RPSBLAST alignment for GI: 254780705 and conserved domain: pfam00528

>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component. The alignments cover the most conserved region of the proteins, which is thought to be located in a cytoplasmic loop between two transmembrane domains. The members of this family have a variable number of transmembrane helices. Length = 183
 Score = 57.7 bits (140), Expect = 5e-09
 Identities = 50/204 (24%), Positives = 81/204 (39%), Gaps = 24/204 (11%)

Query: 221 SFPLGIASAIYLEEFSHKGFFSSFVQANINNLASVPSIVYGILGSAVLINFFKMPRSTAL 280
             PLGI +A+              ++  I+ L ++PS V  IL   V+I+   +     L
Sbjct: 1   GIPLGIIAALR-----RGRRLDRLLRPLIDLLQALPSFVLAIL--LVVISILSILGHGIL 53

Query: 281 VGGLILALMTLPSIIIATGVALRTVPSSIRSAALGLGASKVQTVFHHVLPLAMPAILTGS 340
              ++  L       +    ALR++PS +  AA  LGAS+ Q     +LP A+P ILTG 
Sbjct: 54  PAIILALLGWAGYARLIRRAALRSLPSDLVEAARALGASRWQIFRKIILPNALPPILTGL 113

Query: 341 TVSLARALGETAPLLFVGMVAFVTDYPVGVTDIATAFPVQIYLWAADAERPFVERTFGAI 400
            ++   A