLSTGAGIYLAEYAKKGPLT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           +F++  I  L+S+PS+V G+ G  + +  F+    + L G L L +  LP +      +L
Sbjct: 98  NFIRTCIEILSSLPSVVVGLFGYLIFVVQFE-YGFSILSGALALTVFNLPQMTRNVEDSL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM--- 359
           R V  + R A L LG S+ +TV H V+P A+P I+TG  ++  R  GE A L++      
Sbjct: 157 RHVHHTQREAGLALGLSRWETVLHVVIPEALPGIVTGIVLASGRIFGEAAALIYTAGQSA 216

Query: 360 --------VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA-ILLLLIFLAVI 410
                          P+ +   +    V I+   ++   P   +       +LL+F+ + 
Sbjct: 217 PALDWSNWNPLSVTSPISIFRQSETLAVHIWKVNSEGTIPDATQVSAGSAAILLVFILIF 276

Query: 411 NTAMLWLRNRFKKR 424
           N +  ++  +   +
Sbjct: 277 NLSARYIGKKLHAK 290


>gi|218708608|ref|YP_002416229.1| ABC transporter transmembrane protein [Vibrio splendidus LGP32]
 gi|218321627|emb|CAV17579.1| ABC transporter: transmembrane protein [Vibrio splendidus LGP32]
          Length = 569

 Score =  162 bits (410), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 70/263 (26%), Positives = 123/263 (46%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F            G+  A+ G++ +++++  +  PLG+ +AIYL E++     +  ++
Sbjct: 300 WKFLSENPRDSNSEGGVFPAIFGTVLLVILMSIVVMPLGVVAAIYLHEYAKNNALTRLIR 359

Query: 247 ANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG----------------LILALMT 290
             + NLA VPSIVYG+ G    +        +                     L LA++T
Sbjct: 360 IAVINLAGVPSIVYGVFGLGFFVYTIGGSIDSLFYAERLPAPTFGTPGLLWSALTLAVLT 419

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+ T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE
Sbjct: 420 LPVVIVTTEEGLTRIPSSVRHGSLALGATQFETLWRIVLPMASPAIITGLILAIARAAGE 479

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +    
Sbjct: 480 VAPLMLVGVVKLASSLPVDGQFPYLHLDRKFMHLGFHIYDVGFQTSNIEAARPLVYATSF 539

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 540 LLVTVIVGLNLTAINIRNNLREK 562


>gi|292558424|gb|ADE31425.1| Binding-protein-dependent transport systems related protein
           [Streptococcus suis GZ1]
          Length = 295

 Score =  162 bits (410), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 121/254 (47%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  + +SS     GIG+ +  S +++++ + +S PL   + IYL E++ KG  +
Sbjct: 38  PHVSWDFLTSKSSSYKAGGGIGIQLYNSFFLLVVTLLISVPLSTGAGIYLAEYAKKGPLT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           +F++  I  L+S+PS+V G+ G  + +  F+    + L G L L +  LP +      +L
Sbjct: 98  NFIRTCIEILSSLPSVVVGLFGYLIFVVQFE-YGFSILSGALALTVFNLPQMTRNVEDSL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM--- 359
           R V  + R A L LG S+ +TV H V+P A+P I+TG  ++  R  GE A L++      
Sbjct: 157 RHVHHTQREAGLALGLSRWETVLHVVIPEALPGIVTGIVLASGRIFGEAAALIYTAGQSA 216

Query: 360 --------VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA-ILLLLIFLAVI 410
                          P+ +   +    V I+   ++   P   +       +LL+F+ + 
Sbjct: 217 PALDWSNWNPLSVTSPISIFRQSETLAVHIWKVNSEGTIPDATQVSAGSAAILLVFILIF 276

Query: 411 NTAMLWLRNRFKKR 424
           N +  ++  +   +
Sbjct: 277 NLSARYIGKKLHAK 290


>gi|228987518|ref|ZP_04147637.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228772250|gb|EEM20697.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 286

 Score =  162 bits (410), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILLILLFQIFEKGISYLSLEFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIIAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP A P I+TG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L +IN  +LWLRNR
Sbjct: 269 LGLLLLINIFVLWLRNR 285



 Score = 38.1 bits (87), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R++ + +++    +A+L   V L++LL  I  KGI 
Sbjct: 1  MLNHKKIQENMASRFLKDRVYKTLFYIAILFSIVILLILLFQIFEKGIS 49


>gi|47567832|ref|ZP_00238540.1| phosphate transport system permease protein pstA [Bacillus cereus
           G9241]
 gi|47555509|gb|EAL13852.1| phosphate transport system permease protein pstA [Bacillus cereus
           G9241]
          Length = 288

 Score =  162 bits (410), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSIVILLVLLFQIFEKGISYLSLEFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIIAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VPSS+  A+ GLGA+K QT++  VLP A P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRSVPSSLLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L +IN  +LWLRNR
Sbjct: 271 LGLLLLINIFVLWLRNR 287



 Score = 38.1 bits (87), Expect = 3.0,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R++ + +++    +A+L   V L++LL  I  KGI 
Sbjct: 3  MLNHKKIQENMASRFLKDRVYKTLFYIAILFSIVILLVLLFQIFEKGIS 51


>gi|119946229|ref|YP_943909.1| ABC phosphate transporter inner membrane protein PstA [Psychromonas
           ingrahamii 37]
 gi|119864833|gb|ABM04310.1| ABC phosphate transporter inner membrane protein PstA [Psychromonas
           ingrahamii 37]
          Length = 281

 Score =  162 bits (410), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 122/241 (50%), Gaps = 5/241 (2%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS-HKGFFSSF 244
            + F  +  +   E +GI   +V ++YM+++ + ++ P+GI +AIYL E++         
Sbjct: 42  TWEFITSSYTRIGEASGIWPMIVSTVYMVVLTLSIATPIGIMTAIYLTEYAKPGSKIVQV 101

Query: 245 VQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRT 304
           ++  I +LA +PSIVYG+ G    +    +   + L G L L+++ LP II  T  AL  
Sbjct: 102 IRFCIESLAGIPSIVYGLFGMTFFVTTLGL-GFSILAGSLTLSILILPVIIRTTEEALMA 160

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP S R     LG+SK+ T++  +LP AMP I+T   +S+ R +GE+AP+        VT
Sbjct: 161 VPMSYREGGYALGSSKIYTIWRLILPSAMPGIITAIILSIGRVIGESAPVFLTAG--MVT 218

Query: 365 DYPVGVTDIATAFPVQIYLWAAD-AERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
             P  V D      V +Y    +   +   ++ +    +L++ +  +N     +  R+ K
Sbjct: 219 KIPESVLDSGRTLTVHLYKLTQELFSQNEWDQAYATATVLIVLVLFLNLITKLIATRYAK 278

Query: 424 R 424
           +
Sbjct: 279 K 279


>gi|45358659|ref|NP_988216.1| phosphate ABC transporter inner membrane protein [Methanococcus
           maripaludis S2]
 gi|45047525|emb|CAF30652.1| Binding-protein-dependent transport systems inner membrane
           component [Methanococcus maripaludis S2]
          Length = 291

 Score =  162 bits (410), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 118/243 (48%), Gaps = 10/243 (4%)

Query: 190 FINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANI 249
             +  S   +  GI   +VGS  + ++ +  S PLG+  AI+L E + K    + ++ +I
Sbjct: 51  LGSDWSPINDAYGIFPMIVGSFLVTVLALVFSVPLGVGCAIFLAELAPKK-VQNILRPSI 109

Query: 250 NNLASVPSIVYGILGSAVLINFFK-----MPRSTALVGGLILALMTLPSIIIATGVALRT 304
             L ++PS+VYG +G  +L+   +      P  + L   +IL +M +P+I + +  A+ +
Sbjct: 110 EILTAIPSVVYGFVGMVLLVPLIRDVFNTNPGYSWLAASIILGIMIVPTITVLSEDAINS 169

Query: 305 VPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVT 364
           VP  ++  +L +GA++ QT+   VLP ++  IL+G  + + RA+GET  +L V       
Sbjct: 170 VPQQLKEGSLAMGATRWQTIKKVVLPASLSGILSGVILGMGRAIGETMAVLMVAGN--WP 227

Query: 365 DYPVGVTDIATAFPVQIYLWAADAERPF--VERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             P  + D        I L   +A          F   L+L + +  +N    ++  ++K
Sbjct: 228 LIPKSIFDPVRPLTSHIILNIKEAASGSPIYYAMFATGLVLFVMVLSLNLISHYINKKYK 287

Query: 423 KRW 425
            +W
Sbjct: 288 IKW 290


>gi|49481279|ref|YP_038329.1| phosphate ABC transporter permease [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52141228|ref|YP_085600.1| phosphate ABC transporter, permease [Bacillus cereus E33L]
 gi|49332835|gb|AAT63481.1| phosphate ABC transporter, permease [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51974697|gb|AAU16247.1| phosphate ABC transporter, permease [Bacillus cereus E33L]
          Length = 288

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 32  LFSIVILLILLFQIFEKGISYLSLEFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 91

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 92  FGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIIAAA 150

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VP+S+  A+ GLGA+K QT++  VLP A P I+TG T++
Sbjct: 151 LTMSLLVLPTVVVASQEAIRSVPNSLLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLA 210

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 211 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 270

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L +IN  +LWLRNR
Sbjct: 271 LGLLLLINIFVLWLRNR 287



 Score = 40.4 bits (93), Expect = 0.61,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 27/49 (55%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    ++N+  R++ + +++    +A+L   V L++LL  I  KGI 
Sbjct: 3  MLNHKKIQENMASRFLKDRIYKLLFYIAILFSIVILLILLFQIFEKGIS 51


>gi|205373992|ref|ZP_03226792.1| ABC transporter permease [Bacillus coahuilensis m4-4]
          Length = 214

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 88/214 (41%), Positives = 142/214 (66%), Gaps = 1/214 (0%)

Query: 211 LYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLIN 270
           +++M +V  +SF LG+ +A+YLEE++ +   ++F+Q NI+NLA VPS+V+G+LG  + + 
Sbjct: 1   MWLMAVVAPVSFILGVGTALYLEEYAKQNKINNFIQVNISNLAGVPSVVFGLLGLTIFVR 60

Query: 271 FFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLP 330
            F    ++ L  GL LALM LP II+A+  A+R+V   +R A+ G+GA+K QT+   VLP
Sbjct: 61  VFAF-GTSVLAAGLTLALMILPVIIVASQEAIRSVSGELRDASFGMGATKWQTIIRVVLP 119

Query: 331 LAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAER 390
            A+P ILTG+ ++++RA+GETAPL+ +G+  F+   P  V D  TA P+QIY W    + 
Sbjct: 120 SAIPGILTGTILAVSRAIGETAPLVVIGIPTFLAFLPGSVLDTFTALPMQIYNWTGRPQA 179

Query: 391 PFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            F +     I++LL  L ++N   +++RN+F +R
Sbjct: 180 EFQDLAAAGIIVLLALLILMNAIAVFIRNKFSQR 213


>gi|261252155|ref|ZP_05944728.1| phosphate transport system permease protein PstA [Vibrio orientalis
           CIP 102891]
 gi|260935546|gb|EEX91535.1| phosphate transport system permease protein PstA [Vibrio orientalis
           CIP 102891]
          Length = 548

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 75/263 (28%), Positives = 127/263 (48%), Gaps = 25/263 (9%)

Query: 187 YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQ 246
           + F  +         G+  A+ G++ M+LI+  +  PLG+ +AIYL E++    F+  ++
Sbjct: 279 WKFLSDNPRESNSEGGVFPAMFGTVLMVLIMSVIVMPLGVIAAIYLHEYAKNNAFTRLIR 338

Query: 247 ANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMT 290
             + NLA VPSIVYG+ G    +                          L   L LA++T
Sbjct: 339 VAVINLAGVPSIVYGVFGLGFFVYTLGGSIDSLFYQERLPAPTFGTPGLLWSALTLAVLT 398

Query: 291 LPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGE 350
           LP +I+AT   L  +P+S+R  +L LGA++ +T++  VLP+A PA++TG  +++ARA GE
Sbjct: 399 LPVVIVATEEGLTRIPNSVRHGSLALGATQFETMWRIVLPMASPAMITGLILAVARAAGE 458

Query: 351 TAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYL--WAADAERPFVERTFGAIL 401
            APL+ VG+V   +  PV        +          IY   +            +   L
Sbjct: 459 VAPLMLVGVVKLASSLPVDSQFPFLHLERKFMHLGFHIYDVGFQTTNIESARPLVYATSL 518

Query: 402 LLLIFLAVINTAMLWLRNRFKKR 424
           LL+  +  +N   + +RN  +++
Sbjct: 519 LLVTVIIGLNLTAISIRNNLREK 541


>gi|319892601|ref|YP_004149476.1| Phosphate transport system permease protein PstA [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317162297|gb|ADV05840.1| Phosphate transport system permease protein PstA [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323464359|gb|ADX76512.1| phosphate ABC transporter, permease protein PstA [Staphylococcus
           pseudintermedius ED99]
          Length = 293

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 95/239 (39%), Positives = 156/239 (65%), Gaps = 1/239 (0%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           +  FF N +SS    AG+  A++G+L++M+ +I ++  LG+ SAIYLEE++    F+ F+
Sbjct: 55  STDFFTNFSSSSASSAGVKGALIGTLWLMMTLIPIALVLGVGSAIYLEEYAKDNAFTKFI 114

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           + NI+NLASVPSIVYG+LG+ + +   ++  ++ +   L LAL+ LP II+A+  A+R+V
Sbjct: 115 RVNISNLASVPSIVYGLLGATIFVALLQL-GNSVIAAALTLALLILPVIIVASQEAIRSV 173

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P S++ A+ GLGA+K QT+   VLP A+P I+TG  ++++RA+GETAPL+ +G+   +  
Sbjct: 174 PQSVKEASYGLGANKWQTIQQVVLPAAIPGIITGVILAISRAIGETAPLVAIGIPTILLR 233

Query: 366 YPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            P  + D     P+QIY WA      F   +  AI++LL  L ++NT  + +RN++  +
Sbjct: 234 TPNSILDSFQTLPLQIYDWARKPGIDFQALSSAAIIVLLAILLILNTIAVIIRNKYSNK 292


>gi|81428117|ref|YP_395116.1| phosphate ABC transporter transmembrane protein [Lactobacillus
           sakei subsp. sakei 23K]
 gi|78609758|emb|CAI54804.1| Phosphate ABC transporter, membrane-spanning subunit [Lactobacillus
           sakei subsp. sakei 23K]
          Length = 294

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 69/254 (27%), Positives = 118/254 (46%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
               + F  N AS+  +  GIGV +  S Y+++I + +S PL I + IYL E++ K + +
Sbjct: 38  PHVTWQFLTNPASTFTKGGGIGVQLFNSFYLLVIAMVISVPLSIGAGIYLAEYAPKNWVT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           + V+  I  L+S+PS+V G+ G  V +  FK+   + L G L L +  LP +      AL
Sbjct: 98  NVVRTAIEVLSSLPSVVVGLFGFLVFVIQFKL-GFSILAGALALTVFNLPLLTRNVEDAL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM--- 359
           +++  + R A L LG S+ +TV H ++P A+P I+TG  +   R  GE A L++      
Sbjct: 157 KSIHFTQREAGLALGLSRYETVKHVIIPEALPNIITGMILGAGRIFGEAAALIYTAGQSA 216

Query: 360 --------VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAI-LLLLIFLAVI 410
                          P+     A    V I+   ++   P           +L+I + + 
Sbjct: 217 PSLDFTNWNPTYIASPLNPMRPAETLAVHIWKINSEGIMPDATAVSAGASAVLIIAVLLF 276

Query: 411 NTAMLWLRNRFKKR 424
           N     +  R  ++
Sbjct: 277 NWLARVIGKRVYRK 290


>gi|114562536|ref|YP_750049.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           frigidimarina NCIMB 400]
 gi|114333829|gb|ABI71211.1| phosphate ABC transporter, inner membrane subunit PstA [Shewanella
           frigidimarina NCIMB 400]
          Length = 553

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 81/391 (20%), Positives = 158/391 (40%), Gaps = 35/391 (8%)

Query: 61  EFSETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQMLSTTARY 120
                +    +   +  + +   +Y     + L  K    + +  L  +    +      
Sbjct: 165 HIDRAVAISDQALALQKSDIGSINYQ---MERLRLKERGYELDGELTAERKADIKAQIGQ 221

Query: 121 HLRKTLMTDPSLIGKTVEVSLLASANIDSALKGYLYSPANVHRMSDYQWKWFQKLDSDGA 180
             +  L+ +  L     +     +A     +K        +   S     +   ++  G 
Sbjct: 222 LNKDYLVLEKDLFALRDK-----AARDSVVVKDMRGVEVTLQLDSILDVSYVNHMNLLGK 276

Query: 181 LFLDFNY--GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHK 238
           +   F     F  +         G+  A+ G+++M++++  +  P G+ +AIYL E++ K
Sbjct: 277 VGHWFVGIGRFVSDDPREANTEGGVFPAIFGTVFMVMLMAVIVTPFGVIAAIYLHEYAKK 336

Query: 239 GFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVG 282
           G  +  ++  + NLA VPSIVYG+ G    +                          +  
Sbjct: 337 GPITKLIRIAVINLAGVPSIVYGVFGLGFFVYMMGGSIDQLFFPEALPAPTFGSPGVIWS 396

Query: 283 GLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTV 342
            L LA++TLP +I++T   L  +PS++R  +L LGA+K +T++  V+P+A PAI+TG  +
Sbjct: 397 ALTLAILTLPVVIVSTEEGLSRIPSAVRQGSLALGATKAETLWRIVIPMASPAIMTGLIL 456

Query: 343 SLARALGETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFV 393
           ++ARA GE APL+ VG+V      P+ +                 IY     +       
Sbjct: 457 AVARAAGEVAPLMLVGVVKLAPTLPIDMNFPFVHLERKFMHLGFHIYDVGFQSPNVEAAR 516

Query: 394 ERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
              +    LL+  +  +N   + +RN  +++
Sbjct: 517 PLVYATSFLLVSVIVALNLTAISVRNHLREK 547


>gi|294495552|ref|YP_003542045.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanohalophilus mahii DSM 5219]
 gi|292666551|gb|ADE36400.1| phosphate ABC transporter membrane protein 2, PhoT family
           [Methanohalophilus mahii DSM 5219]
          Length = 283

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 82/241 (34%), Positives = 134/241 (55%), Gaps = 3/241 (1%)

Query: 186 NYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFV 245
           ++ F      +R    GI  A+VG+ Y++ I + ++ PLG+ SAIYL E++ +      +
Sbjct: 41  SWDFLTEMPKNRMTEGGIYPALVGTAYLVGISMAVAIPLGVLSAIYLNEYAKESRSKWII 100

Query: 246 QANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTV 305
           +  INNLA  PS+V+G+ G A+ + F    + + +   L L+L+ LP +I A+  AL TV
Sbjct: 101 EMAINNLAGTPSVVFGLFGLALFVKFLAF-KPSIISASLTLSLLILPVVIRASKEALITV 159

Query: 306 PSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTD 365
           P + R A+L LG +K +T+   VLP A+P I+TG  +S+ R  GETAP++F G   F+  
Sbjct: 160 PLAHREASLALGVTKWKTIRSIVLPEALPGIVTGIILSIGRVAGETAPIMFTGAAYFLPR 219

Query: 366 YPVGVTDIATAFPVQIYLWAADA--ERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKK 423
            P  V     A P  +Y+ A             +G  L+LLI + +IN+  + +R  ++K
Sbjct: 220 LPESVFSQFMALPYHLYILATSGLNPMETRPIQYGTGLVLLILVLLINSIAIIIRKHYRK 279

Query: 424 R 424
           +
Sbjct: 280 K 280


>gi|90414595|ref|ZP_01222568.1| putative phosphate ABC transporter, permease protein
           [Photobacterium profundum 3TCK]
 gi|90324311|gb|EAS40880.1| putative phosphate ABC transporter, permease protein
           [Photobacterium profundum 3TCK]
          Length = 553

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 75/261 (28%), Positives = 125/261 (47%), Gaps = 25/261 (9%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F            G+  A+ G+++M+L++  +  PLG+ +AIYL E++ K  F+  ++  
Sbjct: 287 FLTEDPREANTEGGVFPAIFGTVFMVLLMSIIVTPLGVMAAIYLHEYAGKNGFTKLIRVA 346

Query: 249 INNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTLP 292
           + NLA VPSIVYG+ G    +                          L   L LA++TLP
Sbjct: 347 VINLAGVPSIVYGVFGLGFFVYMVGGTIDDVFFSSQLPTPTFGTPGILWSALTLAILTLP 406

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +I++T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE A
Sbjct: 407 VVIVSTEEGLARIPSSVRHGSLALGATQSETLWRIVLPMASPAIMTGLILAVARAAGEVA 466

Query: 353 PLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILLL 403
           PL+ VG+V      PV        +          IY     +          +    LL
Sbjct: 467 PLMLVGVVKMAPTLPVDGHFPYVHLDRKFMHLGYHIYDVGFQSPNVEAARPLVYATSFLL 526

Query: 404 LIFLAVINTAMLWLRNRFKKR 424
           +  +  +N   + +RN  +++
Sbjct: 527 VTVIVGLNLTAIGIRNHLREK 547


>gi|332296834|ref|YP_004438756.1| phosphate ABC transporter, inner membrane subunit PstA [Treponema
           brennaborense DSM 12168]
 gi|332179937|gb|AEE15625.1| phosphate ABC transporter, inner membrane subunit PstA [Treponema
           brennaborense DSM 12168]
          Length = 559

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 75/236 (31%), Positives = 122/236 (51%), Gaps = 5/236 (2%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F            GI   ++ +L M+++ +  S P G+ +A+YL E++ +G     ++  
Sbjct: 327 FIFEKPVDGGRFGGISSIILNTLMMIVLTLLFSVPPGLFAAVYLVEYAKEGRLMQILRLG 386

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSS 308
              LA +PSI++G+ G  + +  F       L G L LALM LP+++     AL+ VP S
Sbjct: 387 TETLAGIPSIIFGLFGMLIFVQGFGW-GICLLSGSLTLALMILPTVVRTAEEALKAVPHS 445

Query: 309 IRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPV 368
           ++  +L LG +K+QT+F  VLP A P+I  G  ++  RALGETA L++    ++  +   
Sbjct: 446 LQEGSLALGGTKIQTIFRVVLPAAFPSISAGIILATGRALGETAALIYTMGSSY--NLAH 503

Query: 369 GVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           GV D      V +YL    AE    ++ F A  +L+ F+ +IN+A   L  R   R
Sbjct: 504 GVFDSTRTLAVHVYLII--AEGISTDKAFAAGTVLIFFIFIINSAAKMLIKRIGAR 557


>gi|54307924|ref|YP_128944.1| putative phosphate ABC transporter, permease protein
           [Photobacterium profundum SS9]
 gi|46912350|emb|CAG19142.1| putative phosphate ABC transporter, permease protein
           [Photobacterium profundum SS9]
          Length = 553

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 75/261 (28%), Positives = 125/261 (47%), Gaps = 25/261 (9%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F            G+  A+ G+++M+L++  +  PLG+ +AIYL E++ K  F+  ++  
Sbjct: 287 FLTEDPREANTEGGVFPAIFGTVFMVLLMSIIVTPLGVMAAIYLHEYAGKNGFTKLIRVA 346

Query: 249 INNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTLP 292
           + NLA VPSIVYG+ G    +                          L   L LA++TLP
Sbjct: 347 VINLAGVPSIVYGVFGLGFFVYMVGGTIDDVFFSSQLPTPTFGTPGILWSALTLAILTLP 406

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +I++T   L  +PSS+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE A
Sbjct: 407 VVIVSTEEGLARIPSSVRHGSLALGATQSETLWRIVLPMASPAIMTGLILAVARAAGEVA 466

Query: 353 PLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILLL 403
           PL+ VG+V      PV        +          IY     +          +    LL
Sbjct: 467 PLMLVGVVKMAPTLPVDGHFPYVHLDRKFMHLGYHIYDVGFQSPNVEAARPLVYATSFLL 526

Query: 404 LIFLAVINTAMLWLRNRFKKR 424
           +  +  +N   + +RN  +++
Sbjct: 527 VTVIVGLNLTAIGIRNHLREK 547


>gi|294102662|ref|YP_003554520.1| phosphate ABC transporter, inner membrane subunit PstA
           [Aminobacterium colombiense DSM 12261]
 gi|293617642|gb|ADE57796.1| phosphate ABC transporter, inner membrane subunit PstA
           [Aminobacterium colombiense DSM 12261]
          Length = 283

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 130/244 (53%), Gaps = 3/244 (1%)

Query: 182 FLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFF 241
           +   ++ F            GI   ++G+L ++++ +  S P+GIA+ +YL E+S KG F
Sbjct: 38  YEALSWSFLTEPPRDNMTRGGISTPLMGTLQLVVVSMLFSLPVGIATGLYLAEYSRKGQF 97

Query: 242 SSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVA 301
           ++ ++  I +LA VPS+V+G+ G ++ +   K   S+ L  GL L  + LP I+ A+  A
Sbjct: 98  TALLRLAIRSLAGVPSVVFGLFGLSLFVILLKF-GSSLLSAGLTLGCLALPLIVTASEQA 156

Query: 302 LRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVA 361
              VP   R+A+  LGASK QT++  V P A   I+TG  +S+ R  GETAP++F G   
Sbjct: 157 FLAVPQDYRAASYALGASKWQTIWKVVFPAASSTIITGGILSIGRVAGETAPIIFTGAAY 216

Query: 362 FVTDYPVGVTDIATAFPVQIYLWAADAERPFVER--TFGAILLLLIFLAVINTAMLWLRN 419
           F       V D   A P  I + A +     + R   +G +L+LL F+  I+   + +R 
Sbjct: 217 FTPGVAKSVFDEVMALPYHIMVLATEGTNITLTRPIQYGTVLVLLAFVLGISAIGVIMRA 276

Query: 420 RFKK 423
           R K+
Sbjct: 277 RLKQ 280


>gi|320546802|ref|ZP_08041110.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus equinus ATCC 9812]
 gi|320448548|gb|EFW89283.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus equinus ATCC 9812]
          Length = 295

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 70/254 (27%), Positives = 124/254 (48%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F    +SS     GIG+ +  SL++++I + +S PL + + IYL E++ KG F+
Sbjct: 38  PYVNWSFLTGKSSSYEAGGGIGIQLYNSLFLLVITLVISIPLSMGAGIYLSEYAKKGRFT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           +F++  I  L+S+PS+V G+ G  + +  F+    + L G L L +  LP +       L
Sbjct: 98  NFIRTCIEILSSLPSVVVGLFGYLIFVVQFQ-YGFSILSGALALTVFNLPQMTRNVEDGL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM--- 359
           R V  + R A L LG S+ +TV H V+P A+P+I+TG  ++  R  GE A L++      
Sbjct: 157 RNVHHTQREAGLALGLSRWETVVHVVIPEALPSIVTGIVLASGRIFGEAAALIYTAGQSA 216

Query: 360 --------VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF-GAILLLLIFLAVI 410
                          P+ +   A    V I+   ++   P   +   G+  +LL+F+ + 
Sbjct: 217 PALDWGNWNPLSVTSPISIFRQAETLAVHIWKVNSEGTIPDATQVSQGSAAVLLVFILIF 276

Query: 411 NTAMLWLRNRFKKR 424
           N    ++  +   +
Sbjct: 277 NLLARYIGKKLHAK 290


>gi|306833541|ref|ZP_07466668.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus bovis ATCC 700338]
 gi|304424311|gb|EFM27450.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus bovis ATCC 700338]
          Length = 295

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 70/254 (27%), Positives = 125/254 (49%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              N+ F    +SS     GIG+ +  SL++++I + +S PL + + IYL E++ KG F+
Sbjct: 38  PHVNWSFLTGKSSSYQAGGGIGIQLYNSLFLLVITLIISIPLSMGAGIYLSEYAKKGRFT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           +F++  I  L+S+PS+V G+ G  + +  F+    + + G L L +  LP +       L
Sbjct: 98  NFIRTCIEILSSLPSVVVGLFGYLIFVVQFQ-YGFSIISGALALTVFNLPQMTRNVEDGL 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM--- 359
           R V  + R A L LG S+ +TV H V+P A+P+I+TG  ++  R  GE A L++      
Sbjct: 157 RNVHHTQREAGLALGLSRWETVVHVVVPEALPSIVTGIVLASGRIFGEAAALIYTAGQSA 216

Query: 360 --------VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTF-GAILLLLIFLAVI 410
                          PV +   A    V I+   ++   P   +   G+  +LL+F+ + 
Sbjct: 217 PALDWSNWNPLSVTSPVSIFRQAETLAVHIWKVNSEGTIPDATQVSQGSAAVLLVFILIF 276

Query: 411 NTAMLWLRNRFKKR 424
           N +  ++  +   +
Sbjct: 277 NLSARYIGKKLHAK 290


>gi|254506716|ref|ZP_05118856.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus 16]
 gi|219550297|gb|EED27282.1| phosphate ABC transporter, permease protein [Vibrio
           parahaemolyticus 16]
          Length = 553

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 78/298 (26%), Positives = 136/298 (45%), Gaps = 28/298 (9%)

Query: 155 LYSPANVHRMSDYQWKWF-QKLDSDGALFLDFN--YGFFINGASSRPEVAGIGVAVVGSL 211
           ++       +SD    W+  ++     +       + F  +         G+  A+ G++
Sbjct: 249 MHGDQYRIPLSDILDIWYPNQMSMLDKIGHWAQQAWKFLSSDPRESNSEGGVFPAMFGTV 308

Query: 212 YMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINF 271
            M+LI+  +  PLG+ +A+YL E++    F+  ++  + NLA VPSIVYG+ G    +  
Sbjct: 309 LMVLIMSIVVMPLGVIAAVYLHEYAKNNAFTRIIRVAVINLAGVPSIVYGVFGLGFFVYT 368

Query: 272 FK----------------MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALG 315
                                   L   L LA++TLP +I+AT   L  +PSS+R  +L 
Sbjct: 369 LGGSIDALFYTEHLPSPTFGTPGLLWSALTLAVLTLPVVIVATEEGLTRIPSSVRHGSLA 428

Query: 316 LGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG------ 369
           LGA++ +T++  VLP+A PAI+TG  +++ARA GE APL+ VG+V   +  PV       
Sbjct: 429 LGATQFETMWRIVLPMASPAIITGLILAVARAAGEVAPLMLVGVVKLASTLPVDSQFPFL 488

Query: 370 -VTDIATAFPVQIYL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
            +          IY   +            +    LL+  +  +N   + +RN  +++
Sbjct: 489 HLERKFMHLGFHIYDVGFQTTNIEAARPLVYATSFLLVTVIIGLNLTAISIRNNLREK 546


>gi|209695876|ref|YP_002263806.1| phosphate import protein, transmembrane component PstA [Aliivibrio
           salmonicida LFI1238]
 gi|208009829|emb|CAQ80137.1| phosphate import protein, transmembrane component PstA [Aliivibrio
           salmonicida LFI1238]
          Length = 509

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 72/262 (27%), Positives = 121/262 (46%), Gaps = 25/262 (9%)

Query: 188 GFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQA 247
            F            G+  A+ G++ ++L++  +  PLG+ +AIYL E++     +  V+ 
Sbjct: 242 DFLSEPPREANSEGGVFPAIFGTILLVLLMSIIVMPLGVIAAIYLHEYAKPNILTRLVRI 301

Query: 248 NINNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTL 291
            + NLA VPSIVYG+ G    +                          L   L LA++TL
Sbjct: 302 AVINLAGVPSIVYGVFGLGFFVYVVGGTIDQLFYSNQLPTPTFGTPGLLWSALTLAILTL 361

Query: 292 PSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGET 351
           P +I+AT   L  +P+S+R  +L LGA++ +T++  VLP+A PAI+TG  +++ARA GE 
Sbjct: 362 PVVIVATEEGLSRIPNSVRHGSLALGATQFETLWKIVLPMASPAIMTGLILAVARAAGEV 421

Query: 352 APLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFVERTFGAILL 402
           APL+ VG+V      P+                   IY     +          +    L
Sbjct: 422 APLMLVGVVKLAPSLPIDSVAPYLHLDRKFMHLGYHIYDVGFQSPNVEAARPIVYATAFL 481

Query: 403 LLIFLAVINTAMLWLRNRFKKR 424
           L+  +  +N   + +RN  +++
Sbjct: 482 LVTVIIGLNLTAIAIRNNLREK 503


>gi|295692225|ref|YP_003600835.1| phosphate ABC transporter, permease protein [Lactobacillus
           crispatus ST1]
 gi|295030331|emb|CBL49810.1| Phosphate ABC transporter, permease protein [Lactobacillus
           crispatus ST1]
          Length = 295

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 69/254 (27%), Positives = 115/254 (45%), Gaps = 13/254 (5%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              ++ F  + ASS     G+   +  S+Y++++   +S P+ + +AIYL E++   + +
Sbjct: 38  PHLSWHFLSSEASSYQAGGGVRDQLFNSIYLLILTTIISLPIALGAAIYLAEYAKDNWVT 97

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
           + ++  I  L+S+PSIV G+ G  + +  F     + + G L L    LP +      A+
Sbjct: 98  NLIRTTIQILSSLPSIVVGLFGYLLFVVQFGF-GFSIISGALALTFFNLPILTSNIEEAI 156

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGM--- 359
           + VP   R A L LG S  +T+   VLP A+P ILTG  +S  R  GE A L++      
Sbjct: 157 KGVPQDQREAGLALGLSNWKTIRGIVLPAALPGILTGIILSAGRIFGEAAALIYTAGQSG 216

Query: 360 --------VAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGA-ILLLLIFLAVI 410
                     F    P+ V   A    V I+    +   P       A   LL+I + V 
Sbjct: 217 STVNYADWNPFSPTSPLNVMRPAETLAVHIWKVNTEGIIPDATIVSAATSALLVIVVIVF 276

Query: 411 NTAMLWLRNRFKKR 424
           N    +L N+  ++
Sbjct: 277 NLGARYLGNKLYRK 290


>gi|317492779|ref|ZP_07951203.1| phosphate ABC transporter [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918901|gb|EFV40236.1| phosphate ABC transporter [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 557

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 78/261 (29%), Positives = 132/261 (50%), Gaps = 25/261 (9%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F ++         G+  A+ G++ M++++  +  PLG+ +A+YL E++ K +F+  ++  
Sbjct: 291 FLVDSPRESNTEGGVFPAIFGTMLMVILMSVIVMPLGVIAAVYLHEYARKNWFTRLIRIA 350

Query: 249 INNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTLP 292
           + NLA VPSIVYGI G    +                          L   L LAL+TLP
Sbjct: 351 VVNLAGVPSIVYGIFGLGFFVYVLGGSIDQLLFSESLPNPTFGTPGLLWASLTLALLTLP 410

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +I++T   L  +P+S+R  +L LGA+K +T+   VLPLA+PA+LTG  +++ARA GETA
Sbjct: 411 VVIVSTEEGLARIPASLRQGSLALGATKAETLRRVVLPLAVPAMLTGLILAIARAAGETA 470

Query: 353 PLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILLL 403
           PL+ VG+V    + P+        +         Q+Y  A  +          F    LL
Sbjct: 471 PLMLVGVVKSAPELPIDSVFPYLHLDRKFMHLGFQVYDGALQSPNVEAARPLVFATAFLL 530

Query: 404 LIFLAVINTAMLWLRNRFKKR 424
           +  +  +N A + +R+  +++
Sbjct: 531 VTLVVGLNLAAMSIRHYLREK 551


>gi|228947983|ref|ZP_04110269.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228811673|gb|EEM58008.1| ABC transporter permease protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 286

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 148/257 (57%), Gaps = 1/257 (0%)

Query: 164 MSDYQWKWFQKLDSDGALFLDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFP 223
           +                     +  FF N AS  P+ AGI  A+ G++  M IVI +SF 
Sbjct: 30  LFSIVILLILLFQIFEKGISYLSLEFFTNFASRNPKEAGIAAALSGTILFMSIVIPVSFI 89

Query: 224 LGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGG 283
            G+ +A+YLE+++ +  F   ++ N   LA VPS+V+G+LG  + +    +   + +   
Sbjct: 90  FGVGTALYLEQYAKESIFKKVIEINNQTLAGVPSVVFGLLGLTIFVYALHL-GESIIAAA 148

Query: 284 LILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVS 343
           L ++L+ LP++++A+  A+R+VP+S+  A+ GLGA+K QT++  VLP A P I+TG T++
Sbjct: 149 LTMSLLVLPTVVVASQEAIRSVPNSLLEASYGLGATKWQTMYRIVLPYAFPGIITGCTLA 208

Query: 344 LARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLL 403
           ++RA+GE APLL +G +AF    P  + D  T  P+QI+ W +  +  F       +++L
Sbjct: 209 ISRAIGEAAPLLVIGALAFANYVPFSMFDRFTVLPIQIFNWMSRPQEEFQYVAAAGMIVL 268

Query: 404 LIFLAVINTAMLWLRNR 420
           L  L +IN  +LWLRNR
Sbjct: 269 LGLLLLINIFVLWLRNR 285



 Score = 40.8 bits (94), Expect = 0.47,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 26/49 (53%)

Query: 1  MKSFSINKKNLKYRYISEWLFRFYCVVAVLVVFVFLILLLSSIVSKGIG 49
          M +    + N+  R++ + +++    +A+L   V L++LL  I  KGI 
Sbjct: 1  MLNHKKIQANMASRFLKDRIYKLLFYIAILFSIVILLILLFQIFEKGIS 49


>gi|258626946|ref|ZP_05721748.1| phosphate ABC transporter, permease protein [Vibrio mimicus VM603]
 gi|258580770|gb|EEW05717.1| phosphate ABC transporter, permease protein [Vibrio mimicus VM603]
          Length = 548

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 95/405 (23%), Positives = 176/405 (43%), Gaps = 40/405 (9%)

Query: 59  PIEFS------ETIVDPQKKRFMDPAILLRADYNLLVRKALARKLSISDSNHALLRQASQ 112
           PI F       E  +D + ++ +  A  +R   N +V + + R +S       L ++  Q
Sbjct: 138 PISFDAVDGQGEESLDLRLQQALQKAQAIREQVNTIVEQQV-RVISGDLEKLRLEKRRKQ 196

Query: 113 MLSTTARYHLRKTLMTDPSLIGKTVEVSLLASA---NIDS--ALKGYLYSPANVHRMSDY 167
           + +  +   L+  ++    L  +  +V     A    +D        +        +S+ 
Sbjct: 197 LNNQLSDEFLQNYVLRKSRLEAELSDVQAQLDALRAPLDQQFLHVADMRGQTVSVPLSEI 256

Query: 168 QWKWF-QKLDSDGALFLDFN--YGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPL 224
              W+   ++    L       + F            G+  A+ G++++++I+  +  PL
Sbjct: 257 LDFWYPNDMNFAQKLAEWGKQAWRFLSESPRESNSEGGVFPAIFGTVFLVIIMSIIVMPL 316

Query: 225 GIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFK----------- 273
           G+ +AIYL E++ +G F+  ++  + NLA VPSIVYG+ G    +               
Sbjct: 317 GVVAAIYLHEYAKEGAFTRMIRVAVINLAGVPSIVYGVFGLGFFVYTIGASVDNLFYAER 376

Query: 274 -----MPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHV 328
                      L   L LA++TLP +I+AT   L  +P+S+R  +L LGA++ +T++  V
Sbjct: 377 LPTPTFGTPGLLWSALTLAVLTLPVVIVATEEGLSRIPNSVRHGSLALGATQFETIWRIV 436

Query: 329 LPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVG-------VTDIATAFPVQI 381
           LP+A PAI+TG  +++ARA GE APL+ VG V   +  PV        +          I
Sbjct: 437 LPMASPAIITGLILAIARAAGEVAPLMLVGAVKLASSLPVDGEFPFIHLERKFMHLGFHI 496

Query: 382 YL--WAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFKKR 424
           Y   +  +         +    LL+  +  +N   + +RN  +++
Sbjct: 497 YDIGFQTNNIEAARPLVYATSFLLVTVIVALNLTAISIRNNLREK 541


>gi|85711166|ref|ZP_01042226.1| ABC-type phosphate transport system, permease component [Idiomarina
           baltica OS145]
 gi|85695079|gb|EAQ33017.1| ABC-type phosphate transport system, permease component [Idiomarina
           baltica OS145]
          Length = 553

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 70/261 (26%), Positives = 123/261 (47%), Gaps = 25/261 (9%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F            G+  A+ G+++M+L++  +  P G+ +A+YL E++ K   +  ++  
Sbjct: 287 FVSEPPREANTEGGVFPAIFGTVFMVLLMSVIVTPFGVVAAVYLHEYAGKNPVTKLIRIA 346

Query: 249 INNLASVPSIVYGILGSAVLINFFK----------------MPRSTALVGGLILALMTLP 292
           + NLA VPSIVYG+ G    +                          L   + LA++TLP
Sbjct: 347 VINLAGVPSIVYGVFGLGFFVYMVGGSIDQVFYPEALPNPTFGTPGVLWSAITLAILTLP 406

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +I++T   L  +PSS+R  +L LGA+K +T++  ++P+A PAI+TG  +++ARA GE A
Sbjct: 407 VVIVSTEEGLARIPSSLREGSLALGATKWETIWRIIVPMASPAIMTGLILAVARAAGEVA 466

Query: 353 PLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILLL 403
           PL+ VG+V      PV        +          IY     +          +    LL
Sbjct: 467 PLMLVGVVKSAPMLPVDGNFPYFHLDRKFMHLGFHIYDVGFQSPNVEASRPLVYATSFLL 526

Query: 404 LIFLAVINTAMLWLRNRFKKR 424
           +  +  +N   + +RN  +++
Sbjct: 527 ITVIVGLNLTAIGVRNHLREK 547


>gi|312622594|ref|YP_004024207.1| phosphate ABC transporter inner membrane subunit PstA
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203061|gb|ADQ46388.1| phosphate ABC transporter, inner membrane subunit PstA
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 280

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 74/241 (30%), Positives = 126/241 (52%), Gaps = 5/241 (2%)

Query: 183 LDFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFS 242
              +  F +       +  GI   +VG+LY+ L+ + ++ P+G+ +AIYL E++ KG   
Sbjct: 40  KGISLSFILQYPEEMGKSGGIFPVIVGTLYVTLLAVIIASPVGVLAAIYLTEYAKKGKAV 99

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVAL 302
             ++     LA +PSI+YG+ G A  +      R + L G L L++M LP+II  +  A+
Sbjct: 100 ELIRFGTETLAGIPSIIYGLFGFAFFVIALGF-RWSILSGALTLSIMILPTIIRTSEEAI 158

Query: 303 RTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAF 362
           +TVP S R  +L LGA+K QT+   V+P AMP ILTG  + + RA+GETA +L     + 
Sbjct: 159 KTVPMSFREGSLALGATKWQTIAKVVIPPAMPGILTGVILGVGRAIGETAAVLLTAGSSL 218

Query: 363 VTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK 422
             ++P  +        V +Y+    +E      ++    LL++ + +IN     +  R+ 
Sbjct: 219 --NFPTSIFSPTRTMSVHLYIL--SSEGISKLNSYATATLLIVIVFIINMFANMIIRRYN 274

Query: 423 K 423
           +
Sbjct: 275 R 275


>gi|115377153|ref|ZP_01464367.1| phosphate ABC transporter, permease protein PstA [Stigmatella
           aurantiaca DW4/3-1]
 gi|310822865|ref|YP_003955223.1| phosphate ABC transporter permease psta [Stigmatella aurantiaca
           DW4/3-1]
 gi|115365862|gb|EAU64883.1| phosphate ABC transporter, permease protein PstA [Stigmatella
           aurantiaca DW4/3-1]
 gi|309395937|gb|ADO73396.1| Phosphate ABC transporter, permease protein PstA [Stigmatella
           aurantiaca DW4/3-1]
          Length = 303

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/250 (30%), Positives = 124/250 (49%), Gaps = 16/250 (6%)

Query: 184 DFNYGFFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFS-HKGFFS 242
              + F     S      GI  A+ G+  + L++     P+G+ +A+YL E++      +
Sbjct: 42  HVTWEFLSQPPSDGMMRGGIFPALYGTAALTLLMTLAVMPVGVLTAVYLHEYASPDSRLA 101

Query: 243 SFVQANINNLASVPSIVYGILGSAVLINF-------------FKMPRSTALVGGLILALM 289
            +V+  I NLA VPSIV+G+ G    I+F                 + + L   L LA++
Sbjct: 102 RWVRVAIVNLAGVPSIVFGLFGLGFFIHFVGGGMDRMMGYQTMHWAQPSILWASLTLAVL 161

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP +I++T  ALR VP   R+A+L LGA++ QT+   VLP A+P ILTG+ ++++R  G
Sbjct: 162 TLPVVIVSTEEALRAVPMDHRTASLALGATQSQTLMRVVLPGALPGILTGAVLAVSRGAG 221

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAE--RPFVERTFGAILLLLIFL 407
           E AP+LF G   F+ D P  ++          Y+ A  +          +  +L+LL+  
Sbjct: 222 EVAPILFTGAAYFLPDLPTSLSSQFMHLGYHTYVLATQSPDIEATRPLLYATVLVLLMLT 281

Query: 408 AVINTAMLWL 417
             +N   + +
Sbjct: 282 FALNLVAVVI 291


>gi|327400758|ref|YP_004341597.1| phosphate ABC transporter inner membrane subunit PstA
           [Archaeoglobus veneficus SNP6]
 gi|327316266|gb|AEA46882.1| phosphate ABC transporter, inner membrane subunit PstA
           [Archaeoglobus veneficus SNP6]
          Length = 280

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 81/237 (34%), Positives = 130/237 (54%), Gaps = 4/237 (1%)

Query: 192 NGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQANINN 251
           N         GI  A++G++Y+ ++    S PLG+ +AI+L E++  G     ++  I N
Sbjct: 45  NWEHRDITKGGIFPAILGTIYVTVMTAVFSIPLGVGAAIFLNEYARAGRTVRLIKMAIRN 104

Query: 252 LASVPSIVYGILGSAVLINFFKMPRSTALVGGLILALMTLPSIIIATGVALRTVPSSIRS 311
           LA VPS+VYG+ G A  + FF     + +   L LA+MTLP +I ++  AL+ VP+  R 
Sbjct: 105 LAGVPSVVYGLFGLAAFVYFFGF-GESIIAASLTLAVMTLPWVITSSEEALKGVPNDFRL 163

Query: 312 AALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETAPLLFVGMVAFVTDYPVGVT 371
           A+  LGA+K QT+ + +LP A+P +LTG+ + LARA+GETAPLLF G V ++   P    
Sbjct: 164 ASYALGATKWQTIKNAILPYALPGVLTGAIIGLARAMGETAPLLFTGAVFYIRRLPNSPF 223

Query: 372 DIATAFPVQIYLWAAD-AERPFVERTFGAILLLLIFLAVINTAMLWLRNRFK--KRW 425
           D   + P   Y+ A   A             +L+  + ++  +   +R R++  +RW
Sbjct: 224 DRFMSLPYHTYVLATQHASPYAKTYAAATATVLIAIVFIMIASATIIRYRYRKARRW 280


>gi|51597116|ref|YP_071307.1| ABC phosphate transporter, permease subunit [Yersinia
           pseudotuberculosis IP 32953]
 gi|51590398|emb|CAH22038.1| putative ABC phosphate transporter, permease subunit [Yersinia
           pseudotuberculosis IP 32953]
          Length = 570

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 78/261 (29%), Positives = 131/261 (50%), Gaps = 25/261 (9%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F  +   +     G+  A+ G++ M++++  +  PLG+ +A+YL E++ K + +  ++ +
Sbjct: 304 FLTDNPYNASSEGGVFPAIFGTVLMVILMSIVVMPLGVIAAVYLHEYAGKNWLTRLIRIS 363

Query: 249 INNLASVPSIVYGILGSAVLINFFKMPRSTALVGGLIL----------------ALMTLP 292
           + NLA VPSIVYG+ G    +               +                 AL+TLP
Sbjct: 364 VVNLAGVPSIVYGVFGLGFFVYLIGGSLDKLFYAESLPNPTFGTPGVLWAALTLALLTLP 423

Query: 293 SIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALGETA 352
            +I+AT   L  +P+S+R  +  LGASK +T++H VLP+A PA+LTG  +++ARA GETA
Sbjct: 424 VVIVATEEGLARIPTSLRQGSQALGASKAETLWHIVLPMAAPAMLTGLILAVARAAGETA 483

Query: 353 PLLFVGMVAFVTDYPVG-------VTDIATAFPVQIYLWAADAE--RPFVERTFGAILLL 403
           PL+ VG+V      PV        +         QIY  A  +          F   LLL
Sbjct: 484 PLMLVGVVKSAPVLPVDGIFPFLHLERKFMHLSFQIYDMAFQSPNVEAARPLVFATALLL 543

Query: 404 LIFLAVINTAMLWLRNRFKKR 424
           +I +  +N A + +R+  +++
Sbjct: 544 VIIVVGLNLAAMGIRHHLREK 564


>gi|187735797|ref|YP_001877909.1| phosphate ABC transporter, inner membrane subunit PstA [Akkermansia
           muciniphila ATCC BAA-835]
 gi|187425849|gb|ACD05128.1| phosphate ABC transporter, inner membrane subunit PstA [Akkermansia
           muciniphila ATCC BAA-835]
          Length = 584

 Score =  161 bits (408), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 81/264 (30%), Positives = 121/264 (45%), Gaps = 28/264 (10%)

Query: 189 FFINGASSRPEVAGIGVAVVGSLYMMLIVIGLSFPLGIASAIYLEEFSHKGFFSSFVQAN 248
           F  +         GI  A+ G+  M L++  L  P+G+  AIYL E++ +G     V+  
Sbjct: 315 FITDDPREANTEGGIFPAIFGTFIMTLLMSVLVTPVGVIGAIYLREYARQGALVQAVRIC 374

Query: 249 INNLASVPSIVYGILGSAVLINFFK-------------------MPRSTALVGGLILALM 289
           +NNLA VPSIV+G+ G    + +                        S  L   L LALM
Sbjct: 375 VNNLAGVPSIVFGVFGLGFFVYYLGGSIDELFYWKKLAVDNTPTFGTSGILWASLTLALM 434

Query: 290 TLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGSTVSLARALG 349
           TLP +I++T  AL  VP  +R AAL  GASK Q +   +LP A+P ++TG  +++AR  G
Sbjct: 435 TLPVVIVSTEEALSAVPRGLREAALACGASKWQMIKRIILPSALPGVMTGLILAMARGAG 494

Query: 350 ETAPLLFVGMVAFVTDYPVGVTDI-------ATAFPVQIYLWAADAE--RPFVERTFGAI 400
           E APL+  G+V      P+                   IY     +          F   
Sbjct: 495 EVAPLMVTGVVKLAPSLPIDGEGPFIHLERKFMHLGFHIYDVGFQSPDSDAAQPMVFATT 554

Query: 401 LLLLIFLAVINTAMLWLRNRFKKR 424
           LLL++ + V+N   + +RNR +K+
Sbjct: 555 LLLILLVVVMNLTAILIRNRLRKK 578


>gi|227894586|ref|ZP_04012391.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus ultunensis DSM 16047]
 gi|315037595|ref|YP_004031163.1| phosphate ABC transporter, permease protein PstA [Lactobacillus
           amylovorus GRL 1112]
 gi|227863577|gb|EEJ70998.1| phosphate ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus ultunensis DSM 16047]
 gi|312275728|gb|ADQ58368.1| phosphate ABC transporter, permease protein PstA [Lactobacillus
           amylovorus GRL 1112]
 gi|327182891|gb|AEA31338.1| phosphate ABC transporter, permease protein PstA [Lactobacillus